A0A5K4F7C9_SCHMA Loading...

UPF0506 domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4F7C9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 89 aa.

						>A0A5K4F7C9_SCHMA|A0A5K4F7C9
MLKASVFFITIILTILLENSHGKGCRALGEKCSKTVFDRCCGDTVCHLSSPFHGKCVKCLKEGTLCVSDKNCCSHKCNIGKCTKEKHHY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.3	Low	75.9	Confident	224 Å²	224	116.5 Å²	116.5	100%	1.103	60%	0.602	S	S	*	*				0	-58.3	0	-65.1	-68.7	162.3	0	0	111.9	K3 A4	M1-K3 PolarHBondContact O-N 2.96Å; M1-A4 PolarHBondContact O-N 3.2Å
2	L	63.5	Low	76.4	Confident	146 Å²	146	115.5 Å²	115.5	76%	0.764	60%	0.597	S	S	*	*	H	α-helix	trans	-60.7	-37.9	-174.3	-155.5	71.3	0	0	0	115.7	A4 S5 V6	L2-A4 VanDerWaalsContact C-N 3.34Å; L2-A4 PolarHBondContact O-N 3.24Å; L2-S5 PolarHBondContact O-N 2.99Å; L2-V6 PolarHBondContact O-N 3.18Å
3	K	70	Confident	76.8	Confident	193 Å²	193	114.4 Å²	114.4	84%	0.839	59%	0.592	S	S	*	*	H	α-helix	trans	-61.6	-36.8	-178.7	-72.8	-179.2	173.4	176.4	0	113.8	M1 F7	M1-K3 PolarHBondContact O-N 2.96Å; K3-F7 PolarHBondContact O-N 3.46Å
4	A	68.6	Low	76.8	Confident	54 Å²	54	111.5 Å²	111.5	45%	0.446	58%	0.582	S	S	.	*	H	α-helix	trans	-69.7	-42.1	179.1	0	0	0	0	0	111.2	M1 L2 V6 F7 F8	M1-A4 PolarHBondContact O-N 3.2Å; L2-A4 VanDerWaalsContact C-N 3.34Å; L2-A4 PolarHBondContact O-N 3.24Å; A4-V6 VanDerWaalsContact C-N 3.34Å; A4-V6 PolarHBondContact O-N 3.48Å; A4-F7 WeakPolarHBondContact O-CB 3.39Å; A4-F7 PolarHBondContact O-N 3.34Å; A4-F8 HydrophobicContact CB-CE2 4.44Å; A4-F8 WeakPolarHBondContact O-CD2 2.94Å; A4-F8 PolarHBondContact O-N 2.68Å; A4-F8 VanDerWaalsContact O-N 3.11Å
5	S	77.2	Confident	76.6	Confident	66 Å²	66	109.4 Å²	109.4	46%	0.462	57%	0.57	S	S	.	*	H	α-helix	trans	-61.2	-40.3	178.9	-168.1	0	0	0	0	112.6	L2 F7 I9	L2-S5 PolarHBondContact O-N 2.99Å; S5-F7 VanDerWaalsContact C-N 3.34Å; S5-I9 WeakPolarHBondContact O-CD1 3.31Å; S5-I9 VanDerWaalsContact O-CG1 3.27Å; S5-I9 WeakPolarHBondContact O-CG1 3.49Å; S5-I9 PolarHBondContact O-N 3.1Å; S5-I9 VanDerWaalsContact O-N 3.17Å
6	V	79.1	Confident	76.2	Confident	83 Å²	83	108.9 Å²	108.9	50%	0.503	57%	0.568	S	S	.	*	H	α-helix	trans	-65.2	-40.1	176.9	176.4	0	0	0	0	111	L2 A4 F8 I9 T10	L2-V6 PolarHBondContact O-N 3.18Å; A4-V6 VanDerWaalsContact C-N 3.34Å; A4-V6 PolarHBondContact O-N 3.48Å; V6-F8 PolarHBondContact O-N 3.4Å; V6-I9 PolarHBondContact O-N 2.9Å; V6-T10 WeakPolarHBondContact O-CG2 3.31Å; V6-T10 PolarHBondContact O-N 2.01Å; V6-T10 PolarHBondContact O-OG1 3.37Å
7	F	80.3	Confident	75.6	Confident	136 Å²	136	109.5 Å²	109.5	60%	0.596	57%	0.571	S	S	*	*	H	α-helix	trans	-63.7	-42.6	179.4	-158.5	-104.9	0	0	0	112.3	K3 A4 S5 T10 I11	K3-F7 PolarHBondContact O-N 3.46Å; A4-F7 WeakPolarHBondContact O-CB 3.39Å; A4-F7 PolarHBondContact O-N 3.34Å; S5-F7 VanDerWaalsContact C-N 3.34Å; F7-T10 WeakPolarHBondContact CA-OG1 3.32Å; F7-T10 PolarHBondContact O-N 2.89Å; F7-T10 PolarHBondContact O-OG1 2.82Å; F7-I11 HydrophobicContact CD1-CD1 3.51Å; F7-I11 HydrophobicContact CD1-CG1 4.39Å; F7-I11 HydrophobicContact CE1-CD1 3.5Å; F7-I11 VanDerWaalsContact CE1-CD1 3.5Å; F7-I11 HydrophobicContact CE1-CG1 4.37Å; F7-I11 HydrophobicContact CG-CD1 4.47Å; F7-I11 HydrophobicContact CZ-CD1 4.42Å; F7-I11 WeakPolarHBondContact O-CG1 3.03Å; F7-I11 PolarHBondContact O-N 3.31Å
8	F	81.2	Confident	74.8	Confident	137 Å²	137	111.5 Å²	111.5	60%	0.601	58%	0.577	S	S	*	*	H	α-helix	trans	-63	-42.3	174.8	-73.5	-67	0	0	0	112.2	A4 V6 T10 I11 I12	A4-F8 HydrophobicContact CB-CE2 4.44Å; A4-F8 WeakPolarHBondContact O-CD2 2.94Å; A4-F8 PolarHBondContact O-N 2.68Å; A4-F8 VanDerWaalsContact O-N 3.11Å; V6-F8 PolarHBondContact O-N 3.4Å; F8-T10 VanDerWaalsContact C-N 3.33Å; F8-T10 PolarHBondContact O-N 2.95Å; F8-I11 PolarHBondContact O-N 2.84Å; F8-I12 WeakPolarHBondContact O-CG1 3.49Å; F8-I12 PolarHBondContact O-N 3.09Å
9	I	84.6	Confident	73.7	Confident	109 Å²	109	112.1 Å²	112.1	56%	0.559	58%	0.581	S	S	*	*	H	α-helix	trans	-61.6	-43	176.7	-66.3	163.3	0	0	0	110.7	S5 V6 I11 I12 L13	S5-I9 WeakPolarHBondContact O-CD1 3.31Å; S5-I9 VanDerWaalsContact O-CG1 3.27Å; S5-I9 WeakPolarHBondContact O-CG1 3.49Å; S5-I9 PolarHBondContact O-N 3.1Å; S5-I9 VanDerWaalsContact O-N 3.17Å; V6-I9 PolarHBondContact O-N 2.9Å; I9-I11 PolarHBondContact O-N 3.37Å; I9-I12 PolarHBondContact O-N 3.08Å; I9-L13 WeakPolarHBondContact O-CB 3.35Å; I9-L13 PolarHBondContact O-N 3.01Å
