A0A5K4F7B3_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F7B3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 67 aa.

						>A0A5K4F7B3_SCHMA|A0A5K4F7B3
MDEYEHYNYEEDKVAGSKGGKNRTKRDVEEHHKKSENRTNRIHIDYQVNNEEKQREQNSKHGSENKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.8	Low	78.4	Confident	229 Å²	229	157.4 Å²	157.4	100%	1.128	72%	0.722	S	S	*	*				0	108.4	0	-77.4	-64.4	-177.6	0	0	104.4	E3	M1-E3 PolarHBondContact O-N 3.4Å
2	D	81.3	Confident	78.2	Confident	172 Å²	172	150.2 Å²	150.2	92%	0.92	69%	0.694	S	S	*	*			trans	-77.2	110.9	177.4	-59.3	-39	0	0	0	106.8	Y4	D2-Y4 PolarHBondContact O-N 3.05Å
3	E	77.6	Confident	77.7	Confident	185 Å²	185	146.5 Å²	146.5	86%	0.864	68%	0.675	S	S	*	*	P	Polyproline II helix	trans	-68.6	122.2	177.4	-75.3	176.1	-175.2	0	0	108.5	M1 E5	M1-E3 PolarHBondContact O-N 3.4Å; E3-E5 PolarHBondContact O-N 3.25Å
4	Y	81.8	Confident	76.9	Confident	190 Å²	190	142.9 Å²	142.9	75%	0.745	67%	0.668	S	S	*	*	P	Polyproline II helix	trans	-63.5	116.9	174.8	174.4	-106.1	0	0	0	108.9	D2 H6	D2-Y4 PolarHBondContact O-N 3.05Å; Y4-H6 AromaticContact CD1-CD2 3.58Å; Y4-H6 AromaticContact CD1-NE2 3.93Å; Y4-H6 PolarHBondContact O-CD2 2.66Å; Y4-H6 PolarHBondContact O-N 3.37Å
5	E	81.1	Confident	76	Confident	178 Å²	178	138.7 Å²	138.7	83%	0.832	67%	0.668	S	S	*	*	P	Polyproline II helix	trans	-65.3	119.6	174.9	-69.8	-171.2	154.6	0	0	109.8	E3 Y7	E3-E5 PolarHBondContact O-N 3.25Å; E5-Y7 PolarHBondContact O-N 2.86Å
6	H	82.7	Confident	74.9	Confident	161 Å²	161	133.1 Å²	133.1	75%	0.745	66%	0.657	S	S	*	*	P	Polyproline II helix	trans	-76.7	118.6	175.5	-79.1	-151	0	0	0	109.4	Y4 N8	Y4-H6 AromaticContact CD1-CD2 3.58Å; Y4-H6 AromaticContact CD1-NE2 3.93Å; Y4-H6 PolarHBondContact O-CD2 2.66Å; Y4-H6 PolarHBondContact O-N 3.37Å; H6-N8 PolarHBondContact O-N 3.03Å; H6-N8 VanDerWaalsContact O-N 3.15Å
7	Y	83.1	Confident	73.8	Confident	144 Å²	144	129.7 Å²	129.7	57%	0.565	65%	0.649	S	S	*	*	P	Polyproline II helix	trans	-59.1	117.5	169.5	173.2	-102.2	0	0	0	110.4	E5 Y9 D12	E5-Y7 PolarHBondContact O-N 2.86Å; Y7-Y9 HydrophobicContact CE1-CD2 4.17Å; Y7-Y9 PolarHBondContact O-N 2.97Å; Y7-D12 HydrophobicContact CE2-CB 3.68Å; Y7-D12 WeakPolarHBondContact CE2-OD2 3.37Å; Y7-D12 PolarHBondContact OH-OD2 3.48Å
8	N	83.1	Confident	72.9	Confident	72 Å²	72	133 Å²	133	39%	0.385	66%	0.659	S	S	.	*			trans	-91.5	98.4	174.4	-170.9	-14.7	0	0	0	110.3	H6 E10 E11 D12	H6-N8 PolarHBondContact O-N 3.03Å; H6-N8 VanDerWaalsContact O-N 3.15Å; N8-E10 PolarHBondContact O-N 2.82Å; N8-E10 WeakPolarHBondContact OD1-CB 3.25Å; N8-E10 PolarHBondContact OD1-N 3.4Å; N8-E11 HydrophobicContact CB-CB 4.12Å; N8-E11 HydrophobicContact CB-CG 4.28Å; N8-E11 WeakPolarHBondContact CB-OE2 3.24Å; N8-E11 WeakPolarHBondContact ND2-CG 3.44Å; N8-E11 PolarHBondContact ND2-OE2 2.8Å; N8-E11 PolarHBondContact O-N 3.26Å; N8-E11 PolarHBondContact OD1-N 3.02Å; N8-D12 PolarHBondContact O-N 2.94Å; N8-D12 VanDerWaalsContact O-N 3.11Å
