A0A5K4F7A9_SCHMA Loading...

BAH domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4F7A9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 123 aa.

						>A0A5K4F7A9_SCHMA|A0A5K4F7A9
MQKHPDRNWILIFLRTQSHRYVNAEDNHLTETSDTDEYDSKFKIAWNSTSNRVHVFSPKLVWALRDVKLGERLLVTGFLSYYRSRKPDGTTQRNCCVTAQRIAYMGWSNDYQSSENLEEVLET
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.9	Very low	64.6	Low	237 Å²	237	126.3 Å²	126.3	100%	1.167	60%	0.597	S	S	*	*				0	98.8	0	-79.9	-179.7	170	0	0	108.6	K3	M1-K3 PolarHBondContact O-N 3.42Å; M1-K3 VanDerWaalsContact O-N 3.09Å
2	Q	40.4	Very low	67	Low	182 Å²	182	118.2 Å²	118.2	85%	0.85	56%	0.559	S	S	*	*			trans	-66.4	106	170.4	-86.3	171.8	-29.3	0	0	108	H4	Q2-H4 PolarHBondContact O-N 3.3Å
3	K	48.1	Very low	68.9	Low	185 Å²	185	117.7 Å²	117.7	80%	0.804	55%	0.554	S	S	*	*			trans	-74.8	105.5	170.3	-75.2	179.7	175.9	178.9	0	106.6	M1 P5	M1-K3 PolarHBondContact O-N 3.42Å; M1-K3 VanDerWaalsContact O-N 3.09Å; K3-P5 WeakPolarHBondContact O-CD 3.27Å
4	H	56.9	Low	70.6	Confident	104 Å²	104	111.5 Å²	111.5	48%	0.481	53%	0.526	S	S	.	.			trans	-67.1	106.5	164.9	-70.5	-76.1	0	0	0	107.6	Q2 D6 R7 N8	Q2-H4 PolarHBondContact O-N 3.3Å; H4-D6 PolarHBondContact O-N 3.23Å; H4-R7 HydrophobicContact CB-CG 4.24Å; H4-R7 PolarHBondContact O-N 2.86Å; H4-N8 PolarHBondContact O-ND2 3.2Å
5	P	55.6	Low	72	Confident	84 Å²	84	115.1 Å²	115.1	55%	0.545	53%	0.533	S	S	.	.	G	3₁₀ helix	trans	-62.8	-31.1	-176.9	26.9	-32.7	0	0	0	111.3	K3 R7 N8	K3-P5 WeakPolarHBondContact O-CD 3.27Å; P5-R7 PolarHBondContact O-N 3.29Å; P5-R7 VanDerWaalsContact O-N 3.14Å; P5-N8 PolarHBondContact O-N 3.04Å
6	D	56.9	Low	73.1	Confident	122 Å²	122	111.8 Å²	111.8	65%	0.652	52%	0.523	S	S	*	.	G	3₁₀ helix	trans	-67.3	-15.8	-175.4	-48.5	-39.6	0	0	0	113.4	H4	H4-D6 PolarHBondContact O-N 3.23Å
7	R	62	Low	73.8	Confident	175 Å²	175	110 Å²	110	66%	0.66	52%	0.515	S	S	*	.	G	3₁₀ helix	trans	-91.6	-1.1	178.9	-68.9	-172.1	176.6	-175.2	-0.9	114.6	H4 P5	H4-R7 HydrophobicContact CB-CG 4.24Å; H4-R7 PolarHBondContact O-N 2.86Å; P5-R7 PolarHBondContact O-N 3.29Å; P5-R7 VanDerWaalsContact O-N 3.14Å
8	N	78.9	Confident	74.4	Confident	68 Å²	68	107 Å²	107	36%	0.364	51%	0.508	S	S	.	.	S	Bend	trans	-100.8	4.7	-170.6	-62.8	-41.6	0	0	0	114	H4 P5 F56	H4-N8 PolarHBondContact O-ND2 3.2Å; P5-N8 PolarHBondContact O-N 3.04Å; N8-F56 CarbonylContact O-C 3.6Å
9	W	88.5	Confident	74.8	Confident	120 Å²	120	106.9 Å²	106.9	46%	0.455	51%	0.507	S	S	.	.			trans	-144.8	158.6	179.7	68.6	-76.5	0	0	0	111.9	L11 V55 F56	W9-L11 HydrophobicContact CZ3-CB 3.99Å; W9-V55 CarbonylContact C-O 3.57Å; W9-V55 WeakPolarHBondContact CA-O 3.36Å; W9-V55 WeakPolarHBondContact CB-O 3.2Å; W9-F56 HydrophobicContact CB-CD1 3.76Å; W9-F56 HydrophobicContact CB-CE1 4.18Å
10	I	89.9	Confident	75.1	Confident	46 Å²	46	109.5 Å²	109.5	24%	0.236	51%	0.511	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.2	143.9	172	-172.9	173.3	0	0	0	109.2	I12 V55 V61 L64	I10-I12 HydrophobicContact CD1-CG2 4Å; I10-I12 HydrophobicContact CG1-CG2 4.01Å; I10-V55 HydrophobicContact CG2-CB 3.61Å; I10-V55 HydrophobicContact CG2-CG1 4.23Å; I10-V55 HydrophobicContact CG2-CG2 3.94Å; I10-V55 PolarHBondContact N-O 3.37Å; I10-V55 PolarHBondContact O-N 3.27Å; I10-V61 HydrophobicContact CB-CG1 4.45Å; I10-V61 HydrophobicContact CG2-CB 4.46Å; I10-V61 HydrophobicContact CG2-CG1 4.42Å; I10-V61 HydrophobicContact CG2-CG2 4.09Å; I10-L64 HydrophobicContact CD1-CB 4.21Å; I10-L64 HydrophobicContact CG2-CB 4.42Å; I10-L64 HydrophobicContact CG2-CD1 3.54Å
11	L	91.2	Very high	75.3	Confident	66 Å²	66	111.1 Å²	111.1	35%	0.346	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.1	125.9	170.5	-177.9	62.5	0	0	0	108.4	W9 F13 R52 H54	W9-L11 HydrophobicContact CZ3-CB 3.99Å; L11-F13 HydrophobicContact CD2-CE2 4.04Å; L11-F13 HydrophobicContact CD2-CZ 4.41Å; L11-F13 HydrophobicContact CG-CE2 4.2Å; L11-R52 HydrophobicContact CD1-CG 3.46Å; L11-R52 VanDerWaalsContact CD1-CG 3.46Å; L11-H54 WeakPolarHBondContact CD1-CD2 3.36Å; L11-H54 WeakPolarHBondContact CD1-NE2 3.45Å
12	I	92.3	Very high	77	Confident	29 Å²	29	100.9 Å²	100.9	15%	0.149	47%	0.465	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.4	150.7	172	66.3	179.8	0	0	0	110.1	I10 L14 V53 L64 L73	I10-I12 HydrophobicContact CD1-CG2 4Å; I10-I12 HydrophobicContact CG1-CG2 4.01Å; I12-L14 HydrophobicContact CD1-CD1 4.32Å; I12-L14 HydrophobicContact CD1-CD2 4.07Å; I12-L14 HydrophobicContact CD1-CG 4.16Å; I12-L14 HydrophobicContact CG1-CG 4.35Å; I12-V53 HydrophobicContact CD1-CB 4.31Å; I12-V53 HydrophobicContact CD1-CG1 4.38Å; I12-V53 HydrophobicContact CG1-CB 3.67Å; I12-V53 HydrophobicContact CG1-CG1 4.16Å; I12-V53 HydrophobicContact CG1-CG2 4.38Å; I12-V53 PolarHBondContact N-O 3.4Å; I12-V53 PolarHBondContact O-N 3.33Å; I12-L64 HydrophobicContact CD1-CD1 4.18Å; I12-L64 HydrophobicContact CD1-CD2 4.42Å; I12-L73 HydrophobicContact CD1-CD1 4.05Å
13	F	92.5	Very high	78.7	Confident	112 Å²	112	95.7 Å²	95.7	49%	0.491	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109	118.5	171	-71.9	-91.8	0	0	0	108.6	L11 N51 R52	L11-F13 HydrophobicContact CD2-CE2 4.04Å; L11-F13 HydrophobicContact CD2-CZ 4.41Å; L11-F13 HydrophobicContact CG-CE2 4.2Å; F13-N51 WeakPolarHBondContact CA-O 3.15Å; F13-R52 HydrophobicContact CD1-CB 4.39Å; F13-R52 HydrophobicContact CE1-CB 4.08Å; F13-R52 HydrophobicContact CE1-CG 4.19Å; F13-R52 HydrophobicContact CZ-CG 4.37Å
14	L	92.3	Very high	79.6	Confident	31 Å²	31	88.8 Å²	88.8	16%	0.162	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.5	120.8	178.5	-66.5	-174.8	0	0	0	110.3	I12 T16 N51 V53 L73 V75	I12-L14 HydrophobicContact CD1-CD1 4.32Å; I12-L14 HydrophobicContact CD1-CD2 4.07Å; I12-L14 HydrophobicContact CD1-CG 4.16Å; I12-L14 HydrophobicContact CG1-CG 4.35Å; L14-T16 PolarHBondContact O-N 3.36Å; L14-N51 PolarHBondContact N-O 2.84Å; L14-N51 PolarHBondContact O-N 3.12Å; L14-V53 HydrophobicContact CD1-CG2 3.96Å; L14-V53 HydrophobicContact CG-CG2 4.11Å; L14-L73 HydrophobicContact CD1-CB 4.27Å; L14-L73 HydrophobicContact CD2-CB 4.35Å; L14-L73 HydrophobicContact CD2-CD1 4.05Å; L14-V75 HydrophobicContact CD1-CB 4.27Å; L14-V75 HydrophobicContact CD1-CG2 3.36Å