10	T	83.4	Confident	72.7	Confident	68 Å²	68	110.7 Å²	110.7	42%	0.417	58%	0.582	S	S	.	*	H	α-helix	trans	-64.4	-39.9	178	50.7	0	0	0	0	112.6	V6 F7 F8 L13 T14	V6-T10 WeakPolarHBondContact O-CG2 3.31Å; V6-T10 PolarHBondContact O-N 2.01Å; V6-T10 PolarHBondContact O-OG1 3.37Å; F7-T10 WeakPolarHBondContact CA-OG1 3.32Å; F7-T10 PolarHBondContact O-N 2.89Å; F7-T10 PolarHBondContact O-OG1 2.82Å; F8-T10 VanDerWaalsContact C-N 3.33Å; F8-T10 PolarHBondContact O-N 2.95Å; T10-L13 PolarHBondContact O-N 2.9Å; T10-T14 WeakPolarHBondContact O-CG2 3.37Å; T10-T14 PolarHBondContact O-N 3.42Å; T10-T14 PolarHBondContact O-OG1 3.11Å
11	I	84.7	Confident	71.8	Confident	65 Å²	65	110.1 Å²	110.1	33%	0.333	58%	0.576	S	S	.	*	H	α-helix	trans	-65.5	-44.4	177.4	-69.6	166	0	0	0	110.9	F7 F8 I9 L13 T14 I15	F7-I11 HydrophobicContact CD1-CD1 3.51Å; F7-I11 HydrophobicContact CD1-CG1 4.39Å; F7-I11 HydrophobicContact CE1-CD1 3.5Å; F7-I11 VanDerWaalsContact CE1-CD1 3.5Å; F7-I11 HydrophobicContact CE1-CG1 4.37Å; F7-I11 HydrophobicContact CG-CD1 4.47Å; F7-I11 HydrophobicContact CZ-CD1 4.42Å; F7-I11 WeakPolarHBondContact O-CG1 3.03Å; F7-I11 PolarHBondContact O-N 3.31Å; F8-I11 PolarHBondContact O-N 2.84Å; I9-I11 PolarHBondContact O-N 3.37Å; I11-L13 VanDerWaalsContact C-N 3.32Å; I11-L13 PolarHBondContact O-N 2.03Å; I11-T14 WeakPolarHBondContact CA-OG1 3.49Å; I11-T14 PolarHBondContact O-N 2.61Å; I11-T14 PolarHBondContact O-OG1 3.18Å; I11-I15 HydrophobicContact CG2-CD1 3.71Å; I11-I15 HydrophobicContact CG2-CG1 4.43Å; I11-I15 WeakPolarHBondContact O-CD1 3.26Å; I11-I15 VanDerWaalsContact O-CG1 3.22Å; I11-I15 WeakPolarHBondContact O-CG1 3.3Å; I11-I15 PolarHBondContact O-N 2.87Å
12	I	82.5	Confident	71.4	Confident	105 Å²	105	101.8 Å²	101.8	54%	0.538	55%	0.548	S	S	.	.	H	α-helix	trans	-63.7	-41.5	177.9	-66.2	-164.4	0	0	0	110.2	F8 I9 T14 I15 L16	F8-I12 WeakPolarHBondContact O-CG1 3.49Å; F8-I12 PolarHBondContact O-N 3.09Å; I9-I12 PolarHBondContact O-N 3.08Å; I12-T14 PolarHBondContact O-N 3.22Å; I12-I15 PolarHBondContact O-N 2.97Å; I12-L16 HydrophobicContact CG2-CD1 3.89Å; I12-L16 HydrophobicContact CG2-CG 4.3Å; I12-L16 WeakPolarHBondContact O-CB 3.49Å; I12-L16 VanDerWaalsContact O-CG 3.23Å; I12-L16 WeakPolarHBondContact O-CG 3.45Å; I12-L16 PolarHBondContact O-N 3.21Å
13	L	81.6	Confident	71.2	Confident	101 Å²	101	104.7 Å²	104.7	53%	0.529	55%	0.554	S	S	.	*	H	α-helix	trans	-62.7	-42.3	177.2	-174	63.5	0	0	0	112.6	I9 T10 I11 L16 L17	I9-L13 WeakPolarHBondContact O-CB 3.35Å; I9-L13 PolarHBondContact O-N 3.01Å; T10-L13 PolarHBondContact O-N 2.9Å; I11-L13 VanDerWaalsContact C-N 3.32Å; I11-L13 PolarHBondContact O-N 2.03Å; L13-L16 PolarHBondContact O-N 3.47Å; L13-L17 HydrophobicContact CG-CD1 4.38Å; L13-L17 WeakPolarHBondContact O-CG 3.48Å; L13-L17 PolarHBondContact O-N 3.08Å
14	T	76.8	Confident	71.4	Confident	74 Å²	74	97.2 Å²	97.2	45%	0.454	53%	0.532	S	S	.	.	H	α-helix	trans	-64.2	-43.1	176.4	49.5	0	0	0	0	111.8	T10 I11 I12 L16 L17 E18	T10-T14 WeakPolarHBondContact O-CG2 3.37Å; T10-T14 PolarHBondContact O-N 3.42Å; T10-T14 PolarHBondContact O-OG1 3.11Å; I11-T14 WeakPolarHBondContact CA-OG1 3.49Å; I11-T14 PolarHBondContact O-N 2.61Å; I11-T14 PolarHBondContact O-OG1 3.18Å; I12-T14 PolarHBondContact O-N 3.22Å; T14-L16 VanDerWaalsContact C-N 3.3Å; T14-L16 PolarHBondContact O-N 3.31Å; T14-L17 PolarHBondContact O-N 3.11Å; T14-E18 WeakPolarHBondContact O-CG 3.45Å; T14-E18 PolarHBondContact O-N 3.08Å
15	I	73.6	Confident	72.3	Confident	80 Å²	80	97.6 Å²	97.6	41%	0.41	53%	0.531	S	S	.	.	H	α-helix	trans	-60.6	-41.9	175.9	-67.2	167.3	0	0	0	110.2	I11 I12 L17 E18 N19	I11-I15 HydrophobicContact CG2-CD1 3.71Å; I11-I15 HydrophobicContact CG2-CG1 4.43Å; I11-I15 WeakPolarHBondContact O-CD1 3.26Å; I11-I15 VanDerWaalsContact O-CG1 3.22Å; I11-I15 WeakPolarHBondContact O-CG1 3.3Å; I11-I15 PolarHBondContact O-N 2.87Å; I12-I15 PolarHBondContact O-N 2.97Å; I15-L17 PolarHBondContact O-N 3.32Å; I15-E18 PolarHBondContact O-N 2.77Å; I15-N19 VanDerWaalsContact CG2-ND2 3.34Å; I15-N19 WeakPolarHBondContact CG2-ND2 3.5Å; I15-N19 WeakPolarHBondContact O-CB 3.02Å; I15-N19 PolarHBondContact O-N 2.95Å; I15-N19 PolarHBondContact O-ND2 3.19Å