9	Y	80.3	Confident	71.9	Confident	146 Å²	146	129 Å²	129	57%	0.573	66%	0.655	S	S	*	*	H	α-helix	trans	-56	-36.4	176.9	175.9	-96.6	0	0	0	113	Y7 E11 K13	Y7-Y9 HydrophobicContact CE1-CD2 4.17Å; Y7-Y9 PolarHBondContact O-N 2.97Å; Y9-E11 VanDerWaalsContact C-N 3.32Å; Y9-E11 PolarHBondContact O-N 2.93Å; Y9-K13 HydrophobicContact CE1-CD 4.37Å; Y9-K13 WeakPolarHBondContact O-CB 2.94Å; Y9-K13 PolarHBondContact O-N 3.3Å
10	E	78.1	Confident	71.2	Confident	114 Å²	114	125.5 Å²	125.5	53%	0.533	65%	0.653	S	S	.	*	H	α-helix	trans	-70.7	-29.3	-177.9	-73.5	-70.6	110	0	0	112.5	N8 K13	N8-E10 PolarHBondContact O-N 2.82Å; N8-E10 WeakPolarHBondContact OD1-CB 3.25Å; N8-E10 PolarHBondContact OD1-N 3.4Å; E10-K13 WeakPolarHBondContact O-CE 3.38Å; E10-K13 IonicContact OE1-NZ 2.61Å; E10-K13 PolarHBondContact OE1-NZ 2.71Å; E10-K13 IonicContact OE2-NZ 3.57Å; E10-K13 PolarHBondContact OE2-NZ 2.79Å
11	E	74	Confident	70.7	Confident	140 Å²	140	129.1 Å²	129.1	65%	0.654	66%	0.664	S	S	*	*	H	α-helix	trans	-77.3	-46.4	173.8	-77.4	-178.5	88	0	0	111.8	N8 Y9	N8-E11 HydrophobicContact CB-CB 4.12Å; N8-E11 HydrophobicContact CB-CG 4.28Å; N8-E11 WeakPolarHBondContact CB-OE2 3.24Å; N8-E11 WeakPolarHBondContact ND2-CG 3.44Å; N8-E11 PolarHBondContact ND2-OE2 2.8Å; N8-E11 PolarHBondContact O-N 3.26Å; N8-E11 PolarHBondContact OD1-N 3.02Å; Y9-E11 VanDerWaalsContact C-N 3.32Å; Y9-E11 PolarHBondContact O-N 2.93Å
12	D	75.3	Confident	70.9	Confident	71 Å²	71	124.7 Å²	124.7	38%	0.38	64%	0.644	S	S	.	*	H	α-helix	trans	-82.2	-19.6	-171.5	-162.6	34.9	0	0	0	113.9	Y7 N8 V14 A15 G16	Y7-D12 HydrophobicContact CE2-CB 3.68Å; Y7-D12 WeakPolarHBondContact CE2-OD2 3.37Å; Y7-D12 PolarHBondContact OH-OD2 3.48Å; N8-D12 PolarHBondContact O-N 2.94Å; N8-D12 VanDerWaalsContact O-N 3.11Å; D12-V14 PolarHBondContact O-N 3.19Å; D12-A15 PolarHBondContact O-N 3.18Å; D12-G16 PolarHBondContact O-N 3.43Å
13	K	72.1	Confident	70	Confident	103 Å²	103	121.9 Å²	121.9	45%	0.448	62%	0.621	S	S	.	*	H	α-helix	trans	-55.1	-29.2	177	74.8	-174.8	175.2	-175.7	0	113.3	Y9 E10	Y9-K13 HydrophobicContact CE1-CD 4.37Å; Y9-K13 WeakPolarHBondContact O-CB 2.94Å; Y9-K13 PolarHBondContact O-N 3.3Å; E10-K13 WeakPolarHBondContact O-CE 3.38Å; E10-K13 IonicContact OE1-NZ 2.61Å; E10-K13 PolarHBondContact OE1-NZ 2.71Å; E10-K13 IonicContact OE2-NZ 3.57Å; E10-K13 PolarHBondContact OE2-NZ 2.79Å
14	V	66.4	Low	69.5	Low	96 Å²	96	116.9 Å²	116.9	58%	0.582	60%	0.603	S	S	*	*	H	α-helix	trans	-97.8	-38.3	178.8	-169.3	0	0	0	0	111.2	D12 G16 S17	D12-V14 PolarHBondContact O-N 3.19Å; V14-G16 PolarHBondContact O-N 3.04Å; V14-S17 WeakPolarHBondContact O-CB 3.46Å; V14-S17 PolarHBondContact O-N 2.94Å; V14-S17 PolarHBondContact O-OG 3Å
15	A	62.9	Low	68.8	Low	80 Å²	80	117.1 Å²	117.1	66%	0.661	61%	0.608	S	S	*	*	H	α-helix	trans	-63.6	-31.5	179.2	0	0	0	0	0	112.3	D12 S17	D12-A15 PolarHBondContact O-N 3.18Å; A15-S17 PolarHBondContact O-N 3.43Å