15	R	91.7	Very high	80.2	Confident	166 Å²	166	91.6 Å²	91.6	63%	0.626	43%	0.433	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.7	124.6	165.8	-172.9	179.9	-179.2	-170.4	-0.1	108.4	S48 T49	R15-S48 WeakPolarHBondContact CG-OG 3.41Å; R15-S48 PolarHBondContact NE-OG 2.86Å; R15-T49 CarbonylContact C-O 3.52Å; R15-T49 WeakPolarHBondContact CA-O 3.36Å
16	T	89.3	Confident	80.5	Confident	61 Å²	61	92.1 Å²	92.1	37%	0.374	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120	123.1	175.2	-52.1	0	0	0	0	108.2	L14 T49 N51	L14-T16 PolarHBondContact O-N 3.36Å; T16-T49 PolarHBondContact N-O 2.85Å; T16-T49 PolarHBondContact O-N 2.83Å; T16-T49 PolarHBondContact O-OG1 2.78Å; T16-N51 WeakPolarHBondContact CB-ND2 3.3Å; T16-N51 PolarHBondContact OG1-ND2 3.29Å
17	Q	86	Confident	80.5	Confident	82 Å²	82	93.8 Å²	93.8	38%	0.383	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.6	126.2	169.8	-76.2	171.6	-38	0	0	108.9	W46 N47	Q17-W46 HydrophobicContact CB-CE3 4.16Å; Q17-N47 VanDerWaalsContact CA-O 3.32Å; Q17-N47 WeakPolarHBondContact CA-O 3.45Å
18	S	84.3	Confident	80.2	Confident	56 Å²	56	93.5 Å²	93.5	39%	0.392	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	140.7	171	56.8	0	0	0	0	109.7	N47	S18-N47 PolarHBondContact N-O 2.88Å; S18-N47 PolarHBondContact O-N 3.14Å
19	H	81.8	Confident	78.9	Confident	106 Å²	106	94.1 Å²	94.1	49%	0.491	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.2	137.8	169.9	58.8	-93.6	0	0	0	108.9	Y21 I44 W46	H19-Y21 AromaticContact CD2-CE2 3.76Å; H19-I44 HydrophobicContact CB-CG2 3.77Å; H19-W46 HydrophobicContact CB-CE3 4.5Å; H19-W46 HydrophobicContact CB-CZ3 4.33Å
20	R	80.9	Confident	77.2	Confident	157 Å²	157	95 Å²	95	59%	0.592	47%	0.468	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-124.9	127.9	167.6	-179.2	178.4	176.8	-179	-2.7	107.6	V22 A45 N47	R20-V22 HydrophobicContact CG-CG2 4.2Å; R20-V22 PolarHBondContact O-N 3.36Å; R20-A45 PolarHBondContact N-O 2.95Å; R20-A45 PolarHBondContact O-N 2.87Å; R20-N47 VanDerWaalsContact CD-ND2 3.34Å; R20-N47 WeakPolarHBondContact CD-ND2 3.25Å
21	Y	79.5	Confident	75.3	Confident	144 Å²	144	100 Å²	100	57%	0.565	49%	0.491	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.5	122.2	168.4	-63.3	-83.4	0	0	0	108.5	H19 F42 I44	H19-Y21 AromaticContact CD2-CE2 3.76Å; Y21-F42 HydrophobicContact CD1-CB 4.3Å; Y21-I44 HydrophobicContact CD1-CG1 4.05Å; Y21-I44 HydrophobicContact CE1-CD1 4.16Å; Y21-I44 HydrophobicContact CE1-CG1 3.77Å
22	V	78.5	Confident	73.4	Confident	23 Å²	23	103.7 Å²	103.7	14%	0.139	52%	0.516	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	140.3	177.9	-174.4	0	0	0	0	108	R20 A24 D26 L29 F42 K43 A45	R20-V22 HydrophobicContact CG-CG2 4.2Å; R20-V22 PolarHBondContact O-N 3.36Å; V22-A24 PolarHBondContact O-N 3.19Å; V22-D26 HydrophobicContact CG1-CB 4.2Å; V22-L29 HydrophobicContact CB-CD1 3.9Å; V22-L29 HydrophobicContact CG1-CD1 3.75Å; V22-L29 HydrophobicContact CG2-CD1 4.25Å; V22-F42 CarbonylContact O-C 3.51Å; V22-F42 VanDerWaalsContact O-CA 3.25Å; V22-F42 WeakPolarHBondContact O-CA 3.46Å; V22-K43 PolarHBondContact N-O 2.84Å; V22-K43 PolarHBondContact O-N 2.81Å; V22-A45 HydrophobicContact CG2-CB 3.62Å
23	N	75.5	Confident	71.4	Confident	72 Å²	72	105.4 Å²	105.4	39%	0.385	53%	0.53	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.5	131.2	177.3	-168.9	-16.4	0	0	0	109.2	E25 D26 K41 F42	N23-E25 PolarHBondContact O-N 2.77Å; N23-E25 VanDerWaalsContact O-N 3.09Å; N23-E25 PolarHBondContact OD1-N 2.81Å; N23-D26 PolarHBondContact O-N 3.28Å; N23-D26 VanDerWaalsContact O-N 3.1Å; N23-K41 WeakPolarHBondContact CA-O 3.32Å; N23-K41 PolarHBondContact OD1-O 3.27Å; N23-K41 VanDerWaalsContact OD1-O 3.14Å; N23-F42 HydrophobicContact CB-CE1 4.45Å
24	A	66.8	Low	69.4	Low	40 Å²	40	108.1 Å²	108.1	33%	0.331	55%	0.55	S	S	.	*	T	Hydrogen-bonded Turn	trans	-61.8	-17.7	-176.4	0	0	0	0	0	113.4	V22 D26 K41 K43	V22-A24 PolarHBondContact O-N 3.19Å; A24-D26 VanDerWaalsContact C-N 3.35Å; A24-K41 PolarHBondContact N-O 3.43Å; A24-K43 HydrophobicContact CB-CD 4.46Å; A24-K43 HydrophobicContact CB-CG 4.2Å
25	E	69.4	Low	67.3	Low	163 Å²	163	112.9 Å²	112.9	76%	0.762	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.8	-5.8	177.6	-62.4	179.6	174	0	0	114.2	N23 N27	N23-E25 PolarHBondContact O-N 2.77Å; N23-E25 VanDerWaalsContact O-N 3.09Å; N23-E25 PolarHBondContact OD1-N 2.81Å; E25-N27 PolarHBondContact O-N 2.82Å
26	D	62.3	Low	65.4	Low	96 Å²	96	112.7 Å²	112.7	51%	0.513	59%	0.592	S	S	.	*			trans	-83.3	101	179.7	-146.3	-7.7	0	0	0	110.3	V22 N23 A24 H28	V22-D26 HydrophobicContact CG1-CB 4.2Å; N23-D26 PolarHBondContact O-N 3.28Å; N23-D26 VanDerWaalsContact O-N 3.1Å; A24-D26 VanDerWaalsContact C-N 3.35Å; D26-H28 PolarHBondContact O-N 3.26Å
27	N	57.8	Low	63.5	Low	156 Å²	156	119 Å²	119	83%	0.834	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.1	17.3	-169.6	-86.2	-21.5	0	0	0	116.9	E25	E25-N27 PolarHBondContact O-N 2.82Å
28	H	55.7	Low	61.9	Low	170 Å²	170	125.9 Å²	125.9	79%	0.787	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111.2	14.9	-172.5	-73.3	-54.4	0	0	0	115.3	D26	D26-H28 PolarHBondContact O-N 3.26Å
29	L	51.6	Low	60.4	Low	80 Å²	80	128.4 Å²	128.4	42%	0.419	65%	0.651	S	S	.	*			trans	-114.6	114.6	-178.9	-72.9	165.9	0	0	0	112	V22 E31 A45	V22-L29 HydrophobicContact CB-CD1 3.9Å; V22-L29 HydrophobicContact CG1-CD1 3.75Å; V22-L29 HydrophobicContact CG2-CD1 4.25Å; L29-E31 PolarHBondContact O-N 3.09Å; L29-A45 HydrophobicContact CD1-CB 4.27Å; L29-A45 HydrophobicContact CD2-CB 4.13Å
30	T	52.9	Low	59.4	Low	140 Å²	140	129.2 Å²	129.2	86%	0.859	67%	0.668	S	S	*	*			trans	-61.8	116.7	161.7	39.1	0	0	0	0	109	T32	T30-T32 PolarHBondContact O-N 3.47Å
31	E	48.4	Very low	58.9	Low	150 Å²	150	128.5 Å²	128.5	70%	0.701	67%	0.669	S	S	*	*			trans	-66.3	116.9	-175.2	-67.6	-177.3	137.9	0	0	112.5	L29 K43	L29-E31 PolarHBondContact O-N 3.09Å; E31-K43 IonicContact OE1-NZ 2.78Å; E31-K43 PolarHBondContact OE1-NZ 3.38Å
32	T	51.9	Low	58.4	Low	144 Å²	144	126.3 Å²	126.3	88%	0.883	66%	0.663	S	S	*	*			trans	-139.6	84.4	147.9	52.2	0	0	0	0	107.1	T30	T30-T32 PolarHBondContact O-N 3.47Å
33	S	50.8	Low	58.2	Low	64 Å²	64	128.4 Å²	128.4	45%	0.448	67%	0.67	S	S	.	*			trans	-137.3	105.9	167.5	63.6	0	0	0	0	108.7	T35	S33-T35 PolarHBondContact O-N 2.81Å
34	D	50.4	Low	58.4	Low	169 Å²	169	129 Å²	129	90%	0.904	67%	0.673	S	S	*	*			trans	-52.9	123.6	158.2	-84.5	-37.2	0	0	0	108.1	D36	D34-D36 PolarHBondContact O-N 3.34Å