16	L	70.3	Confident	72.7	Confident	101 Å²	101	96.3 Å²	96.3	53%	0.529	52%	0.515	S	S	.	.	H	α-helix	trans	-66.7	-35.3	178	-70.5	170.9	0	0	0	113	I12 L13 T14 N19 S20	I12-L16 HydrophobicContact CG2-CD1 3.89Å; I12-L16 HydrophobicContact CG2-CG 4.3Å; I12-L16 WeakPolarHBondContact O-CB 3.49Å; I12-L16 VanDerWaalsContact O-CG 3.23Å; I12-L16 WeakPolarHBondContact O-CG 3.45Å; I12-L16 PolarHBondContact O-N 3.21Å; L13-L16 PolarHBondContact O-N 3.47Å; T14-L16 VanDerWaalsContact C-N 3.3Å; T14-L16 PolarHBondContact O-N 3.31Å; L16-N19 PolarHBondContact O-N 3.06Å; L16-S20 PolarHBondContact O-N 3.15Å; L16-S20 PolarHBondContact O-OG 3.13Å
17	L	65.7	Low	73.3	Confident	119 Å²	119	94.5 Å²	94.5	62%	0.623	51%	0.509	S	S	*	.	H	α-helix	trans	-68.1	-42.7	175.5	-73.1	171.2	0	0	0	111.7	L13 T14 I15 N19 S20	L13-L17 HydrophobicContact CG-CD1 4.38Å; L13-L17 WeakPolarHBondContact O-CG 3.48Å; L13-L17 PolarHBondContact O-N 3.08Å; T14-L17 PolarHBondContact O-N 3.11Å; I15-L17 PolarHBondContact O-N 3.32Å; L17-N19 VanDerWaalsContact C-N 3.32Å; L17-N19 PolarHBondContact O-N 2.95Å; L17-S20 PolarHBondContact O-N 3.39Å
18	E	61.1	Low	73.8	Confident	146 Å²	146	92.7 Å²	92.7	68%	0.682	51%	0.505	S	S	*	.	H	α-helix	trans	-66.4	-35.1	175.2	-69.1	179.9	150.7	0	0	112	T14 I15 S20	T14-E18 WeakPolarHBondContact O-CG 3.45Å; T14-E18 PolarHBondContact O-N 3.08Å; I15-E18 PolarHBondContact O-N 2.77Å; E18-S20 VanDerWaalsContact C-N 3.31Å; E18-S20 PolarHBondContact O-N 2.86Å
19	N	54.9	Low	74.3	Confident	123 Å²	123	88.3 Å²	88.3	66%	0.658	50%	0.498	S	S	*	.	H	α-helix	trans	-78.6	-9.7	176.3	-77.1	-71.5	0	0	0	114	I15 L16 L17 H21	I15-N19 VanDerWaalsContact CG2-ND2 3.34Å; I15-N19 WeakPolarHBondContact CG2-ND2 3.5Å; I15-N19 WeakPolarHBondContact O-CB 3.02Å; I15-N19 PolarHBondContact O-N 2.95Å; I15-N19 PolarHBondContact O-ND2 3.19Å; L16-N19 PolarHBondContact O-N 3.06Å; L17-N19 VanDerWaalsContact C-N 3.32Å; L17-N19 PolarHBondContact O-N 2.95Å; N19-H21 PolarHBondContact O-N 3.17Å
20	S	53	Low	74.6	Confident	84 Å²	84	86.7 Å²	86.7	59%	0.587	49%	0.488	S	S	*	.			trans	-73.4	28.1	168	-74.4	0	0	0	0	113.1	L16 L17 E18 G22	L16-S20 PolarHBondContact O-N 3.15Å; L16-S20 PolarHBondContact O-OG 3.13Å; L17-S20 PolarHBondContact O-N 3.39Å; E18-S20 VanDerWaalsContact C-N 3.31Å; E18-S20 PolarHBondContact O-N 2.86Å; S20-G22 PolarHBondContact O-N 2.02Å
21	H	53.4	Low	74.9	Confident	98 Å²	98	91.6 Å²	91.6	45%	0.454	50%	0.504	S	S	.	.	T	Hydrogen-bonded Turn	trans	-71.3	40.6	174.4	-152.3	177.3	0	0	0	112.8	N19 R26	N19-H21 PolarHBondContact O-N 3.17Å; H21-R26 PolarHBondContact CD2-NH1 2.87Å; H21-R26 VanDerWaalsContact CD2-NH1 3.3Å; H21-R26 PolarHBondContact NE2-NH1 3.29Å; H21-R26 PolarHBondContact O-NH1 3.49Å; H21-R26 PolarHBondContact O-NH2 2.03Å; H21-R26 VanDerWaalsContact O-NH2 3.11Å
22	G	53.6	Low	75.2	Confident	50 Å²	50	88.8 Å²	88.8	52%	0.515	49%	0.49	S	S	.	.	T	Hydrogen-bonded Turn	trans	-116.6	11.8	176	0	0	0	0	0	113.8	S20	S20-G22 PolarHBondContact O-N 2.02Å
23	K	59.4	Low	75.3	Confident	207 Å²	207	84.6 Å²	84.6	90%	0.9	47%	0.47	S	S	*	.	S	Bend	trans	-125.3	-8.2	175.4	-66.9	-176.2	-178.4	178.3	0	114.5
24	G	75.5	Confident	75	Confident	36 Å²	36	83.9 Å²	83.9	37%	0.371	46%	0.463	S	S	.	.	S	Bend	trans	-92	151.6	179.1	0	0	0	0	0	112
25	C	85.9	Confident	75	Confident	62 Å²	62	82.6 Å²	82.6	42%	0.419	46%	0.455	S	S	.	.	P	Polyproline II helix	trans	-73.4	157.4	164.1	60.6	0	0	0	0	110.2	R39 C41	C25-R39 CarbonylContact C-O 3.47Å; C25-R39 WeakPolarHBondContact CA-O 3.46Å; C25-C41 HydrophobicContact CB-CB 3.83Å; C25-C41 WeakPolarHBondContact CB-SG 3.33Å; C25-C41 PolarHBondContact O-SG 3.11Å; C25-C41 WeakPolarHBondContact SG-CA 3.36Å; C25-C41 WeakPolarHBondContact SG-CB 3.02Å; C25-C41 CovalentContact SG-SG 2.03Å; C25-C41 PolarHBondContact SG-SG 3.31Å