16	G	58	Low	68.1	Low	48 Å²	48	117.6 Å²	117.6	50%	0.495	60%	0.602	S	S	.	*	T	Hydrogen-bonded Turn	trans	-71.3	13.4	175.8	0	0	0	0	0	116.4	D12 V14 K18	D12-G16 PolarHBondContact O-N 3.43Å; V14-G16 PolarHBondContact O-N 3.04Å; G16-K18 PolarHBondContact O-N 3.4Å
17	S	57	Low	67.3	Low	76 Å²	76	112.5 Å²	112.5	53%	0.531	58%	0.58	S	S	.	*			trans	-66.9	45.1	-178.1	-64.3	0	0	0	0	114.8	V14 A15 G19	V14-S17 WeakPolarHBondContact O-CB 3.46Å; V14-S17 PolarHBondContact O-N 2.94Å; V14-S17 PolarHBondContact O-OG 3Å; A15-S17 PolarHBondContact O-N 3.43Å; S17-G19 PolarHBondContact O-N 3.44Å
18	K	57.5	Low	66.5	Low	189 Å²	189	108.5 Å²	108.5	82%	0.822	57%	0.571	S	S	*	*			trans	-81.2	4.4	164	-61	-162.8	-178.7	-179.8	0	112.4	G16	G16-K18 PolarHBondContact O-N 3.4Å
19	G	54.5	Low	65.7	Low	57 Å²	57	112.1 Å²	112.1	59%	0.588	59%	0.585	S	S	*	*	S	Bend	trans	-85.7	108.7	-173.5	0	0	0	0	0	115.2	S17 K21	S17-G19 PolarHBondContact O-N 3.44Å; G19-K21 VanDerWaalsContact C-N 3.34Å; G19-K21 PolarHBondContact O-N 3.07Å
20	G	57.5	Low	65.2	Low	59 Å²	59	110.2 Å²	110.2	61%	0.608	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	65.1	-60.2	138.4	0	0	0	0	0	120.2
21	K	61.2	Low	64.5	Low	202 Å²	202	110.3 Å²	110.3	88%	0.878	58%	0.582	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.8	-28.2	-166.5	-72.5	179.6	176.4	176.3	0	114.1	G19	G19-K21 VanDerWaalsContact C-N 3.34Å; G19-K21 PolarHBondContact O-N 3.07Å
22	N	62.5	Low	64.1	Low	135 Å²	135	110.1 Å²	110.1	72%	0.722	58%	0.58	S	S	*	*	S	Bend	trans	-103.2	13.4	-176.3	-62.3	-20.9	0	0	0	113.4	T24	N22-T24 PolarHBondContact O-N 3.06Å
23	R	64.1	Low	63.5	Low	114 Å²	114	114.2 Å²	114.2	43%	0.43	60%	0.595	S	S	.	*			trans	-57.4	126.2	173.1	-74.5	-173.6	-175.4	169.9	1	108.3	D27 V28	R23-D27 HydrophobicContact CB-CB 4.07Å; R23-D27 HydrophobicContact CG-CB 4.46Å; R23-V28 HydrophobicContact CB-CG2 3.87Å
24	T	67	Low	63	Low	79 Å²	79	116.2 Å²	116.2	49%	0.485	60%	0.604	S	S	.	*			trans	-62.8	156.5	178.3	65.8	0	0	0	0	108.8	N22 R26 D27 V28	N22-T24 PolarHBondContact O-N 3.06Å; T24-R26 PolarHBondContact O-N 3.35Å; T24-D27 WeakPolarHBondContact CB-OD2 3.47Å; T24-D27 PolarHBondContact N-OD2 3.29Å; T24-D27 PolarHBondContact O-N 2.88Å; T24-D27 PolarHBondContact OG1-OD2 2.88Å; T24-V28 PolarHBondContact O-N 3.45Å
25	K	66.7	Low	62.9	Low	195 Å²	195	114.7 Å²	114.7	85%	0.848	60%	0.597	S	S	*	*	H	α-helix	trans	-50.8	-33	178.6	-68.9	-175.2	179.2	179.8	0	112.1	V28 E29	K25-V28 PolarHBondContact O-N 2.89Å; K25-E29 PolarHBondContact O-N 3.43Å
26	R	66.4	Low	63.1	Low	189 Å²	189	120.4 Å²	120.4	71%	0.713	61%	0.61	S	S	*	*	H	α-helix	trans	-63.9	-46.3	176.1	-166.3	178.6	111.6	155.8	5.3	112.5	T24 V28 E29 E30	T24-R26 PolarHBondContact O-N 3.35Å; R26-V28 VanDerWaalsContact C-N 3.32Å; R26-V28 PolarHBondContact O-N 2.93Å; R26-E29 PolarHBondContact O-N 2.71Å; R26-E30 PolarHBondContact O-N 3.15Å