35	T	48	Very low	59.1	Low	132 Å²	132	127.7 Å²	127.7	81%	0.81	66%	0.662	S	S	*	*			trans	-67.8	105.1	179.3	33.6	0	0	0	0	110.5	S33	S33-T35 PolarHBondContact O-N 2.81Å
36	D	51.9	Low	59.6	Low	161 Å²	161	128 Å²	128	86%	0.861	66%	0.656	S	S	*	*			trans	-100.3	120	147.5	-87	-29.3	0	0	0	108.2	D34 Y38	D34-D36 PolarHBondContact O-N 3.34Å; D36-Y38 VanDerWaalsContact C-N 3.3Å; D36-Y38 PolarHBondContact O-N 3.47Å
37	E	49.1	Very low	60.6	Low	195 Å²	195	126.4 Å²	126.4	91%	0.911	65%	0.647	S	S	*	*	S	Bend	trans	-65	73.9	-175.3	-125.1	178.8	178.8	0	0	111.7
38	Y	51.9	Low	61.9	Low	226 Å²	226	122 Å²	122	89%	0.886	63%	0.628	S	S	*	*	S	Bend	trans	-148	107.3	165.3	-123.2	-94.2	0	0	0	109.8	D36	D36-Y38 VanDerWaalsContact C-N 3.3Å; D36-Y38 PolarHBondContact O-N 3.47Å
39	D	53.4	Low	63.4	Low	109 Å²	109	116.9 Å²	116.9	58%	0.583	61%	0.61	S	S	*	*			trans	80.6	77.2	176	-124.4	-9.6	0	0	0	116.6	K41 F42	D39-K41 PolarHBondContact O-N 3.19Å; D39-F42 PolarHBondContact O-N 2.85Å
40	S	59.8	Low	65.3	Low	123 Å²	123	117.1 Å²	117.1	86%	0.86	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.6	-5.3	179.1	54.2	0	0	0	0	116.1
41	K	70.6	Confident	67.1	Low	141 Å²	141	113.5 Å²	113.5	61%	0.613	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.5	-17.7	176.2	-69.5	-177.4	178.9	179.4	0	113.6	N23 A24 D39	N23-K41 WeakPolarHBondContact CA-O 3.32Å; N23-K41 PolarHBondContact OD1-O 3.27Å; N23-K41 VanDerWaalsContact OD1-O 3.14Å; A24-K41 PolarHBondContact N-O 3.43Å; D39-K41 PolarHBondContact O-N 3.19Å
42	F	69.1	Low	69.3	Low	99 Å²	99	109.4 Å²	109.4	43%	0.434	57%	0.571	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-130.3	131.3	-174.3	-62	-77.5	0	0	0	111.9	Y21 V22 N23 D39	Y21-F42 HydrophobicContact CD1-CB 4.3Å; V22-F42 CarbonylContact O-C 3.51Å; V22-F42 VanDerWaalsContact O-CA 3.25Å; V22-F42 WeakPolarHBondContact O-CA 3.46Å; N23-F42 HydrophobicContact CB-CE1 4.45Å; D39-F42 PolarHBondContact O-N 2.85Å
43	K	74.7	Confident	71.4	Confident	66 Å²	66	102.7 Å²	102.7	29%	0.287	53%	0.53	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.3	142.3	167.6	-69.4	-178.8	174.7	-178.1	0	108.9	V22 A24 E31 A45	V22-K43 PolarHBondContact N-O 2.84Å; V22-K43 PolarHBondContact O-N 2.81Å; A24-K43 HydrophobicContact CB-CD 4.46Å; A24-K43 HydrophobicContact CB-CG 4.2Å; E31-K43 IonicContact OE1-NZ 2.78Å; E31-K43 PolarHBondContact OE1-NZ 3.38Å; K43-A45 PolarHBondContact O-N 3.04Å
44	I	79.6	Confident	73.5	Confident	86 Å²	86	100.7 Å²	100.7	44%	0.441	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.4	114.8	171.6	-66.2	173.3	0	0	0	108.3	H19 Y21	H19-I44 HydrophobicContact CB-CG2 3.77Å; Y21-I44 HydrophobicContact CD1-CG1 4.05Å; Y21-I44 HydrophobicContact CE1-CD1 4.16Å; Y21-I44 HydrophobicContact CE1-CG1 3.77Å
45	A	81.7	Confident	75.6	Confident	12 Å²	12	92.7 Å²	92.7	10%	0.099	47%	0.471	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	135.5	168.6	0	0	0	0	0	109.9	R20 V22 L29 K43	R20-A45 PolarHBondContact N-O 2.95Å; R20-A45 PolarHBondContact O-N 2.87Å; V22-A45 HydrophobicContact CG2-CB 3.62Å; L29-A45 HydrophobicContact CD1-CB 4.27Å; L29-A45 HydrophobicContact CD2-CB 4.13Å; K43-A45 PolarHBondContact O-N 3.04Å
46	W	81.2	Confident	77.6	Confident	169 Å²	169	91.7 Å²	91.7	64%	0.64	46%	0.455	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89.7	114.4	175.9	-70.5	100.1	0	0	0	110.6	Q17 H19	Q17-W46 HydrophobicContact CB-CE3 4.16Å; H19-W46 HydrophobicContact CB-CE3 4.5Å; H19-W46 HydrophobicContact CB-CZ3 4.33Å
47	N	83.2	Confident	79.4	Confident	62 Å²	62	86.2 Å²	86.2	33%	0.332	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.1	127.4	174.2	-74.2	-18.9	0	0	0	110	Q17 S18 R20	Q17-N47 VanDerWaalsContact CA-O 3.32Å; Q17-N47 WeakPolarHBondContact CA-O 3.45Å; S18-N47 PolarHBondContact N-O 2.88Å; S18-N47 PolarHBondContact O-N 3.14Å; R20-N47 VanDerWaalsContact CD-ND2 3.34Å; R20-N47 WeakPolarHBondContact CD-ND2 3.25Å
48	S	85.3	Confident	81.2	Confident	63 Å²	63	80.3 Å²	80.3	44%	0.441	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.6	118.2	174.5	177.4	0	0	0	0	109.6	R15	R15-S48 WeakPolarHBondContact CG-OG 3.41Å; R15-S48 PolarHBondContact NE-OG 2.86Å
49	T	86.8	Confident	82.8	Confident	64 Å²	64	78 Å²	78	39%	0.393	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	150	173.3	58.3	0	0	0	0	110.3	R15 T16 N51	R15-T49 CarbonylContact C-O 3.52Å; R15-T49 WeakPolarHBondContact CA-O 3.36Å; T16-T49 PolarHBondContact N-O 2.85Å; T16-T49 PolarHBondContact O-N 2.83Å; T16-T49 PolarHBondContact O-OG1 2.78Å; T49-N51 PolarHBondContact OG1-ND2 3.33Å
50	S	89.8	Confident	84.5	Confident	84 Å²	84	74.2 Å²	74.2	59%	0.587	38%	0.383	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.5	111.1	173.2	-172.4	0	0	0	0	109.1
51	N	92.5	Very high	85.9	Confident	65 Å²	65	68.8 Å²	68.8	35%	0.348	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.1	128.1	-176	-68	-68	0	0	0	110.2	F13 L14 T16 T49	F13-N51 WeakPolarHBondContact CA-O 3.15Å; L14-N51 PolarHBondContact N-O 2.84Å; L14-N51 PolarHBondContact O-N 3.12Å; T16-N51 WeakPolarHBondContact CB-ND2 3.3Å; T16-N51 PolarHBondContact OG1-ND2 3.29Å; T49-N51 PolarHBondContact OG1-ND2 3.33Å
52	R	94.4	Very high	86.7	Confident	63 Å²	63	70.2 Å²	70.2	24%	0.238	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.5	127.6	175.1	-173.5	177.5	-71.7	162.5	3.8	109.9	L11 F13 H54 Y82 N94 C96 V97	L11-R52 HydrophobicContact CD1-CG 3.46Å; L11-R52 VanDerWaalsContact CD1-CG 3.46Å; F13-R52 HydrophobicContact CD1-CB 4.39Å; F13-R52 HydrophobicContact CE1-CB 4.08Å; F13-R52 HydrophobicContact CE1-CG 4.19Å; F13-R52 HydrophobicContact CZ-CG 4.37Å; R52-H54 WeakPolarHBondContact CD-NE2 3.44Å; R52-Y82 PolarHBondContact NH1-OH 2.98Å; R52-N94 VanDerWaalsContact NH1-CG 3.33Å; R52-N94 PolarHBondContact NH1-OD1 3.07Å; R52-C96 HydrophobicContact CB-CB 3.95Å; R52-C96 HydrophobicContact CG-CB 3.91Å; R52-C96 CarbonylContact O-C 3.54Å; R52-C96 WeakPolarHBondContact O-CA 3.31Å; R52-C96 VanDerWaalsContact O-CB 3.28Å; R52-C96 WeakPolarHBondContact O-CB 3.34Å; R52-V97 PolarHBondContact O-N 3.15Å