26	R	87.4	Confident	74.8	Confident	38 Å²	38	83.7 Å²	83.7	14%	0.143	47%	0.465	C	S	.	.	B	Isolated β-bridge	trans	-88.1	127	179.1	-56.7	-63.6	178.3	-155.4	-3.3	110	H21 E30 K31 C32 D38 R39 C40 C41 C56	H21-R26 PolarHBondContact CD2-NH1 2.87Å; H21-R26 VanDerWaalsContact CD2-NH1 3.3Å; H21-R26 PolarHBondContact NE2-NH1 3.29Å; H21-R26 PolarHBondContact O-NH1 3.49Å; H21-R26 PolarHBondContact O-NH2 2.03Å; H21-R26 VanDerWaalsContact O-NH2 3.11Å; R26-E30 VanDerWaalsContact CA-OE2 3.3Å; R26-E30 WeakPolarHBondContact CA-OE2 3.17Å; R26-E30 HydrophobicContact CB-CB 4.13Å; R26-K31 WeakPolarHBondContact CD-O 3.25Å; R26-K31 WeakPolarHBondContact CG-O 3.4Å; R26-C32 HydrophobicContact CG-CB 4.49Å; R26-D38 IonicContact CZ-OD1 3.32Å; R26-D38 IonicContact NE-OD1 3.09Å; R26-D38 PolarHBondContact NE-OD1 2.03Å; R26-D38 VanDerWaalsContact NE-OD1 3.09Å; R26-D38 IonicContact NH2-OD1 2.72Å; R26-D38 PolarHBondContact NH2-OD1 2.88Å; R26-R39 PolarHBondContact N-O 3.5Å; R26-C40 CarbonylContact O-C 3.6Å; R26-C40 WeakPolarHBondContact O-CA 3.42Å; R26-C41 PolarHBondContact O-N 3.43Å; R26-C56 WeakPolarHBondContact CB-SG 3.28Å
27	A	89.6	Confident	74.8	Confident	45 Å²	45	86.6 Å²	86.6	37%	0.372	47%	0.474	S	S	.	.	P	Polyproline II helix	trans	-67.2	165	178.2	0	0	0	0	0	111.7	G29 E30 C56	A27-G29 PolarHBondContact O-N 2.82Å; A27-E30 HydrophobicContact CB-CG 3.95Å; A27-E30 PolarHBondContact N-OE2 2.56Å; A27-E30 VanDerWaalsContact O-CB 3.3Å; A27-E30 WeakPolarHBondContact O-CB 3.43Å; A27-E30 PolarHBondContact O-N 2.93Å; A27-C56 WeakPolarHBondContact O-CB 3.41Å
28	L	91.9	Very high	75.3	Confident	99 Å²	99	82.6 Å²	82.6	52%	0.518	45%	0.453	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57	127.3	178	-174.4	71.7	0	0	0	110.5	E30 T44 K58	L28-E30 VanDerWaalsContact C-N 3.31Å; L28-T44 HydrophobicContact CD1-CG2 4.01Å; L28-K58 HydrophobicContact CD1-CG 3.95Å; L28-K58 HydrophobicContact CD2-CG 4.34Å
29	G	91	Very high	76.2	Confident	44 Å²	44	83.6 Å²	83.6	45%	0.454	45%	0.45	S	S	.	.	T	Hydrogen-bonded Turn	trans	87.5	-14.3	-177.1	0	0	0	0	0	115.2	A27 C56	A27-G29 PolarHBondContact O-N 2.82Å; G29-C56 PolarHBondContact N-O 2.98Å
30	E	90.7	Very high	77.8	Confident	75 Å²	75	78.5 Å²	78.5	35%	0.35	43%	0.425	S	S	.	.			trans	-70.8	157.1	176.1	-66.4	-166.3	142.9	0	0	112.2	R26 A27 L28 K55 C56	R26-E30 VanDerWaalsContact CA-OE2 3.3Å; R26-E30 WeakPolarHBondContact CA-OE2 3.17Å; R26-E30 HydrophobicContact CB-CB 4.13Å; A27-E30 HydrophobicContact CB-CG 3.95Å; A27-E30 PolarHBondContact N-OE2 2.56Å; A27-E30 VanDerWaalsContact O-CB 3.3Å; A27-E30 WeakPolarHBondContact O-CB 3.43Å; A27-E30 PolarHBondContact O-N 2.93Å; L28-E30 VanDerWaalsContact C-N 3.31Å; E30-K55 CarbonylContact O-C 3.57Å; E30-K55 VanDerWaalsContact O-CA 3.24Å; E30-K55 WeakPolarHBondContact O-CA 3.43Å; E30-C56 PolarHBondContact O-N 3.2Å
31	K	90	Very high	79.5	Confident	171 Å²	171	76.5 Å²	76.5	74%	0.743	41%	0.41	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.7	139.8	178.5	-67.5	179.2	-179.5	174.9	0	110.6	R26 G54	R26-K31 WeakPolarHBondContact CD-O 3.25Å; R26-K31 WeakPolarHBondContact CG-O 3.4Å; K31-G54 WeakPolarHBondContact CA-O 3.27Å
32	C	90.5	Very high	81.1	Confident	6 Å²	6	75.3 Å²	75.3	4%	0.041	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.9	155.4	176.4	62.4	0	0	0	0	110.3	R26 C46 G54 K55	R26-C32 HydrophobicContact CG-CB 4.49Å; C32-C46 HydrophobicContact CB-CB 3.87Å; C32-C46 WeakPolarHBondContact CB-SG 3.39Å; C32-C46 WeakPolarHBondContact SG-CA 3.05Å; C32-C46 WeakPolarHBondContact SG-CB 2.98Å; C32-C46 CovalentContact SG-SG 2.02Å; C32-C46 PolarHBondContact SG-SG 2.03Å; C32-G54 PolarHBondContact N-O 3.01Å; C32-G54 CarbonylContact O-C 3.56Å; C32-G54 WeakPolarHBondContact O-CA 3.24Å; C32-G54 PolarHBondContact O-N 3.3Å; C32-G54 VanDerWaalsContact SG-C 3.53Å; C32-K55 PolarHBondContact SG-N 3.26Å
33	S	84.9	Confident	82.7	Confident	17 Å²	17	80.7 Å²	80.7	12%	0.119	44%	0.441	C	S	.	.			trans	-114.3	3.8	-178.4	66.4	0	0	0	0	114.1	T35 D38 F52	S33-T35 PolarHBondContact O-N 3.46Å; S33-T35 VanDerWaalsContact OG-CG2 3.28Å; S33-T35 WeakPolarHBondContact OG-CG2 3.23Å; S33-T35 PolarHBondContact OG-OG1 3.15Å; S33-D38 WeakPolarHBondContact CB-OD2 3.1Å; S33-D38 WeakPolarHBondContact OG-CB 3.33Å; S33-D38 PolarHBondContact OG-OD2 2.84Å; S33-F52 VanDerWaalsContact CA-O 3.27Å; S33-F52 WeakPolarHBondContact CA-O 3.47Å; S33-F52 WeakPolarHBondContact CB-O 2.74Å