27	D	66.6	Low	63.5	Low	54 Å²	54	125.5 Å²	125.5	29%	0.289	63%	0.626	S	S	.	*	H	α-helix	trans	-67.4	-37.5	179.2	-51.6	-44.3	0	0	0	111	R23 T24 E30 H31	R23-D27 HydrophobicContact CB-CB 4.07Å; R23-D27 HydrophobicContact CG-CB 4.46Å; T24-D27 WeakPolarHBondContact CB-OD2 3.47Å; T24-D27 PolarHBondContact N-OD2 3.29Å; T24-D27 PolarHBondContact O-N 2.88Å; T24-D27 PolarHBondContact OG1-OD2 2.88Å; D27-E30 PolarHBondContact O-N 2.75Å; D27-H31 PolarHBondContact O-CD2 3.23Å; D27-H31 PolarHBondContact O-N 3.35Å
28	V	66.2	Low	63.8	Low	59 Å²	59	130.6 Å²	130.6	36%	0.358	63%	0.634	S	S	.	*	H	α-helix	trans	-61.8	-44.9	175.4	177.1	0	0	0	0	110.5	R23 T24 K25 R26 H31 H32	R23-V28 HydrophobicContact CB-CG2 3.87Å; T24-V28 PolarHBondContact O-N 3.45Å; K25-V28 PolarHBondContact O-N 2.89Å; R26-V28 VanDerWaalsContact C-N 3.32Å; R26-V28 PolarHBondContact O-N 2.93Å; V28-H31 PolarHBondContact O-N 3.11Å; V28-H32 VanDerWaalsContact CG1-ND1 3.34Å; V28-H32 WeakPolarHBondContact CG1-ND1 3.46Å; V28-H32 WeakPolarHBondContact O-CB 3.35Å; V28-H32 PolarHBondContact O-N 3.43Å; V28-H32 VanDerWaalsContact O-N 3.07Å; V28-H32 PolarHBondContact O-ND1 2.88Å
29	E	65.4	Low	64.2	Low	148 Å²	148	126.1 Å²	126.1	69%	0.692	62%	0.622	S	S	*	*	H	α-helix	trans	-65.2	-40	178.2	-170.9	170.1	-124.2	0	0	112.1	K25 R26 H31 H32 K33	K25-E29 PolarHBondContact O-N 3.43Å; R26-E29 PolarHBondContact O-N 2.71Å; E29-H31 PolarHBondContact O-N 2.97Å; E29-H32 CarbonylContact O-C 3.51Å; E29-H32 PolarHBondContact O-N 2.84Å; E29-K33 PolarHBondContact O-N 3.01Å; E29-K33 VanDerWaalsContact O-N 3.15Å
30	E	69.2	Low	64.7	Low	106 Å²	106	129.3 Å²	129.3	50%	0.495	63%	0.626	S	S	.	*	H	α-helix	trans	-62.1	-41.6	175.8	-177.2	165.7	-159	0	0	112.5	R26 D27 H32 K33	R26-E30 PolarHBondContact O-N 3.15Å; D27-E30 PolarHBondContact O-N 2.75Å; E30-H32 VanDerWaalsContact C-N 3.31Å; E30-H32 PolarHBondContact O-N 3.31Å; E30-K33 WeakPolarHBondContact O-CG 3.41Å; E30-K33 PolarHBondContact O-N 3.49Å
31	H	64.7	Low	65.3	Low	116 Å²	116	134.5 Å²	134.5	54%	0.537	63%	0.627	S	S	.	*	H	α-helix	trans	-74.9	-18.4	177.3	-71.4	-57.8	0	0	0	114.1	D27 V28 E29	D27-H31 PolarHBondContact O-CD2 3.23Å; D27-H31 PolarHBondContact O-N 3.35Å; V28-H31 PolarHBondContact O-N 3.11Å; E29-H31 PolarHBondContact O-N 2.97Å
32	H	64.5	Low	65.5	Low	136 Å²	136	131.5 Å²	131.5	63%	0.63	62%	0.619	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.3	14.7	176.8	-65.8	112.2	0	0	0	113.4	V28 E29 E30 K34	V28-H32 VanDerWaalsContact CG1-ND1 3.34Å; V28-H32 WeakPolarHBondContact CG1-ND1 3.46Å; V28-H32 WeakPolarHBondContact O-CB 3.35Å; V28-H32 PolarHBondContact O-N 3.43Å; V28-H32 VanDerWaalsContact O-N 3.07Å; V28-H32 PolarHBondContact O-ND1 2.88Å; E29-H32 CarbonylContact O-C 3.51Å; E29-H32 PolarHBondContact O-N 2.84Å; E30-H32 VanDerWaalsContact C-N 3.31Å; E30-H32 PolarHBondContact O-N 3.31Å; H32-K34 PolarHBondContact O-N 3.47Å