53	V	95.4	Very high	87.5	Confident	3 Å²	3	69 Å²	69	2%	0.018	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.5	124.8	179.3	-178.4	0	0	0	0	110.3	I12 L14 V55 V75 V97 A99	I12-V53 HydrophobicContact CD1-CB 4.31Å; I12-V53 HydrophobicContact CD1-CG1 4.38Å; I12-V53 HydrophobicContact CG1-CB 3.67Å; I12-V53 HydrophobicContact CG1-CG1 4.16Å; I12-V53 HydrophobicContact CG1-CG2 4.38Å; I12-V53 PolarHBondContact N-O 3.4Å; I12-V53 PolarHBondContact O-N 3.33Å; L14-V53 HydrophobicContact CD1-CG2 3.96Å; L14-V53 HydrophobicContact CG-CG2 4.11Å; V53-V55 HydrophobicContact CG1-CG2 4.14Å; V53-V75 HydrophobicContact CG1-CG1 3.78Å; V53-V75 HydrophobicContact CG1-CG2 4.45Å; V53-V97 CarbonylContact C-O 3.58Å; V53-V97 VanDerWaalsContact CA-O 3.28Å; V53-V97 WeakPolarHBondContact CA-O 3.34Å; V53-V97 HydrophobicContact CG2-CB 4.31Å; V53-A99 HydrophobicContact CG1-CB 3.89Å
54	H	94.8	Very high	88.2	Confident	23 Å²	23	66.3 Å²	66.3	11%	0.106	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	132.4	176.1	-68.6	-161.1	0	0	0	109.4	L11 R52 F56 Y82 V97 T98 A99	L11-H54 WeakPolarHBondContact CD1-CD2 3.36Å; L11-H54 WeakPolarHBondContact CD1-NE2 3.45Å; R52-H54 WeakPolarHBondContact CD-NE2 3.44Å; H54-F56 HydrophobicContact CB-CD2 4.48Å; H54-F56 HydrophobicContact CB-CE2 3.71Å; H54-F56 HydrophobicContact CB-CZ 3.92Å; H54-F56 AromaticContact ND1-CZ 3.89Å; H54-Y82 AromaticContact CE1-CE1 3.59Å; H54-Y82 AromaticContact CE1-CZ 3.85Å; H54-Y82 AromaticContact NE2-CE1 3.98Å; H54-V97 PolarHBondContact N-O 3.46Å; H54-T98 CarbonylContact O-C 3.58Å; H54-T98 WeakPolarHBondContact O-CA 3.14Å; H54-A99 PolarHBondContact O-N 3.25Å
55	V	94	Very high	88.5	Confident	0 Å²	0	68.4 Å²	68.4	0%	0	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.8	115.2	-179.6	-172.4	0	0	0	0	108.6	W9 I10 V53 L60 V61 L64 A99 I102	W9-V55 CarbonylContact C-O 3.57Å; W9-V55 WeakPolarHBondContact CA-O 3.36Å; W9-V55 WeakPolarHBondContact CB-O 3.2Å; I10-V55 HydrophobicContact CG2-CB 3.61Å; I10-V55 HydrophobicContact CG2-CG1 4.23Å; I10-V55 HydrophobicContact CG2-CG2 3.94Å; I10-V55 PolarHBondContact N-O 3.37Å; I10-V55 PolarHBondContact O-N 3.27Å; V53-V55 HydrophobicContact CG1-CG2 4.14Å; V55-L60 HydrophobicContact CG1-CB 3.46Å; V55-L60 VanDerWaalsContact CG1-CB 3.46Å; V55-L60 HydrophobicContact CG1-CD1 4.2Å; V55-L60 HydrophobicContact CG1-CG 4.49Å; V55-V61 HydrophobicContact CG1-CG2 4.17Å; V55-L64 HydrophobicContact CB-CD1 4.29Å; V55-L64 HydrophobicContact CG1-CD1 4.25Å; V55-L64 HydrophobicContact CG2-CD1 3.71Å; V55-A99 HydrophobicContact CG2-CB 3.91Å; V55-I102 HydrophobicContact CG1-CD1 4.23Å; V55-I102 HydrophobicContact CG2-CD1 3.8Å
56	F	91	Very high	88.6	Confident	111 Å²	111	74.2 Å²	74.2	49%	0.487	38%	0.375	S	S	.	.			trans	-109.4	-7.1	-177.7	-60.4	-72.6	0	0	0	113.7	N8 W9 H54 P58 T98	N8-F56 CarbonylContact O-C 3.6Å; W9-F56 HydrophobicContact CB-CD1 3.76Å; W9-F56 HydrophobicContact CB-CE1 4.18Å; H54-F56 HydrophobicContact CB-CD2 4.48Å; H54-F56 HydrophobicContact CB-CE2 3.71Å; H54-F56 HydrophobicContact CB-CZ 3.92Å; H54-F56 AromaticContact ND1-CZ 3.89Å; F56-P58 WeakPolarHBondContact O-CD 3.38Å; F56-T98 HydrophobicContact CD2-CG2 3.74Å; F56-T98 HydrophobicContact CE2-CG2 3.85Å
57	S	88.3	Confident	89	Confident	46 Å²	46	68.7 Å²	68.7	32%	0.322	36%	0.359	S	S	.	.			trans	-80.3	118.3	179	172.8	0	0	0	0	109.5	K59 L60 V61	S57-K59 PolarHBondContact O-N 2.78Å; S57-K59 VanDerWaalsContact O-N 3.09Å; S57-L60 PolarHBondContact O-N 2.88Å; S57-V61 VanDerWaalsContact O-CG2 3.31Å; S57-V61 WeakPolarHBondContact O-CG2 3.29Å; S57-V61 PolarHBondContact O-N 2.79Å
58	P	87.2	Confident	89.4	Confident	71 Å²	71	72 Å²	72	46%	0.461	37%	0.371	S	S	.	.	H	α-helix	trans	-56.9	-31.4	-179.3	-27.2	36.1	0	0	0	113.4	F56 W62	F56-P58 WeakPolarHBondContact O-CD 3.38Å; P58-W62 PolarHBondContact O-N 3.39Å
59	K	87.1	Confident	89.5	Confident	178 Å²	178	74.4 Å²	74.4	77%	0.774	38%	0.378	S	S	*	.	H	α-helix	trans	-65.7	-42.6	175.1	-67.1	-175.7	177.9	-177.8	0	112	S57 A63	S57-K59 PolarHBondContact O-N 2.78Å; S57-K59 VanDerWaalsContact O-N 3.09Å; K59-A63 PolarHBondContact O-N 2.83Å
60	L	88.6	Confident	89.7	Confident	30 Å²	30	72 Å²	72	16%	0.157	37%	0.366	C	S	.	.	H	α-helix	trans	-73.5	-38.9	178.3	-63.8	179.7	0	0	0	111.4	V55 S57 W62 A63 L64 I102	V55-L60 HydrophobicContact CG1-CB 3.46Å; V55-L60 VanDerWaalsContact CG1-CB 3.46Å; V55-L60 HydrophobicContact CG1-CD1 4.2Å; V55-L60 HydrophobicContact CG1-CG 4.49Å; S57-L60 PolarHBondContact O-N 2.88Å; L60-W62 VanDerWaalsContact C-N 3.27Å; L60-W62 PolarHBondContact O-N 3.42Å; L60-A63 PolarHBondContact O-N 2.9Å; L60-A63 VanDerWaalsContact O-N 3.14Å; L60-L64 WeakPolarHBondContact O-CG 3.38Å; L60-L64 PolarHBondContact O-N 3.23Å; L60-L64 VanDerWaalsContact O-N 3.09Å; L60-I102 HydrophobicContact CD1-CG1 4.46Å
61	V	89.6	Confident	89.9	Confident	8 Å²	8	69.7 Å²	69.7	5%	0.048	35%	0.346	C	S	.	.	H	α-helix	trans	-56.5	-45.4	174.5	174.9	0	0	0	0	110.1	I10 V55 S57 A63 L64 R65	I10-V61 HydrophobicContact CB-CG1 4.45Å; I10-V61 HydrophobicContact CG2-CB 4.46Å; I10-V61 HydrophobicContact CG2-CG1 4.42Å; I10-V61 HydrophobicContact CG2-CG2 4.09Å; V55-V61 HydrophobicContact CG1-CG2 4.17Å; S57-V61 VanDerWaalsContact O-CG2 3.31Å; S57-V61 WeakPolarHBondContact O-CG2 3.29Å; S57-V61 PolarHBondContact O-N 2.79Å; V61-A63 PolarHBondContact O-N 3.26Å; V61-L64 PolarHBondContact O-N 3.09Å; V61-R65 PolarHBondContact O-N 3.14Å
62	W	86.1	Confident	89.9	Confident	171 Å²	171	72.3 Å²	72.3	65%	0.648	35%	0.351	S	S	*	.	H	α-helix	trans	-59.4	-44.9	175.3	-105	88.6	0	0	0	113	P58 L60 L64 R65	P58-W62 PolarHBondContact O-N 3.39Å; L60-W62 VanDerWaalsContact C-N 3.27Å; L60-W62 PolarHBondContact O-N 3.42Å; W62-L64 PolarHBondContact O-N 3.49Å; W62-R65 PolarHBondContact O-N 3.25Å
63	A	85.8	Confident	89.9	Confident	73 Å²	73	70.8 Å²	70.8	60%	0.603	35%	0.347	S	S	*	.	H	α-helix	trans	-65.5	-21.3	179.2	0	0	0	0	0	113.7	K59 L60 V61	K59-A63 PolarHBondContact O-N 2.83Å; L60-A63 PolarHBondContact O-N 2.9Å; L60-A63 VanDerWaalsContact O-N 3.14Å; V61-A63 PolarHBondContact O-N 3.26Å