34	K	75.7	Confident	84.2	Confident	86 Å²	86	72.3 Å²	72.3	37%	0.374	41%	0.408	S	S	.	.	S	Bend	trans	54.7	24.4	-172.4	-156.9	173.9	-178.6	170.4	0	113	C46 L48	K34-C46 HydrophobicContact CB-CB 4.35Å; K34-C46 PolarHBondContact N-SG 2.63Å; K34-L48 HydrophobicContact CB-CD1 3.87Å; K34-L48 HydrophobicContact CB-CD2 4.03Å; K34-L48 HydrophobicContact CB-CG 4.05Å; K34-L48 HydrophobicContact CD-CD1 3.55Å; K34-L48 HydrophobicContact CD-CG 4.09Å; K34-L48 HydrophobicContact CG-CD1 4.35Å
35	T	76.5	Confident	85	Confident	48 Å²	48	71.5 Å²	71.5	29%	0.294	40%	0.395	S	S	.	.	S	Bend	trans	-89.1	163.9	171.1	64.2	0	0	0	0	110.4	S33 F37 D38	S33-T35 PolarHBondContact O-N 3.46Å; S33-T35 VanDerWaalsContact OG-CG2 3.28Å; S33-T35 WeakPolarHBondContact OG-CG2 3.23Å; S33-T35 PolarHBondContact OG-OG1 3.15Å; T35-F37 PolarHBondContact O-N 2.74Å; T35-F37 VanDerWaalsContact O-N 3.15Å; T35-D38 PolarHBondContact O-N 2.97Å; T35-D38 VanDerWaalsContact O-N 3.13Å; T35-D38 PolarHBondContact OG1-N 3.44Å
36	V	70.8	Confident	85.2	Confident	102 Å²	102	69.3 Å²	69.3	62%	0.618	38%	0.381	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60	-25.1	177.5	-178.3	0	0	0	0	112.1	R39	V36-R39 PolarHBondContact O-NE 3.29Å; V36-R39 VanDerWaalsContact O-NE 3.08Å
37	F	69.8	Low	85.5	Confident	163 Å²	163	70.4 Å²	70.4	72%	0.715	39%	0.387	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.8	-19.1	-179.1	-53.4	-71.5	0	0	0	113.5	T35	T35-F37 PolarHBondContact O-N 2.74Å; T35-F37 VanDerWaalsContact O-N 3.15Å
38	D	75	Confident	85.5	Confident	35 Å²	35	71 Å²	71	19%	0.187	38%	0.384	C	S	.	.	S	Bend	trans	-119	68.3	-178	-74.7	-44.5	0	0	0	111.3	R26 S33 T35	R26-D38 IonicContact CZ-OD1 3.32Å; R26-D38 IonicContact NE-OD1 3.09Å; R26-D38 PolarHBondContact NE-OD1 2.03Å; R26-D38 VanDerWaalsContact NE-OD1 3.09Å; R26-D38 IonicContact NH2-OD1 2.72Å; R26-D38 PolarHBondContact NH2-OD1 2.88Å; S33-D38 WeakPolarHBondContact CB-OD2 3.1Å; S33-D38 WeakPolarHBondContact OG-CB 3.33Å; S33-D38 PolarHBondContact OG-OD2 2.84Å; T35-D38 PolarHBondContact O-N 2.97Å; T35-D38 VanDerWaalsContact O-N 3.13Å; T35-D38 PolarHBondContact OG1-N 3.44Å
39	R	81.2	Confident	85.2	Confident	166 Å²	166	71.1 Å²	71.1	63%	0.626	39%	0.393	S	S	*	.	P	Polyproline II helix	trans	-86	144.1	176.3	-55.7	-174.6	-164.7	-167.1	4.8	110.3	C25 R26 V36	C25-R39 CarbonylContact C-O 3.47Å; C25-R39 WeakPolarHBondContact CA-O 3.46Å; R26-R39 PolarHBondContact N-O 3.5Å; V36-R39 PolarHBondContact O-NE 3.29Å; V36-R39 VanDerWaalsContact O-NE 3.08Å
40	C	88.6	Confident	84.9	Confident	17 Å²	17	71.6 Å²	71.6	12%	0.115	39%	0.389	C	S	.	.	B	Isolated β-bridge	trans	-78.1	154.7	169.6	-56.6	0	0	0	0	110.8	R26 T44 C56	R26-C40 CarbonylContact O-C 3.6Å; R26-C40 WeakPolarHBondContact O-CA 3.42Å; C40-T44 WeakPolarHBondContact CB-OG1 3.03Å; C40-C56 VanDerWaalsContact CA-SG 3.55Å; C40-C56 HydrophobicContact CB-CB 3.64Å; C40-C56 WeakPolarHBondContact CB-SG 3.35Å; C40-C56 WeakPolarHBondContact SG-CA 3.33Å; C40-C56 WeakPolarHBondContact SG-CB 3.36Å; C40-C56 CovalentContact SG-SG 2.03Å; C40-C56 PolarHBondContact SG-SG 3.5Å
41	C	89	Confident	84.6	Confident	41 Å²	41	72.7 Å²	72.7	28%	0.277	40%	0.403	S	S	.	.	S	Bend	trans	-74.7	143.2	-178.4	-66	0	0	0	0	112.7	C25 R26 T44	C25-C41 HydrophobicContact CB-CB 3.83Å; C25-C41 WeakPolarHBondContact CB-SG 3.33Å; C25-C41 PolarHBondContact O-SG 3.11Å; C25-C41 WeakPolarHBondContact SG-CA 3.36Å; C25-C41 WeakPolarHBondContact SG-CB 3.02Å; C25-C41 CovalentContact SG-SG 2.03Å; C25-C41 PolarHBondContact SG-SG 3.31Å; R26-C41 PolarHBondContact O-N 3.43Å; C41-T44 PolarHBondContact N-OG1 2.72Å; C41-T44 WeakPolarHBondContact O-CB 3.36Å; C41-T44 PolarHBondContact O-N 2.95Å; C41-T44 PolarHBondContact O-OG1 3.09Å
42	G	87.1	Confident	84.3	Confident	74 Å²	74	71.6 Å²	71.6	76%	0.763	40%	0.399	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.9	-135.2	177.1	0	0	0	0	0	112.5	T44	G42-T44 VanDerWaalsContact C-N 3.28Å; G42-T44 PolarHBondContact O-N 2.84Å
43	D	86.7	Confident	84.2	Confident	162 Å²	162	77.2 Å²	77.2	87%	0.866	42%	0.424	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.8	11.4	-179.8	-60	-47.9	0	0	0	113.9