33	K	62.8	Low	65.5	Low	157 Å²	157	130.4 Å²	130.4	68%	0.683	61%	0.61	S	S	*	*			trans	-48.1	109.8	175.5	-79.2	-175.6	-176	-178.4	0	109.3	E29 E30 S35	E29-K33 PolarHBondContact O-N 3.01Å; E29-K33 VanDerWaalsContact O-N 3.15Å; E30-K33 WeakPolarHBondContact O-CG 3.41Å; E30-K33 PolarHBondContact O-N 3.49Å; K33-S35 PolarHBondContact O-N 3.4Å
34	K	61.8	Low	65.4	Low	146 Å²	146	132.2 Å²	132.2	64%	0.635	63%	0.626	S	S	*	*			trans	-63.1	110.9	176.6	-64.3	176.8	178.4	-178.7	0	105.5	H32 E36 N40	H32-K34 PolarHBondContact O-N 3.47Å; K34-E36 PolarHBondContact O-N 3.49Å; K34-N40 PolarHBondContact NZ-OD1 3.05Å
35	S	64.2	Low	64.9	Low	64 Å²	64	134.2 Å²	134.2	45%	0.448	63%	0.634	S	S	.	*			trans	-48.9	140.6	169.5	57.5	0	0	0	0	108.8	K33 N37 R38	K33-S35 PolarHBondContact O-N 3.4Å; S35-N37 PolarHBondContact O-N 3.47Å; S35-R38 WeakPolarHBondContact O-CB 3.28Å; S35-R38 PolarHBondContact O-N 3.01Å; S35-R38 WeakPolarHBondContact OG-CD 3.44Å; S35-R38 VanDerWaalsContact OG-CG 3.24Å; S35-R38 WeakPolarHBondContact OG-CG 3.41Å
36	E	67.8	Low	64.5	Low	199 Å²	199	135.1 Å²	135.1	93%	0.93	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.7	-26.8	-176.7	-66.6	178	170.3	0	0	113	K34 R38	K34-E36 PolarHBondContact O-N 3.49Å; E36-R38 PolarHBondContact O-N 3.22Å
37	N	66.8	Low	64.2	Low	155 Å²	155	135.2 Å²	135.2	83%	0.829	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.5	-2.4	178.5	-59.4	-16.2	0	0	0	114.7	S35 T39	S35-N37 PolarHBondContact O-N 3.47Å; N37-T39 PolarHBondContact O-N 3.38Å
38	R	62.2	Low	63.8	Low	184 Å²	184	137.7 Å²	137.7	69%	0.694	66%	0.659	S	S	*	*			trans	-85.1	95.5	173.8	-85.4	176.9	179.4	-156.1	-0.1	108.4	S35 E36 N40	S35-R38 WeakPolarHBondContact O-CB 3.28Å; S35-R38 PolarHBondContact O-N 3.01Å; S35-R38 WeakPolarHBondContact OG-CD 3.44Å; S35-R38 VanDerWaalsContact OG-CG 3.24Å; S35-R38 WeakPolarHBondContact OG-CG 3.41Å; E36-R38 PolarHBondContact O-N 3.22Å; R38-N40 PolarHBondContact O-N 2.74Å
39	T	66	Low	63.6	Low	94 Å²	94	140.1 Å²	140.1	58%	0.577	67%	0.67	S	S	*	*			trans	-51.8	137.4	167.6	60.8	0	0	0	0	108.9	N37 R41	N37-T39 PolarHBondContact O-N 3.38Å; T39-R41 PolarHBondContact O-N 3.07Å; T39-R41 WeakPolarHBondContact OG1-CB 3.42Å
40	N	66	Low	63.6	Low	125 Å²	125	137 Å²	137	67%	0.668	66%	0.658	S	S	*	*	S	Bend	trans	-62.9	9.9	171.2	-72.1	-50.6	0	0	0	113.2	K34 R38 I42	K34-N40 PolarHBondContact NZ-OD1 3.05Å; R38-N40 PolarHBondContact O-N 2.74Å; N40-I42 PolarHBondContact O-N 3.31Å
41	R	68.9	Low	63.4	Low	168 Å²	168	136.8 Å²	136.8	63%	0.634	66%	0.657	S	S	*	*			trans	-61.6	102.3	171.2	-166.6	173.5	73.2	-173.9	5.2	108	T39 H43	T39-R41 PolarHBondContact O-N 3.07Å; T39-R41 WeakPolarHBondContact OG1-CB 3.42Å; R41-H43 PolarHBondContact NH2-NE2 2.99Å; R41-H43 PolarHBondContact O-N 3.29Å
42	I	65.1	Low	63.4	Low	139 Å²	139	138 Å²	138	71%	0.713	66%	0.663	S	S	*	*			trans	-57.9	110	165.2	-57.4	172.6	0	0	0	104.8	N40 I44	N40-I42 PolarHBondContact O-N 3.31Å; I42-I44 VanDerWaalsContact C-N 3.32Å; I42-I44 HydrophobicContact CB-CG1 4.37Å; I42-I44 HydrophobicContact CG2-CG1 3.86Å; I42-I44 PolarHBondContact O-N 2.91Å