64	L	90.1	Very high	89.9	Confident	10 Å²	10	75 Å²	75	5%	0.052	37%	0.369	C	S	.	.	H	α-helix	trans	-90.1	-10.8	-179.5	-75	179.1	0	0	0	114.5	I10 I12 V55 L60 V61 W62 D66 V67 L73 I102	I10-L64 HydrophobicContact CD1-CB 4.21Å; I10-L64 HydrophobicContact CG2-CB 4.42Å; I10-L64 HydrophobicContact CG2-CD1 3.54Å; I12-L64 HydrophobicContact CD1-CD1 4.18Å; I12-L64 HydrophobicContact CD1-CD2 4.42Å; V55-L64 HydrophobicContact CB-CD1 4.29Å; V55-L64 HydrophobicContact CG1-CD1 4.25Å; V55-L64 HydrophobicContact CG2-CD1 3.71Å; L60-L64 WeakPolarHBondContact O-CG 3.38Å; L60-L64 PolarHBondContact O-N 3.23Å; L60-L64 VanDerWaalsContact O-N 3.09Å; V61-L64 PolarHBondContact O-N 3.09Å; W62-L64 PolarHBondContact O-N 3.49Å; L64-D66 PolarHBondContact O-N 3.39Å; L64-V67 HydrophobicContact CD2-CG2 3.78Å; L64-V67 WeakPolarHBondContact O-CB 3.47Å; L64-V67 PolarHBondContact O-N 3.06Å; L64-L73 HydrophobicContact CD2-CD1 3.83Å; L64-I102 HydrophobicContact CD1-CD1 3.53Å; L64-I102 HydrophobicContact CD2-CD1 4.05Å; L64-I102 HydrophobicContact CD2-CG2 4.15Å; L64-I102 HydrophobicContact CG-CD1 3.99Å
65	R	85	Confident	89.9	Confident	130 Å²	130	75.5 Å²	75.5	49%	0.491	37%	0.374	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.5	-31.3	-175.3	-73.7	-176.2	175.7	-175.9	-2.2	113.6	V61 W62	V61-R65 PolarHBondContact O-N 3.14Å; W62-R65 PolarHBondContact O-N 3.25Å
66	D	85.3	Confident	90	Very high	135 Å²	135	78.4 Å²	78.4	72%	0.722	39%	0.392	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.2	4.8	-176.9	-57.4	-42.8	0	0	0	112.5	L64 K68	L64-D66 PolarHBondContact O-N 3.39Å; D66-K68 PolarHBondContact O-N 3.1Å
67	V	89.7	Confident	90.2	Very high	52 Å²	52	74.9 Å²	74.9	32%	0.315	39%	0.386	S	S	.	.			trans	-69.4	131.7	179.9	168.9	0	0	0	0	110.3	L64 E71 L73	L64-V67 HydrophobicContact CD2-CG2 3.78Å; L64-V67 WeakPolarHBondContact O-CB 3.47Å; L64-V67 PolarHBondContact O-N 3.06Å; V67-E71 WeakPolarHBondContact CA-OE2 3.33Å; V67-E71 HydrophobicContact CG1-CB 4.36Å; V67-L73 HydrophobicContact CG1-CD1 4.03Å; V67-L73 HydrophobicContact CG2-CD1 4.41Å; V67-L73 HydrophobicContact CG2-CD2 4.27Å
68	K	90.3	Very high	90.5	Very high	132 Å²	132	77.5 Å²	77.5	57%	0.574	39%	0.392	S	S	*	.			trans	-104.6	153.2	-179.3	-62.4	-178.8	-178.2	179.5	0	111.6	D66 G70 E71 W107	D66-K68 PolarHBondContact O-N 3.1Å; K68-G70 PolarHBondContact O-N 3.41Å; K68-E71 HydrophobicContact CB-CG 4.16Å; K68-E71 PolarHBondContact N-OE2 2.94Å; K68-E71 VanDerWaalsContact O-CB 3.3Å; K68-E71 WeakPolarHBondContact O-CB 3.28Å; K68-E71 PolarHBondContact O-N 2.9Å; K68-E71 VanDerWaalsContact O-N 3.12Å; K68-W107 HydrophobicContact CB-CH2 3.87Å; K68-W107 HydrophobicContact CB-CZ2 4.36Å; K68-W107 HydrophobicContact CD-CH2 4.1Å; K68-W107 HydrophobicContact CD-CZ2 4.15Å
69	L	88.7	Confident	91	Very high	113 Å²	113	79.4 Å²	79.4	59%	0.592	40%	0.398	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.9	132.4	168.8	-64.3	176.6	0	0	0	109.7	W107 Y111 L117	L69-W107 WeakPolarHBondContact O-CZ3 3.3Å; L69-Y111 HydrophobicContact CB-CE2 3.85Å; L69-Y111 WeakPolarHBondContact CB-OH 3.43Å; L69-L117 HydrophobicContact CD1-CD1 4.08Å
70	G	90.1	Very high	91.4	Very high	13 Å²	13	72.1 Å²	72.1	13%	0.134	37%	0.369	C	S	.	.	T	Hydrogen-bonded Turn	trans	97	-13.7	-175.9	0	0	0	0	0	114.7	K68 S108	K68-G70 PolarHBondContact O-N 3.41Å; G70-S108 VanDerWaalsContact O-CB 3.27Å; G70-S108 WeakPolarHBondContact O-CB 3.31Å; G70-S108 PolarHBondContact O-N 3.09Å
71	E	93.1	Very high	91.7	Very high	37 Å²	37	76.9 Å²	76.9	17%	0.173	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.2	140.3	172	-69.8	-174.2	155.7	0	0	111.8	V67 K68 Y104 W107	V67-E71 WeakPolarHBondContact CA-OE2 3.33Å; V67-E71 HydrophobicContact CG1-CB 4.36Å; K68-E71 HydrophobicContact CB-CG 4.16Å; K68-E71 PolarHBondContact N-OE2 2.94Å; K68-E71 VanDerWaalsContact O-CB 3.3Å; K68-E71 WeakPolarHBondContact O-CB 3.28Å; K68-E71 PolarHBondContact O-N 2.9Å; K68-E71 VanDerWaalsContact O-N 3.12Å; E71-Y104 HydrophobicContact CB-CE2 3.7Å; E71-Y104 VanDerWaalsContact CD-CE2 3.4Å; E71-Y104 HydrophobicContact CG-CE2 3.69Å; E71-Y104 PolarHBondContact OE1-OH 2.96Å; E71-W107 HydrophobicContact CG-CD2 4.2Å; E71-W107 HydrophobicContact CG-CE3 4.42Å; E71-W107 HydrophobicContact CG-CH2 4.19Å; E71-W107 HydrophobicContact CG-CZ2 3.94Å; E71-W107 HydrophobicContact CG-CZ3 4.42Å
72	R	93.8	Very high	91.9	Very high	119 Å²	119	80.1 Å²	80.1	45%	0.449	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.7	130.1	179.6	-61.1	-176.6	-58.5	-167.5	1	109.5	M105 G106 W107	R72-M105 HydrophobicContact CB-CB 3.79Å; R72-M105 PolarHBondContact NE-O 2.98Å; R72-M105 PolarHBondContact NH2-O 3.39Å; R72-M105 WeakPolarHBondContact O-CB 3.31Å; R72-M105 PolarHBondContact O-N 3.48Å; R72-G106 WeakPolarHBondContact CB-O 3.41Å; R72-G106 PolarHBondContact N-O 3.17Å; R72-W107 VanDerWaalsContact CZ-O 3.3Å; R72-W107 PolarHBondContact NE-O 2.86Å
73	L	94.8	Very high	92.2	Very high	32 Å²	32	81.6 Å²	81.6	17%	0.168	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	134.4	177.7	-61.4	179.1	0	0	0	110.1	I12 L14 L64 V67 V75 I102 A103 Y104	I12-L73 HydrophobicContact CD1-CD1 4.05Å; L14-L73 HydrophobicContact CD1-CB 4.27Å; L14-L73 HydrophobicContact CD2-CB 4.35Å; L14-L73 HydrophobicContact CD2-CD1 4.05Å; L64-L73 HydrophobicContact CD2-CD1 3.83Å; V67-L73 HydrophobicContact CG1-CD1 4.03Å; V67-L73 HydrophobicContact CG2-CD1 4.41Å; V67-L73 HydrophobicContact CG2-CD2 4.27Å; L73-V75 HydrophobicContact CB-CG2 4.47Å; L73-I102 HydrophobicContact CB-CG2 4.38Å; L73-I102 HydrophobicContact CD1-CG2 4.46Å; L73-I102 HydrophobicContact CD2-CG2 4.22Å; L73-A103 WeakPolarHBondContact CA-O 3.46Å; L73-Y104 HydrophobicContact CD2-CD2 4.13Å
74	L	94.3	Very high	92.4	Very high	92 Å²	92	80 Å²	80	48%	0.482	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.9	120	163.2	175.5	66.4	0	0	0	108.2	I102 A103 M105	L74-I102 CarbonylContact O-C 3.53Å; L74-I102 VanDerWaalsContact O-CA 3.29Å; L74-I102 WeakPolarHBondContact O-CA 3.46Å; L74-A103 HydrophobicContact CB-CB 4.3Å; L74-A103 PolarHBondContact N-O 2.83Å; L74-A103 PolarHBondContact O-N 2.83Å; L74-M105 HydrophobicContact CB-CG 3.88Å; L74-M105 HydrophobicContact CB-SD 4.05Å
75	V	94.8	Very high	92.4	Very high	32 Å²	32	89.8 Å²	89.8	19%	0.194	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	128.4	177.7	179.6	0	0	0	0	109.6	L14 V53 L73 V97 A99 I102	L14-V75 HydrophobicContact CD1-CB 4.27Å; L14-V75 HydrophobicContact CD1-CG2 3.36Å; V53-V75 HydrophobicContact CG1-CG1 3.78Å; V53-V75 HydrophobicContact CG1-CG2 4.45Å; L73-V75 HydrophobicContact CB-CG2 4.47Å; V75-V97 HydrophobicContact CG1-CG1 4.07Å; V75-A99 HydrophobicContact CG1-CB 3.72Å; V75-I102 HydrophobicContact CG2-CG1 4.22Å; V75-I102 HydrophobicContact CG2-CG2 4.31Å