44	T	90.7	Very high	84.5	Confident	32 Å²	32	76.7 Å²	76.7	20%	0.196	42%	0.421	C	S	.	.			trans	-78.1	154.7	178.6	63.6	0	0	0	0	111.8	L28 C40 C41 G42 V57	L28-T44 HydrophobicContact CD1-CG2 4.01Å; C40-T44 WeakPolarHBondContact CB-OG1 3.03Å; C41-T44 PolarHBondContact N-OG1 2.72Å; C41-T44 WeakPolarHBondContact O-CB 3.36Å; C41-T44 PolarHBondContact O-N 2.95Å; C41-T44 PolarHBondContact O-OG1 3.09Å; G42-T44 VanDerWaalsContact C-N 3.28Å; G42-T44 PolarHBondContact O-N 2.84Å; T44-V57 CarbonylContact C-O 3.42Å; T44-V57 WeakPolarHBondContact CA-O 3.37Å; T44-V57 WeakPolarHBondContact CB-O 3.07Å
45	V	91.2	Very high	85.3	Confident	18 Å²	18	78.5 Å²	78.5	11%	0.109	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.6	144.1	-172.8	-65.4	0	0	0	0	111.3	H47 C56 V57 L60 N71	V45-H47 PolarHBondContact O-N 2.78Å; V45-C56 WeakPolarHBondContact O-CA 2.95Å; V45-V57 HydrophobicContact CG2-CG2 3.84Å; V45-V57 PolarHBondContact N-O 2.83Å; V45-V57 WeakPolarHBondContact O-CG2 3.2Å; V45-V57 PolarHBondContact O-N 3.42Å; V45-L60 HydrophobicContact CB-CD2 4.44Å; V45-L60 HydrophobicContact CB-CG 4.48Å; V45-L60 HydrophobicContact CG2-CD2 3.77Å; V45-L60 HydrophobicContact CG2-CG 3.78Å; V45-N71 HydrophobicContact CG1-CB 3.99Å
46	C	92	Very high	86.1	Confident	17 Å²	17	76.3 Å²	76.3	12%	0.115	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.5	109.2	177.5	-175	0	0	0	0	110.6	C32 K34	C32-C46 HydrophobicContact CB-CB 3.87Å; C32-C46 WeakPolarHBondContact CB-SG 3.39Å; C32-C46 WeakPolarHBondContact SG-CA 3.05Å; C32-C46 WeakPolarHBondContact SG-CB 2.98Å; C32-C46 CovalentContact SG-SG 2.02Å; C32-C46 PolarHBondContact SG-SG 2.03Å; K34-C46 HydrophobicContact CB-CB 4.35Å; K34-C46 PolarHBondContact N-SG 2.63Å
47	H	92.7	Very high	87.3	Confident	61 Å²	61	73.2 Å²	73.2	28%	0.282	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.2	105.8	171.5	-179.1	-167.5	0	0	0	109.5	V45 G54 K55 V57 L60 T64	V45-H47 PolarHBondContact O-N 2.78Å; H47-G54 CarbonylContact O-C 3.53Å; H47-G54 WeakPolarHBondContact O-CA 3.2Å; H47-K55 PolarHBondContact N-O 3.27Å; H47-K55 PolarHBondContact O-N 3.22Å; H47-V57 HydrophobicContact CB-CG1 4.11Å; H47-V57 HydrophobicContact CB-CG2 3.69Å; H47-L60 HydrophobicContact CB-CD2 3.85Å; H47-T64 VanDerWaalsContact CD2-CG2 3.43Å; H47-T64 WeakPolarHBondContact CD2-CG2 3.06Å
48	L	89.5	Confident	88.4	Confident	56 Å²	56	73.1 Å²	73.1	29%	0.293	40%	0.396	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.4	122.6	174.6	-68.7	172.1	0	0	0	110.5	K34 H53	K34-L48 HydrophobicContact CB-CD1 3.87Å; K34-L48 HydrophobicContact CB-CD2 4.03Å; K34-L48 HydrophobicContact CB-CG 4.05Å; K34-L48 HydrophobicContact CD-CD1 3.55Å; K34-L48 HydrophobicContact CD-CG 4.09Å; K34-L48 HydrophobicContact CG-CD1 4.35Å; L48-H53 CarbonylContact C-O 3.44Å; L48-H53 WeakPolarHBondContact CA-O 3.46Å
49	S	86.7	Confident	89.2	Confident	103 Å²	103	73.7 Å²	73.7	72%	0.72	40%	0.402	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.9	-25	167.8	48.1	0	0	0	0	112.1	H53	S49-H53 PolarHBondContact N-O 2.75Å; S49-H53 PolarHBondContact OG-O 3.06Å
50	S	84.4	Confident	89.8	Confident	53 Å²	53	65.9 Å²	65.9	37%	0.371	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154	171.1	174.3	62.1	0	0	0	0	109.6	F52 H53	S50-F52 PolarHBondContact O-N 2.91Å; S50-H53 PolarHBondContact N-O 3.34Å; S50-H53 VanDerWaalsContact N-O 3.11Å; S50-H53 PolarHBondContact O-N 3.48Å; S50-H53 VanDerWaalsContact O-N 3.08Å; S50-H53 WeakPolarHBondContact OG-CB 3.28Å
51	P	83.4	Confident	89.9	Confident	99 Å²	99	72.4 Å²	72.4	64%	0.643	40%	0.4	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53	125.3	178.7	-27.5	36.4	0	0	0	111.4	H53	P51-H53 PolarHBondContact O-CD2 3.31Å; P51-H53 PolarHBondContact O-N 3.25Å
52	F	83.8	Confident	90	Very high	147 Å²	147	75.8 Å²	75.8	65%	0.645	41%	0.411	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.6	5.9	-178.5	-47.1	-74.7	0	0	0	116.8	S33 S50	S33-F52 VanDerWaalsContact CA-O 3.27Å; S33-F52 WeakPolarHBondContact CA-O 3.47Å; S33-F52 WeakPolarHBondContact CB-O 2.74Å; S50-F52 PolarHBondContact O-N 2.91Å