43	H	63.9	Low	63.6	Low	112 Å²	112	137.8 Å²	137.8	52%	0.519	66%	0.66	S	S	.	*			trans	-68	100.9	168	-84	94.3	0	0	0	106.1	R41 D45	R41-H43 PolarHBondContact NH2-NE2 2.99Å; R41-H43 PolarHBondContact O-N 3.29Å; H43-D45 IonicContact CD2-OD2 3.4Å; H43-D45 PolarHBondContact CD2-OD2 3.26Å; H43-D45 PolarHBondContact O-N 3.49Å
44	I	61.6	Low	63.9	Low	152 Å²	152	135.5 Å²	135.5	78%	0.779	65%	0.652	S	S	*	*			trans	-88.4	33.8	167.4	-44.7	166.9	0	0	0	107.8	I42 Y46	I42-I44 VanDerWaalsContact C-N 3.32Å; I42-I44 HydrophobicContact CB-CG1 4.37Å; I42-I44 HydrophobicContact CG2-CG1 3.86Å; I42-I44 PolarHBondContact O-N 2.91Å; I44-Y46 PolarHBondContact O-N 3.06Å
45	D	57.1	Low	64.3	Low	121 Å²	121	136.1 Å²	136.1	65%	0.647	65%	0.65	S	S	*	*	S	Bend	trans	-77.2	114.9	168.9	-69.8	-24.2	0	0	0	105.2	H43 Q47	H43-D45 IonicContact CD2-OD2 3.4Å; H43-D45 PolarHBondContact CD2-OD2 3.26Å; H43-D45 PolarHBondContact O-N 3.49Å; D45-Q47 PolarHBondContact O-N 3.49Å
46	Y	56.8	Low	64.4	Low	214 Å²	214	138.1 Å²	138.1	84%	0.839	65%	0.652	S	S	*	*			trans	9.6	91	166.4	-82.3	-101.5	0	0	0	111.4	I44 V48	I44-Y46 PolarHBondContact O-N 3.06Å; Y46-V48 PolarHBondContact O-N 3.47Å
47	Q	59.6	Low	64.4	Low	190 Å²	190	133.9 Å²	133.9	89%	0.888	63%	0.633	S	S	*	*			trans	-64.5	76.3	155.5	-73.1	-177.2	-15.7	0	0	105	D45 N49	D45-Q47 PolarHBondContact O-N 3.49Å; Q47-N49 VanDerWaalsContact C-N 3.29Å; Q47-N49 PolarHBondContact O-N 3Å
48	V	59.4	Low	64.5	Low	106 Å²	106	131.6 Å²	131.6	64%	0.642	62%	0.62	S	S	*	*			trans	-56.5	110.1	167.2	-179.7	0	0	0	0	102	Y46 N50	Y46-V48 PolarHBondContact O-N 3.47Å; V48-N50 WeakPolarHBondContact O-CA 3.24Å; V48-N50 WeakPolarHBondContact O-CB 3.37Å; V48-N50 PolarHBondContact O-N 2.71Å
49	N	62.8	Low	64.6	Low	111 Å²	111	127 Å²	127	59%	0.594	62%	0.617	S	S	*	*			trans	-54.2	100.5	-179.2	-177.5	3.8	0	0	0	105.7	Q47 E51	Q47-N49 VanDerWaalsContact C-N 3.29Å; Q47-N49 PolarHBondContact O-N 3Å; N49-E51 VanDerWaalsContact ND2-CD 3.34Å; N49-E51 PolarHBondContact ND2-OE1 2.96Å; N49-E51 PolarHBondContact O-N 2.76Å; N49-E51 WeakPolarHBondContact OD1-CG 3.34Å
50	N	65.3	Low	64.5	Low	81 Å²	81	129.3 Å²	129.3	43%	0.433	62%	0.619	S	S	.	*	T	Hydrogen-bonded Turn	trans	-82.4	37.9	-163.5	-164.8	26	0	0	0	109.3	V48 E52 K53 Q54	V48-N50 WeakPolarHBondContact O-CA 3.24Å; V48-N50 WeakPolarHBondContact O-CB 3.37Å; V48-N50 PolarHBondContact O-N 2.71Å; N50-E52 PolarHBondContact O-N 3.21Å; N50-K53 WeakPolarHBondContact ND2-CB 3.35Å; N50-K53 WeakPolarHBondContact ND2-CD 3.32Å; N50-K53 PolarHBondContact O-N 3.28Å; N50-K53 WeakPolarHBondContact OD1-CB 3.41Å; N50-Q54 WeakPolarHBondContact O-CB 3.46Å; N50-Q54 WeakPolarHBondContact O-CG 3.47Å; N50-Q54 PolarHBondContact O-N 3.33Å