76	T	95.4	Very high	92.6	Very high	62 Å²	62	87.9 Å²	87.9	38%	0.38	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	140.6	170.9	67.3	0	0	0	0	109.8	Q100 R101	T76-Q100 PolarHBondContact O-N 2.82Å; T76-R101 PolarHBondContact N-O 2.93Å; T76-R101 PolarHBondContact O-N 2.79Å; T76-R101 VanDerWaalsContact O-N 3.07Å; T76-R101 WeakPolarHBondContact OG1-CB 3.09Å
77	G	95.8	Very high	92.8	Very high	36 Å²	36	88.4 Å²	88.4	37%	0.371	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	176.1	-153.9	-178.8	0	0	0	0	0	111.6	T98	G77-T98 VanDerWaalsContact CA-O 3.23Å; G77-T98 WeakPolarHBondContact CA-O 3.48Å
78	F	96	Very high	92.9	Very high	102 Å²	102	91 Å²	91	45%	0.447	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	145.3	-179.7	55.2	-85.5	0	0	0	111.3	S80 T98 Q100	F78-S80 WeakPolarHBondContact CD2-OG 3.22Å; F78-S80 WeakPolarHBondContact CE2-OG 3.35Å; F78-T98 HydrophobicContact CD1-CG2 4.49Å; F78-T98 HydrophobicContact CE1-CG2 3.61Å; F78-T98 VanDerWaalsContact CE2-CB 3.45Å; F78-T98 HydrophobicContact CE2-CG2 3.87Å; F78-T98 HydrophobicContact CZ-CG2 3.25Å; F78-T98 PolarHBondContact N-O 3.14Å; F78-T98 VanDerWaalsContact N-O 3.17Å; F78-T98 PolarHBondContact O-N 3.19Å; F78-Q100 HydrophobicContact CD1-CG 4.13Å; F78-Q100 HydrophobicContact CE1-CG 4.22Å
79	L	96.7	Very high	92.9	Very high	110 Å²	110	87.5 Å²	87.5	58%	0.576	44%	0.443	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70	132.7	171.8	-69.6	172.1	0	0	0	109.8	Y81 C96 V97	L79-Y81 HydrophobicContact CB-CE2 4.39Å; L79-C96 CarbonylContact C-O 3.54Å; L79-C96 WeakPolarHBondContact CA-O 3.22Å; L79-V97 HydrophobicContact CD2-CG2 3.98Å
80	S	95.7	Very high	93	Very high	25 Å²	25	85.3 Å²	85.3	18%	0.175	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.9	137.1	-179.5	-62.6	0	0	0	0	109.4	F78 C95 C96 T98	F78-S80 WeakPolarHBondContact CD2-OG 3.22Å; F78-S80 WeakPolarHBondContact CE2-OG 3.35Å; S80-C95 WeakPolarHBondContact O-CA 3.46Å; S80-C96 PolarHBondContact N-O 3.35Å; S80-C96 PolarHBondContact O-N 2.82Å; S80-T98 PolarHBondContact OG-OG1 3.29Å
81	Y	95.6	Very high	93.1	Very high	130 Å²	130	89 Å²	89	51%	0.51	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	132.1	177	-63.1	-90.8	0	0	0	109.4	L79 N94 C95	L79-Y81 HydrophobicContact CB-CE2 4.39Å; Y81-N94 VanDerWaalsContact CA-O 3.31Å; Y81-N94 WeakPolarHBondContact CA-O 3.12Å; Y81-C95 HydrophobicContact CD1-CB 3.94Å; Y81-C95 HydrophobicContact CE1-CB 3.69Å; Y81-C95 VanDerWaalsContact CE1-SG 3.53Å
82	Y	92.7	Very high	93	Very high	76 Å²	76	91.2 Å²	91.2	30%	0.298	47%	0.465	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.5	157.8	175.1	66.2	-84.4	0	0	0	110.5	R52 H54 N94 C96	R52-Y82 PolarHBondContact NH1-OH 2.98Å; H54-Y82 AromaticContact CE1-CE1 3.59Å; H54-Y82 AromaticContact CE1-CZ 3.85Å; H54-Y82 AromaticContact NE2-CE1 3.98Å; Y82-N94 HydrophobicContact CD1-CB 4.08Å; Y82-N94 HydrophobicContact CD2-CB 4.3Å; Y82-N94 HydrophobicContact CE1-CB 3.65Å; Y82-N94 HydrophobicContact CE2-CB 3.91Å; Y82-N94 HydrophobicContact CG-CB 4.39Å; Y82-N94 PolarHBondContact N-O 3.09Å; Y82-N94 VanDerWaalsContact N-O 3.15Å; Y82-N94 PolarHBondContact O-N 2.93Å; Y82-C96 HydrophobicContact CE1-CB 4.5Å
83	R	93.5	Very high	92.9	Very high	203 Å²	203	94 Å²	94	77%	0.766	48%	0.476	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.2	129.2	173.2	-64.9	-178.1	-178.2	178.7	0.1	108.5	Q92	R83-Q92 CarbonylContact C-O 3.52Å; R83-Q92 VanDerWaalsContact CA-O 3.3Å; R83-Q92 WeakPolarHBondContact CA-O 3.23Å
84	S	89.2	Confident	92.8	Very high	38 Å²	38	93 Å²	93	27%	0.266	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.4	148.5	167.5	65.8	0	0	0	0	109.4	T91 Q92 N94	S84-T91 WeakPolarHBondContact O-CA 3.1Å; S84-Q92 PolarHBondContact N-O 2.88Å; S84-Q92 PolarHBondContact O-N 2.96Å; S84-N94 PolarHBondContact OG-ND2 2.82Å
85	R	90.2	Very high	92.7	Very high	217 Å²	217	91.4 Å²	91.4	82%	0.819	47%	0.466	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.8	134.2	169	-68.8	-176.7	179.8	-178.9	-0.6	108.6	T91	R85-T91 HydrophobicContact CG-CG2 4.42Å
86	K	88.8	Confident	92.7	Very high	89 Å²	89	90 Å²	90	39%	0.387	46%	0.458	S	S	.	.			trans	-82.8	161.8	168.9	-75.9	-174	180	179.6	0	109.9	D88 G89 T90 Q92	K86-D88 WeakPolarHBondContact CB-OD1 3.22Å; K86-D88 PolarHBondContact O-N 3.22Å; K86-G89 PolarHBondContact O-N 3.02Å; K86-T90 WeakPolarHBondContact CD-OG1 3.47Å; K86-T90 PolarHBondContact N-O 3.44Å; K86-Q92 HydrophobicContact CG-CB 4.27Å
87	P	89.3	Confident	92.8	Very high	147 Å²	147	88.6 Å²	88.6	96%	0.955	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.1	-27.7	175.3	-25.8	35.2	0	0	0	113.9	G89	P87-G89 PolarHBondContact O-N 3.01Å
88	D	92	Very high	92.8	Very high	106 Å²	106	87.5 Å²	87.5	57%	0.567	44%	0.435	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.8	1.7	176.5	65.5	8.9	0	0	0	114.2	K86 T90	K86-D88 WeakPolarHBondContact CB-OD1 3.22Å; K86-D88 PolarHBondContact O-N 3.22Å; D88-T90 VanDerWaalsContact C-N 3.27Å; D88-T90 PolarHBondContact O-N 2.94Å; D88-T90 VanDerWaalsContact OD1-CB 3.31Å; D88-T90 WeakPolarHBondContact OD1-CB 3.28Å; D88-T90 WeakPolarHBondContact OD1-CG2 3.44Å; D88-T90 PolarHBondContact OD1-N 3.21Å; D88-T90 PolarHBondContact OD1-OG1 3.31Å; D88-T90 PolarHBondContact OD2-OG1 2.85Å
89	G	90.1	Very high	92.8	Very high	58 Å²	58	83 Å²	83	60%	0.598	42%	0.417	S	S	*	.	S	Bend	trans	83	-8.1	-178.1	0	0	0	0	0	114.9	K86 P87	K86-G89 PolarHBondContact O-N 3.02Å; P87-G89 PolarHBondContact O-N 3.01Å
90	T	91.6	Very high	92.7	Very high	67 Å²	67	83.9 Å²	83.9	41%	0.411	42%	0.418	S	S	.	.			trans	-73.9	157.4	176	69.8	0	0	0	0	111.3	K86 D88	K86-T90 WeakPolarHBondContact CD-OG1 3.47Å; K86-T90 PolarHBondContact N-O 3.44Å; D88-T90 VanDerWaalsContact C-N 3.27Å; D88-T90 PolarHBondContact O-N 2.94Å; D88-T90 VanDerWaalsContact OD1-CB 3.31Å; D88-T90 WeakPolarHBondContact OD1-CB 3.28Å; D88-T90 WeakPolarHBondContact OD1-CG2 3.44Å; D88-T90 PolarHBondContact OD1-N 3.21Å; D88-T90 PolarHBondContact OD1-OG1 3.31Å; D88-T90 PolarHBondContact OD2-OG1 2.85Å
91	T	91	Very high	92.6	Very high	92 Å²	92	91.8 Å²	91.8	56%	0.564	44%	0.444	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.5	130.9	176.3	63.3	0	0	0	0	110.8	S84 R85	S84-T91 WeakPolarHBondContact O-CA 3.1Å; R85-T91 HydrophobicContact CG-CG2 4.42Å