53	H	87.8	Confident	90.1	Very high	125 Å²	125	74.6 Å²	74.6	58%	0.579	40%	0.399	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-125.2	119.9	175.3	-61	-88.5	0	0	0	111	L48 S49 S50 P51	L48-H53 CarbonylContact C-O 3.44Å; L48-H53 WeakPolarHBondContact CA-O 3.46Å; S49-H53 PolarHBondContact N-O 2.75Å; S49-H53 PolarHBondContact OG-O 3.06Å; S50-H53 PolarHBondContact N-O 3.34Å; S50-H53 VanDerWaalsContact N-O 3.11Å; S50-H53 PolarHBondContact O-N 3.48Å; S50-H53 VanDerWaalsContact O-N 3.08Å; S50-H53 WeakPolarHBondContact OG-CB 3.28Å; P51-H53 PolarHBondContact O-CD2 3.31Å; P51-H53 PolarHBondContact O-N 3.25Å
54	G	92.3	Very high	90.2	Very high	5 Å²	5	67.9 Å²	67.9	5%	0.052	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.3	-174.9	177.9	0	0	0	0	0	112.7	K31 C32 H47	K31-G54 WeakPolarHBondContact CA-O 3.27Å; C32-G54 PolarHBondContact N-O 3.01Å; C32-G54 CarbonylContact O-C 3.56Å; C32-G54 WeakPolarHBondContact O-CA 3.24Å; C32-G54 PolarHBondContact O-N 3.3Å; C32-G54 VanDerWaalsContact SG-C 3.53Å; H47-G54 CarbonylContact O-C 3.53Å; H47-G54 WeakPolarHBondContact O-CA 3.2Å
55	K	93.1	Very high	90.2	Very high	124 Å²	124	71.9 Å²	71.9	54%	0.539	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.3	149.1	172.6	-65.7	-176.7	-179.1	-178.5	0	111.2	E30 C32 H47 V57	E30-K55 CarbonylContact O-C 3.57Å; E30-K55 VanDerWaalsContact O-CA 3.24Å; E30-K55 WeakPolarHBondContact O-CA 3.43Å; C32-K55 PolarHBondContact SG-N 3.26Å; H47-K55 PolarHBondContact N-O 3.27Å; H47-K55 PolarHBondContact O-N 3.22Å; K55-V57 PolarHBondContact O-N 3.49Å
56	C	93.3	Very high	90.1	Very high	2 Å²	2	71.5 Å²	71.5	1%	0.014	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.8	123.9	172.5	-64.7	0	0	0	0	110.6	R26 A27 G29 E30 C40 V45	R26-C56 WeakPolarHBondContact CB-SG 3.28Å; A27-C56 WeakPolarHBondContact O-CB 3.41Å; G29-C56 PolarHBondContact N-O 2.98Å; E30-C56 PolarHBondContact O-N 3.2Å; C40-C56 VanDerWaalsContact CA-SG 3.55Å; C40-C56 HydrophobicContact CB-CB 3.64Å; C40-C56 WeakPolarHBondContact CB-SG 3.35Å; C40-C56 WeakPolarHBondContact SG-CA 3.33Å; C40-C56 WeakPolarHBondContact SG-CB 3.36Å; C40-C56 CovalentContact SG-SG 2.03Å; C40-C56 PolarHBondContact SG-SG 3.5Å; V45-C56 WeakPolarHBondContact O-CA 2.95Å
57	V	94.3	Very high	89.9	Confident	38 Å²	38	76.3 Å²	76.3	23%	0.23	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	161.3	179	-61.4	0	0	0	0	109.8	T44 V45 H47 K55 C59 L60	T44-V57 CarbonylContact C-O 3.42Å; T44-V57 WeakPolarHBondContact CA-O 3.37Å; T44-V57 WeakPolarHBondContact CB-O 3.07Å; V45-V57 HydrophobicContact CG2-CG2 3.84Å; V45-V57 PolarHBondContact N-O 2.83Å; V45-V57 WeakPolarHBondContact O-CG2 3.2Å; V45-V57 PolarHBondContact O-N 3.42Å; H47-V57 HydrophobicContact CB-CG1 4.11Å; H47-V57 HydrophobicContact CB-CG2 3.69Å; K55-V57 PolarHBondContact O-N 3.49Å; V57-C59 VanDerWaalsContact CG2-O 3.28Å; V57-C59 WeakPolarHBondContact CG2-O 3.45Å; V57-C59 PolarHBondContact O-N 3.49Å; V57-L60 HydrophobicContact CG2-CD2 4.31Å
58	K	93.1	Very high	89.7	Confident	161 Å²	161	75.6 Å²	75.6	70%	0.7	41%	0.412	S	S	*	.	S	Bend	trans	-63.5	-41.5	177.9	-66.8	-174.2	177.6	-176.8	0	112.4	L28	L28-K58 HydrophobicContact CD1-CG 3.95Å; L28-K58 HydrophobicContact CD2-CG 4.34Å
59	C	92.4	Very high	89.8	Confident	46 Å²	46	76.8 Å²	76.8	31%	0.311	42%	0.419	S	S	.	.	S	Bend	trans	-156.4	158	179.1	57.7	0	0	0	0	110.3	V57 C73	V57-C59 VanDerWaalsContact CG2-O 3.28Å; V57-C59 WeakPolarHBondContact CG2-O 3.45Å; V57-C59 PolarHBondContact O-N 3.49Å; C59-C73 HydrophobicContact CB-CB 3.87Å; C59-C73 WeakPolarHBondContact CB-SG 3.43Å; C59-C73 VanDerWaalsContact SG-CA 3.54Å; C59-C73 WeakPolarHBondContact SG-CB 3.23Å; C59-C73 CovalentContact SG-SG 2.03Å; C59-C73 PolarHBondContact SG-SG 2.98Å