51	E	64.5	Low	64.2	Low	103 Å²	103	128.4 Å²	128.4	48%	0.481	61%	0.61	S	S	.	*	H	α-helix	trans	-56	-36.5	-179.5	-94.3	176.1	-154.2	0	0	110.6	N49 R55	N49-E51 VanDerWaalsContact ND2-CD 3.34Å; N49-E51 PolarHBondContact ND2-OE1 2.96Å; N49-E51 PolarHBondContact O-N 2.76Å; N49-E51 WeakPolarHBondContact OD1-CG 3.34Å; E51-R55 VanDerWaalsContact O-CB 3.28Å; E51-R55 WeakPolarHBondContact O-CB 3.48Å; E51-R55 VanDerWaalsContact O-CG 3.24Å; E51-R55 WeakPolarHBondContact O-CG 3.38Å; E51-R55 PolarHBondContact O-N 3.03Å; E51-R55 PolarHBondContact O-NE 2.67Å
52	E	65.1	Low	63.7	Low	140 Å²	140	122.5 Å²	122.5	65%	0.654	60%	0.602	S	S	*	*	H	α-helix	trans	-65.1	-50.5	176.1	-169.3	169	-153.2	0	0	111.9	N50 Q54 R55 E56	N50-E52 PolarHBondContact O-N 3.21Å; E52-Q54 VanDerWaalsContact C-N 3.34Å; E52-Q54 PolarHBondContact O-N 3.03Å; E52-R55 WeakPolarHBondContact O-CB 3.49Å; E52-R55 PolarHBondContact O-N 2.65Å; E52-E56 PolarHBondContact O-N 2.93Å
53	K	67.9	Low	63.3	Low	133 Å²	133	119.9 Å²	119.9	58%	0.578	60%	0.596	S	S	*	*	H	α-helix	trans	-68.8	-33	179.4	-157.4	-178.6	-163.3	175.4	0	112.6	N50 Q57	N50-K53 WeakPolarHBondContact ND2-CB 3.35Å; N50-K53 WeakPolarHBondContact ND2-CD 3.32Å; N50-K53 PolarHBondContact O-N 3.28Å; N50-K53 WeakPolarHBondContact OD1-CB 3.41Å; K53-Q57 PolarHBondContact O-N 3.21Å
54	Q	70	Confident	62.9	Low	109 Å²	109	121.5 Å²	121.5	51%	0.509	60%	0.604	S	S	.	*	H	α-helix	trans	-64.6	-43.4	171.4	-75.8	-90.7	29.5	0	0	111	N50 E52 Q57 N58	N50-Q54 WeakPolarHBondContact O-CB 3.46Å; N50-Q54 WeakPolarHBondContact O-CG 3.47Å; N50-Q54 PolarHBondContact O-N 3.33Å; E52-Q54 VanDerWaalsContact C-N 3.34Å; E52-Q54 PolarHBondContact O-N 3.03Å; Q54-Q57 PolarHBondContact O-N 3.36Å; Q54-N58 WeakPolarHBondContact O-CB 3.44Å; Q54-N58 VanDerWaalsContact O-CG 3.29Å; Q54-N58 PolarHBondContact O-N 3.46Å; Q54-N58 PolarHBondContact O-ND2 3.42Å
55	R	69.5	Low	62.5	Low	158 Å²	158	121.3 Å²	121.3	60%	0.596	60%	0.604	S	S	*	*	H	α-helix	trans	-60.3	-47.9	174.3	-81.8	-174.4	-73.3	-154.4	0.1	111.2	E51 E52 Q57 N58 S59	E51-R55 VanDerWaalsContact O-CB 3.28Å; E51-R55 WeakPolarHBondContact O-CB 3.48Å; E51-R55 VanDerWaalsContact O-CG 3.24Å; E51-R55 WeakPolarHBondContact O-CG 3.38Å; E51-R55 PolarHBondContact O-N 3.03Å; E51-R55 PolarHBondContact O-NE 2.67Å; E52-R55 WeakPolarHBondContact O-CB 3.49Å; E52-R55 PolarHBondContact O-N 2.65Å; R55-Q57 PolarHBondContact O-N 3.26Å; R55-N58 PolarHBondContact O-N 3.22Å; R55-S59 PolarHBondContact O-N 3.02Å; R55-S59 PolarHBondContact O-OG 3.42Å; R55-S59 VanDerWaalsContact O-OG 3.07Å
56	E	66.3	Low	62.3	Low	106 Å²	106	124.4 Å²	124.4	50%	0.495	61%	0.612	S	S	.	*	H	α-helix	trans	-60.2	-43.2	177.4	-73.9	-171.8	171.8	0	0	112.9	E52 S59 K60	E52-E56 PolarHBondContact O-N 2.93Å; E56-S59 PolarHBondContact O-N 3.46Å; E56-K60 WeakPolarHBondContact O-CG 3.49Å; E56-K60 PolarHBondContact O-N 3.35Å
57	Q	68.2	Low	61.5	Low	111 Å²	111	127.2 Å²	127.2	52%	0.519	63%	0.629	S	S	.	*	H	α-helix	trans	-63.1	-44.6	176.9	-108.3	-173.4	-4.4	0	0	111.8	K53 Q54 R55 S59 K60 H61	K53-Q57 PolarHBondContact O-N 3.21Å; Q54-Q57 PolarHBondContact O-N 3.36Å; R55-Q57 PolarHBondContact O-N 3.26Å; Q57-S59 VanDerWaalsContact C-N 3.3Å; Q57-S59 PolarHBondContact O-N 3.38Å; Q57-K60 PolarHBondContact O-N 3.15Å; Q57-H61 PolarHBondContact O-CD2 2.61Å; Q57-H61 PolarHBondContact O-N 3.25Å; Q57-H61 VanDerWaalsContact O-N 3.11Å