92	Q	91	Very high	92.6	Very high	83 Å²	83	87.2 Å²	87.2	39%	0.388	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	127.9	174.3	-176.2	171.7	-1.8	0	0	109.8	R83 S84 K86 N94	R83-Q92 CarbonylContact C-O 3.52Å; R83-Q92 VanDerWaalsContact CA-O 3.3Å; R83-Q92 WeakPolarHBondContact CA-O 3.23Å; S84-Q92 PolarHBondContact N-O 2.88Å; S84-Q92 PolarHBondContact O-N 2.96Å; K86-Q92 HydrophobicContact CG-CB 4.27Å; Q92-N94 PolarHBondContact O-ND2 3.49Å
93	R	93	Very high	92.6	Very high	178 Å²	178	85.8 Å²	85.8	67%	0.672	43%	0.432	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.9	120	165.6	-173.2	179.2	-178.3	-179.8	-1.3	108.2
94	N	91.7	Very high	92.6	Very high	9 Å²	9	81.6 Å²	81.6	5%	0.048	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	147	174.8	-61.1	-86.1	0	0	0	109.4	R52 Y81 Y82 S84 Q92	R52-N94 VanDerWaalsContact NH1-CG 3.33Å; R52-N94 PolarHBondContact NH1-OD1 3.07Å; Y81-N94 VanDerWaalsContact CA-O 3.31Å; Y81-N94 WeakPolarHBondContact CA-O 3.12Å; Y82-N94 HydrophobicContact CD1-CB 4.08Å; Y82-N94 HydrophobicContact CD2-CB 4.3Å; Y82-N94 HydrophobicContact CE1-CB 3.65Å; Y82-N94 HydrophobicContact CE2-CB 3.91Å; Y82-N94 HydrophobicContact CG-CB 4.39Å; Y82-N94 PolarHBondContact N-O 3.09Å; Y82-N94 VanDerWaalsContact N-O 3.15Å; Y82-N94 PolarHBondContact O-N 2.93Å; S84-N94 PolarHBondContact OG-ND2 2.82Å; Q92-N94 PolarHBondContact O-ND2 3.49Å
95	C	93.4	Very high	92.8	Very high	59 Å²	59	84.6 Å²	84.6	40%	0.399	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.6	135.7	168.3	-174.6	0	0	0	0	107.7	S80 Y81	S80-C95 WeakPolarHBondContact O-CA 3.46Å; Y81-C95 HydrophobicContact CD1-CB 3.94Å; Y81-C95 HydrophobicContact CE1-CB 3.69Å; Y81-C95 VanDerWaalsContact CE1-SG 3.53Å
96	C	94.6	Very high	92.9	Very high	4 Å²	4	75.2 Å²	75.2	3%	0.027	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.3	161.9	172.6	64.1	0	0	0	0	111	R52 L79 S80 Y82	R52-C96 HydrophobicContact CB-CB 3.95Å; R52-C96 HydrophobicContact CG-CB 3.91Å; R52-C96 CarbonylContact O-C 3.54Å; R52-C96 WeakPolarHBondContact O-CA 3.31Å; R52-C96 VanDerWaalsContact O-CB 3.28Å; R52-C96 WeakPolarHBondContact O-CB 3.34Å; L79-C96 CarbonylContact C-O 3.54Å; L79-C96 WeakPolarHBondContact CA-O 3.22Å; S80-C96 PolarHBondContact N-O 3.35Å; S80-C96 PolarHBondContact O-N 2.82Å; Y82-C96 HydrophobicContact CE1-CB 4.5Å
97	V	96.2	Very high	93	Very high	32 Å²	32	77 Å²	77	19%	0.194	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.8	121.8	166.6	179.5	0	0	0	0	108	R52 V53 H54 V75 L79 A99	R52-V97 PolarHBondContact O-N 3.15Å; V53-V97 CarbonylContact C-O 3.58Å; V53-V97 VanDerWaalsContact CA-O 3.28Å; V53-V97 WeakPolarHBondContact CA-O 3.34Å; V53-V97 HydrophobicContact CG2-CB 4.31Å; H54-V97 PolarHBondContact N-O 3.46Å; V75-V97 HydrophobicContact CG1-CG1 4.07Å; L79-V97 HydrophobicContact CD2-CG2 3.98Å; V97-A99 PolarHBondContact O-N 2.85Å
98	T	95.8	Very high	93	Very high	13 Å²	13	71.7 Å²	71.7	8%	0.08	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87	108.8	167.8	-61.1	0	0	0	0	108.7	H54 F56 G77 F78 S80 Q100	H54-T98 CarbonylContact O-C 3.58Å; H54-T98 WeakPolarHBondContact O-CA 3.14Å; F56-T98 HydrophobicContact CD2-CG2 3.74Å; F56-T98 HydrophobicContact CE2-CG2 3.85Å; G77-T98 VanDerWaalsContact CA-O 3.23Å; G77-T98 WeakPolarHBondContact CA-O 3.48Å; F78-T98 HydrophobicContact CD1-CG2 4.49Å; F78-T98 HydrophobicContact CE1-CG2 3.61Å; F78-T98 VanDerWaalsContact CE2-CB 3.45Å; F78-T98 HydrophobicContact CE2-CG2 3.87Å; F78-T98 HydrophobicContact CZ-CG2 3.25Å; F78-T98 PolarHBondContact N-O 3.14Å; F78-T98 VanDerWaalsContact N-O 3.17Å; F78-T98 PolarHBondContact O-N 3.19Å; S80-T98 PolarHBondContact OG-OG1 3.29Å; T98-Q100 PolarHBondContact O-N 3.35Å
99	A	96.2	Very high	92.6	Very high	8 Å²	8	73.8 Å²	73.8	7%	0.066	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.5	128.1	-172.6	0	0	0	0	0	112.1	V53 H54 V55 V75 V97 I102	V53-A99 HydrophobicContact CG1-CB 3.89Å; H54-A99 PolarHBondContact O-N 3.25Å; V55-A99 HydrophobicContact CG2-CB 3.91Å; V75-A99 HydrophobicContact CG1-CB 3.72Å; V97-A99 PolarHBondContact O-N 2.85Å; A99-I102 HydrophobicContact CB-CD1 4.11Å; A99-I102 HydrophobicContact CB-CG1 4.12Å
100	Q	94.7	Very high	92.1	Very high	128 Å²	128	75.8 Å²	75.8	60%	0.598	38%	0.378	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.1	-31.9	169.1	-68.9	-179.2	-48.3	0	0	111.9	T76 F78 T98	T76-Q100 PolarHBondContact O-N 2.82Å; F78-Q100 HydrophobicContact CD1-CG 4.13Å; F78-Q100 HydrophobicContact CE1-CG 4.22Å; T98-Q100 PolarHBondContact O-N 3.35Å
101	R	94.5	Very high	91.6	Very high	190 Å²	190	76.9 Å²	76.9	72%	0.717	38%	0.375	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-144.8	149.9	175.4	-52.3	176.7	174.7	162.1	-1.3	109.8	T76	T76-R101 PolarHBondContact N-O 2.93Å; T76-R101 PolarHBondContact O-N 2.79Å; T76-R101 VanDerWaalsContact O-N 3.07Å; T76-R101 WeakPolarHBondContact OG1-CB 3.09Å
102	I	94.2	Very high	90.9	Very high	35 Å²	35	80.8 Å²	80.8	18%	0.179	39%	0.387	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.3	133.4	176.2	-54.7	-179	0	0	0	107	V55 L60 L64 L73 L74 V75 A99	V55-I102 HydrophobicContact CG1-CD1 4.23Å; V55-I102 HydrophobicContact CG2-CD1 3.8Å; L60-I102 HydrophobicContact CD1-CG1 4.46Å; L64-I102 HydrophobicContact CD1-CD1 3.53Å; L64-I102 HydrophobicContact CD2-CD1 4.05Å; L64-I102 HydrophobicContact CD2-CG2 4.15Å; L64-I102 HydrophobicContact CG-CD1 3.99Å; L73-I102 HydrophobicContact CB-CG2 4.38Å; L73-I102 HydrophobicContact CD1-CG2 4.46Å; L73-I102 HydrophobicContact CD2-CG2 4.22Å; L74-I102 CarbonylContact O-C 3.53Å; L74-I102 VanDerWaalsContact O-CA 3.29Å; L74-I102 WeakPolarHBondContact O-CA 3.46Å; V75-I102 HydrophobicContact CG2-CG1 4.22Å; V75-I102 HydrophobicContact CG2-CG2 4.31Å; A99-I102 HydrophobicContact CB-CD1 4.11Å; A99-I102 HydrophobicContact CB-CG1 4.12Å
103	A	93.9	Very high	90	Very high	45 Å²	45	81.1 Å²	81.1	37%	0.372	40%	0.399	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	139.1	173.5	0	0	0	0	0	110.1	L73 L74	L73-A103 WeakPolarHBondContact CA-O 3.46Å; L74-A103 HydrophobicContact CB-CB 4.3Å; L74-A103 PolarHBondContact N-O 2.83Å; L74-A103 PolarHBondContact O-N 2.83Å