58	N	67.7	Low	61.6	Low	106 Å²	106	124.1 Å²	124.1	57%	0.567	62%	0.616	S	S	*	*	H	α-helix	trans	-65	-35.3	177.8	-72.8	-16.2	0	0	0	111.9	Q54 R55 G62	Q54-N58 WeakPolarHBondContact O-CB 3.44Å; Q54-N58 VanDerWaalsContact O-CG 3.29Å; Q54-N58 PolarHBondContact O-N 3.46Å; Q54-N58 PolarHBondContact O-ND2 3.42Å; R55-N58 PolarHBondContact O-N 3.22Å; N58-G62 PolarHBondContact O-N 2.84Å
59	S	65.3	Low	61.7	Low	88 Å²	88	125.1 Å²	125.1	62%	0.615	61%	0.614	S	S	*	*	H	α-helix	trans	-65.5	-39.5	174.2	-64.7	0	0	0	0	112.5	R55 E56 Q57	R55-S59 PolarHBondContact O-N 3.02Å; R55-S59 PolarHBondContact O-OG 3.42Å; R55-S59 VanDerWaalsContact O-OG 3.07Å; E56-S59 PolarHBondContact O-N 3.46Å; Q57-S59 VanDerWaalsContact C-N 3.3Å; Q57-S59 PolarHBondContact O-N 3.38Å
60	K	63.9	Low	61.7	Low	143 Å²	143	125.8 Å²	125.8	62%	0.622	62%	0.615	S	S	*	*	H	α-helix	trans	-64.1	-48.6	176.6	-70.7	178.1	-173.9	179	0	111.3	E56 Q57 G62 S63	E56-K60 WeakPolarHBondContact O-CG 3.49Å; E56-K60 PolarHBondContact O-N 3.35Å; Q57-K60 PolarHBondContact O-N 3.15Å; K60-G62 PolarHBondContact O-N 3.01Å; K60-S63 PolarHBondContact O-N 3.17Å; K60-S63 PolarHBondContact O-OG 3.34Å
61	H	58.6	Low	61.5	Low	105 Å²	105	128.5 Å²	128.5	49%	0.486	63%	0.626	S	S	.	*	H	α-helix	trans	-73.1	-26.6	-179.9	-69	-54	0	0	0	114	Q57 S63 E64	Q57-H61 PolarHBondContact O-CD2 2.61Å; Q57-H61 PolarHBondContact O-N 3.25Å; Q57-H61 VanDerWaalsContact O-N 3.11Å; H61-S63 PolarHBondContact O-N 3.11Å; H61-E64 IonicContact ND1-OE2 2.84Å; H61-E64 PolarHBondContact O-N 2.71Å
62	G	58.2	Low	61.3	Low	45 Å²	45	130.1 Å²	130.1	46%	0.464	64%	0.635	S	S	.	*	H	α-helix	trans	-63.9	-22.8	174	0	0	0	0	0	113.5	N58 K60	N58-G62 PolarHBondContact O-N 2.84Å; K60-G62 PolarHBondContact O-N 3.01Å
63	S	57	Low	61	Low	84 Å²	84	129.4 Å²	129.4	59%	0.587	63%	0.634	S	S	*	*	H	α-helix	trans	-82.5	-22.6	178.2	70.8	0	0	0	0	114.1	K60 H61	K60-S63 PolarHBondContact O-N 3.17Å; K60-S63 PolarHBondContact O-OG 3.34Å; H61-S63 PolarHBondContact O-N 3.11Å
64	E	55.3	Low	60.5	Low	145 Å²	145	129.1 Å²	129.1	68%	0.678	64%	0.638	S	S	*	*	H	α-helix	trans	-80.7	-20.5	-179.2	-67.3	178.6	157.3	0	0	112.7	H61	H61-E64 IonicContact ND1-OE2 2.84Å; H61-E64 PolarHBondContact O-N 2.71Å
65	N	54.8	Low	59.8	Low	148 Å²	148	130.7 Å²	130.7	79%	0.791	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.2	12.5	178.9	-73.3	-37.6	0	0	0	114.4
66	K	51.5	Low	59	Low	186 Å²	186	128.4 Å²	128.4	81%	0.809	65%	0.652	S	S	*	*			trans	-108	75.3	171.3	-81.9	-174	176.6	-175.8	0	110.2
67	K	41.1	Very low	58.3	Low	274 Å²	274	130.5 Å²	130.5	100%	1.191	67%	0.666	S	S	*	*			trans	-149	0	160	-141.5	179.8	-173	-178.6	0	111

Retrieved 67 of 67 residues in 14.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).