104	Y	93.4	Very high	88.8	Confident	116 Å²	116	75.5 Å²	75.5	46%	0.455	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81	131.4	175.6	-178.8	-103	0	0	0	110.5	E71 L73 G106 W107	E71-Y104 HydrophobicContact CB-CE2 3.7Å; E71-Y104 VanDerWaalsContact CD-CE2 3.4Å; E71-Y104 HydrophobicContact CG-CE2 3.69Å; E71-Y104 PolarHBondContact OE1-OH 2.96Å; L73-Y104 HydrophobicContact CD2-CD2 4.13Å; Y104-G106 VanDerWaalsContact CE1-CA 3.41Å; Y104-G106 VanDerWaalsContact CE1-N 3.33Å; Y104-W107 PolarHBondContact OH-NE1 3.23Å
105	M	93.3	Very high	87.3	Confident	101 Å²	101	84.1 Å²	84.1	50%	0.498	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	12.9	-173.3	-58.5	-65.3	-66.6	0	0	112.8	R72 L74	R72-M105 HydrophobicContact CB-CB 3.79Å; R72-M105 PolarHBondContact NE-O 2.98Å; R72-M105 PolarHBondContact NH2-O 3.39Å; R72-M105 WeakPolarHBondContact O-CB 3.31Å; R72-M105 PolarHBondContact O-N 3.48Å; L74-M105 HydrophobicContact CB-CG 3.88Å; L74-M105 HydrophobicContact CB-SD 4.05Å
106	G	92.3	Very high	85.4	Confident	20 Å²	20	88.4 Å²	88.4	21%	0.206	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	84.9	-168.1	-177.5	0	0	0	0	0	113.6	R72 Y104	R72-G106 WeakPolarHBondContact CB-O 3.41Å; R72-G106 PolarHBondContact N-O 3.17Å; Y104-G106 VanDerWaalsContact CE1-CA 3.41Å; Y104-G106 VanDerWaalsContact CE1-N 3.33Å
107	W	91.8	Very high	83.5	Confident	125 Å²	125	93.7 Å²	93.7	47%	0.473	47%	0.473	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.8	148.1	-179	-74.1	83.5	0	0	0	112.6	K68 L69 E71 R72 Y104	K68-W107 HydrophobicContact CB-CH2 3.87Å; K68-W107 HydrophobicContact CB-CZ2 4.36Å; K68-W107 HydrophobicContact CD-CH2 4.1Å; K68-W107 HydrophobicContact CD-CZ2 4.15Å; L69-W107 WeakPolarHBondContact O-CZ3 3.3Å; E71-W107 HydrophobicContact CG-CD2 4.2Å; E71-W107 HydrophobicContact CG-CE3 4.42Å; E71-W107 HydrophobicContact CG-CH2 4.19Å; E71-W107 HydrophobicContact CG-CZ2 3.94Å; E71-W107 HydrophobicContact CG-CZ3 4.42Å; R72-W107 VanDerWaalsContact CZ-O 3.3Å; R72-W107 PolarHBondContact NE-O 2.86Å; Y104-W107 PolarHBondContact OH-NE1 3.23Å
108	S	88.3	Confident	81.2	Confident	36 Å²	36	100.5 Å²	100.5	25%	0.252	50%	0.503	S	S	.	.			trans	-84.2	127.3	170.6	-171.5	0	0	0	0	110.3	G70 D110 Y111	G70-S108 VanDerWaalsContact O-CB 3.27Å; G70-S108 WeakPolarHBondContact O-CB 3.31Å; G70-S108 PolarHBondContact O-N 3.09Å; S108-D110 PolarHBondContact O-N 2.81Å; S108-Y111 PolarHBondContact O-N 2.82Å
109	N	83.7	Confident	79	Confident	150 Å²	150	108.1 Å²	108.1	80%	0.802	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.4	-25.7	176.2	-65.3	-15.3	0	0	0	112.2	Y111	N109-Y111 VanDerWaalsContact C-N 3.32Å
110	D	79.4	Confident	76.8	Confident	101 Å²	101	114.1 Å²	114.1	54%	0.54	57%	0.573	S	S	.	*	T	Hydrogen-bonded Turn	trans	-94	10.7	-177.9	-51.9	-33.2	0	0	0	112.4	S108 Q112	S108-D110 PolarHBondContact O-N 2.81Å; D110-Q112 PolarHBondContact O-N 3.09Å
111	Y	81.5	Confident	74.2	Confident	90 Å²	90	114.9 Å²	114.9	35%	0.353	58%	0.58	S	S	.	*			trans	-72.3	113.2	176.3	178.6	-107.4	0	0	0	110	L69 S108 N109	L69-Y111 HydrophobicContact CB-CE2 3.85Å; L69-Y111 WeakPolarHBondContact CB-OH 3.43Å; S108-Y111 PolarHBondContact O-N 2.82Å; N109-Y111 VanDerWaalsContact C-N 3.32Å
112	Q	76.3	Confident	71.7	Confident	173 Å²	173	115.1 Å²	115.1	81%	0.808	59%	0.589	S	S	*	*			trans	-105.9	125.2	166.6	-66.9	179.8	-14.6	0	0	107.7	D110 S114	D110-Q112 PolarHBondContact O-N 3.09Å; Q112-S114 PolarHBondContact O-N 3.15Å
113	S	72.4	Confident	68.8	Low	90 Å²	90	123.4 Å²	123.4	63%	0.629	64%	0.642	S	S	*	*			trans	-60.5	112.3	171.6	51.1	0	0	0	0	108.5	E115	S113-E115 PolarHBondContact O-N 2.82Å
114	S	67.8	Low	67.5	Low	60 Å²	60	127.3 Å²	127.3	42%	0.42	66%	0.655	S	S	.	*			trans	-71.7	114.8	171.1	141.9	0	0	0	0	107.9	Q112 N116 L117	Q112-S114 PolarHBondContact O-N 3.15Å; S114-N116 PolarHBondContact O-N 2.64Å; S114-N116 VanDerWaalsContact O-N 3.09Å; S114-N116 PolarHBondContact OG-N 2.86Å; S114-L117 PolarHBondContact O-N 3.19Å; S114-L117 PolarHBondContact OG-N 3.31Å
115	E	58.6	Low	66.2	Low	191 Å²	191	127.9 Å²	127.9	89%	0.893	67%	0.666	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.4	-13.1	171.7	-67.1	-175.3	162.1	0	0	112.8	S113	S113-E115 PolarHBondContact O-N 2.82Å
116	N	54	Low	64.7	Low	149 Å²	149	129.4 Å²	129.4	80%	0.797	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.3	10.3	-174.2	-65.2	-40	0	0	0	115.1	S114 E118	S114-N116 PolarHBondContact O-N 2.64Å; S114-N116 VanDerWaalsContact O-N 3.09Å; S114-N116 PolarHBondContact OG-N 2.86Å; N116-E118 VanDerWaalsContact C-N 3.34Å; N116-E118 PolarHBondContact O-N 2.84Å; N116-E118 VanDerWaalsContact O-N 3.15Å
117	L	55.4	Low	63	Low	114 Å²	114	135.8 Å²	135.8	60%	0.597	70%	0.703	S	S	*	*			trans	-85.3	83.3	172.2	-79.6	160.8	0	0	0	108.4	L69 S114 E119	L69-L117 HydrophobicContact CD1-CD1 4.08Å; S114-L117 PolarHBondContact O-N 3.19Å; S114-L117 PolarHBondContact OG-N 3.31Å; L117-E119 PolarHBondContact O-N 2.92Å
118	E	48.4	Very low	61.2	Low	175 Å²	175	136.5 Å²	136.5	82%	0.818	72%	0.717	S	S	*	*			trans	-62.3	123.4	163	-71.6	-175.2	165	0	0	108.2	N116 V120	N116-E118 VanDerWaalsContact C-N 3.34Å; N116-E118 PolarHBondContact O-N 2.84Å; N116-E118 VanDerWaalsContact O-N 3.15Å; E118-V120 PolarHBondContact O-N 2.83Å
119	E	49	Very low	59.4	Low	173 Å²	173	143.2 Å²	143.2	81%	0.808	75%	0.748	S	S	*	*			trans	-57.7	107.5	165.7	-88.9	-177.7	160.8	0	0	107.9	L117 L121	L117-E119 PolarHBondContact O-N 2.92Å; E119-L121 VanDerWaalsContact C-N 3.28Å; E119-L121 PolarHBondContact O-N 3.01Å
120	V	50.1	Low	57.7	Low	134 Å²	134	142.7 Å²	142.7	81%	0.812	74%	0.744	S	S	*	*			trans	-71.4	94.4	166.5	-177.8	0	0	0	0	106.4	E118 E122	E118-V120 PolarHBondContact O-N 2.83Å; V120-E122 PolarHBondContact O-N 3.4Å
121	L	38.9	Very low	56	Low	145 Å²	145	145.9 Å²	145.9	76%	0.759	76%	0.76	S	S	*	*			trans	-61.8	115.4	168.1	-73.5	163.1	0	0	0	108	E119 T123	E119-L121 VanDerWaalsContact C-N 3.28Å; E119-L121 PolarHBondContact O-N 3.01Å; L121-T123 PolarHBondContact O-N 3.31Å
122	E	42.1	Very low	53.9	Low	194 Å²	194	150.6 Å²	150.6	91%	0.907	79%	0.794	S	S	*	*			trans	-64.4	115.4	166.9	-69.2	-175.3	161.5	0	0	108.4	V120	V120-E122 PolarHBondContact O-N 3.4Å
123	T	33.9	Very low	51.9	Low	209 Å²	209	148.5 Å²	148.5	100%	1.282	79%	0.793	S	S	*	*			trans	-76.4	0	166.1	46.2	0	0	0	0	112	L121	L121-T123 PolarHBondContact O-N 3.31Å

Retrieved 123 of 123 residues in 80.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).