60	L	92.8	Very high	89.9	Confident	3 Å²	3	79.4 Å²	79.4	2%	0.016	42%	0.417	C	S	.	.	B	Isolated β-bridge	trans	-82.4	135.6	178.7	-58.4	177.6	0	0	0	110.3	V45 H47 V57 T64 L65 C66 N71 C73 C82	V45-L60 HydrophobicContact CB-CD2 4.44Å; V45-L60 HydrophobicContact CB-CG 4.48Å; V45-L60 HydrophobicContact CG2-CD2 3.77Å; V45-L60 HydrophobicContact CG2-CG 3.78Å; H47-L60 HydrophobicContact CB-CD2 3.85Å; V57-L60 HydrophobicContact CG2-CD2 4.31Å; L60-T64 HydrophobicContact CB-CG2 4.13Å; L60-T64 HydrophobicContact CD1-CG2 4.26Å; L60-T64 HydrophobicContact CD2-CG2 3.89Å; L60-T64 HydrophobicContact CG-CG2 4.3Å; L60-L65 WeakPolarHBondContact CD1-O 3.33Å; L60-C66 HydrophobicContact CD1-CB 4.05Å; L60-N71 WeakPolarHBondContact CB-O 3.3Å; L60-N71 HydrophobicContact CD1-CB 3.88Å; L60-N71 HydrophobicContact CG-CB 4.35Å; L60-N71 WeakPolarHBondContact CG-O 3.3Å; L60-N71 PolarHBondContact N-O 3.46Å; L60-C73 PolarHBondContact O-N 3.41Å; L60-C73 PolarHBondContact O-SG 3.49Å; L60-C82 VanDerWaalsContact CB-SG 3.52Å
61	K	91	Very high	90.1	Very high	154 Å²	154	78.4 Å²	78.4	67%	0.67	41%	0.408	S	S	*	.	P	Polyproline II helix	trans	-74.7	165.4	175.9	-66.3	-174.7	178	-175.6	0	110.8	T64 C82	K61-T64 VanDerWaalsContact O-CB 3.25Å; K61-T64 WeakPolarHBondContact O-CB 3.44Å; K61-T64 PolarHBondContact O-N 2.99Å; K61-T64 PolarHBondContact O-OG1 2.96Å; K61-T64 VanDerWaalsContact O-OG1 3.11Å; K61-C82 VanDerWaalsContact O-CB 3.24Å; K61-C82 WeakPolarHBondContact O-CB 3.49Å
62	E	91.2	Very high	90.5	Very high	111 Å²	111	73.7 Å²	73.7	52%	0.519	38%	0.377	S	S	.	.	T	Hydrogen-bonded Turn	trans	-53.7	141.9	172.6	-62.8	167	-160.5	0	0	112	T64 C82 K84	E62-T64 PolarHBondContact O-N 3.44Å; E62-C82 WeakPolarHBondContact CA-O 3.39Å; E62-K84 HydrophobicContact CG-CG 4.05Å; E62-K84 WeakPolarHBondContact OE1-CE 3.02Å; E62-K84 WeakPolarHBondContact OE1-CG 2.96Å; E62-K84 WeakPolarHBondContact OE2-CE 3.49Å; E62-K84 VanDerWaalsContact OE2-CG 3.23Å; E62-K84 WeakPolarHBondContact OE2-CG 3.34Å; E62-K84 IonicContact OE2-NZ 3.32Å
63	G	88.9	Confident	90.9	Very high	50 Å²	50	69.6 Å²	69.6	52%	0.515	37%	0.366	S	S	.	.	T	Hydrogen-bonded Turn	trans	81.4	-14.1	-177.7	0	0	0	0	0	114.8	C82	G63-C82 PolarHBondContact N-O 2.97Å
64	T	89.7	Confident	91	Very high	21 Å²	21	64.5 Å²	64.5	13%	0.129	34%	0.344	C	S	.	.	S	Bend	trans	-74.8	144.8	178.4	-54.8	0	0	0	0	111.9	H47 L60 K61 E62 C66 K81 C82	H47-T64 VanDerWaalsContact CD2-CG2 3.43Å; H47-T64 WeakPolarHBondContact CD2-CG2 3.06Å; L60-T64 HydrophobicContact CB-CG2 4.13Å; L60-T64 HydrophobicContact CD1-CG2 4.26Å; L60-T64 HydrophobicContact CD2-CG2 3.89Å; L60-T64 HydrophobicContact CG-CG2 4.3Å; K61-T64 VanDerWaalsContact O-CB 3.25Å; K61-T64 WeakPolarHBondContact O-CB 3.44Å; K61-T64 PolarHBondContact O-N 2.99Å; K61-T64 PolarHBondContact O-OG1 2.96Å; K61-T64 VanDerWaalsContact O-OG1 3.11Å; E62-T64 PolarHBondContact O-N 3.44Å; T64-C66 PolarHBondContact O-N 2.94Å; T64-K81 CarbonylContact O-C 3.59Å; T64-K81 VanDerWaalsContact O-CA 3.32Å; T64-K81 WeakPolarHBondContact O-CA 3.49Å; T64-C82 PolarHBondContact O-N 2.76Å
65	L	90	Very high	91	Very high	115 Å²	115	70.6 Å²	70.6	60%	0.602	37%	0.371	S	S	*	.	B	Isolated β-bridge	trans	-65.2	123.2	177.1	-69	173.9	0	0	0	112.2	L60 G80 K81	L60-L65 WeakPolarHBondContact CD1-O 3.33Å; L65-G80 CarbonylContact C-O 3.57Å; L65-G80 VanDerWaalsContact CA-O 3.26Å; L65-G80 WeakPolarHBondContact CA-O 3.45Å; L65-G80 WeakPolarHBondContact CD2-O 3.22Å; L65-K81 HydrophobicContact CD2-CG 4.09Å
66	C	90	Very high	90.9	Very high	10 Å²	10	68.1 Å²	68.1	7%	0.068	36%	0.36	C	S	.	.			trans	-124.2	159.4	-178.6	59.7	0	0	0	0	111.4	L60 T64 C72 C77 G80 K81 C82	L60-C66 HydrophobicContact CD1-CB 4.05Å; T64-C66 PolarHBondContact O-N 2.94Å; C66-C72 VanDerWaalsContact CB-SG 3.55Å; C66-C77 HydrophobicContact CB-CB 3.86Å; C66-C77 WeakPolarHBondContact CB-SG 3.41Å; C66-C77 PolarHBondContact O-SG 3.39Å; C66-C77 WeakPolarHBondContact SG-CA 3.45Å; C66-C77 WeakPolarHBondContact SG-CB 3.27Å; C66-C77 CovalentContact SG-SG 2.01Å; C66-C77 PolarHBondContact SG-SG 3.23Å; C66-G80 PolarHBondContact N-O 3.18Å; C66-G80 VanDerWaalsContact SG-C 3.51Å; C66-K81 WeakPolarHBondContact SG-CA 3.24Å; C66-K81 PolarHBondContact SG-N 3.49Å; C66-K81 VanDerWaalsContact SG-N 3.4Å; C66-K81 PolarHBondContact SG-O 3.37Å; C66-C82 PolarHBondContact SG-N 2.99Å; C66-C82 VanDerWaalsContact SG-N 3.37Å
67	V	87.6	Confident	90.8	Very high	118 Å²	118	69.3 Å²	69.3	72%	0.715	37%	0.368	S	S	*	.	S	Bend	trans	-114.3	-27.1	176.1	178.9	0	0	0	0	110.8
68	S	88.8	Confident	90.7	Very high	46 Å²	46	71.6 Å²	71.6	32%	0.322	38%	0.379	S	S	.	.	S	Bend	trans	-146.2	148.5	-178.1	179.7	0	0	0	0	109.3	K70 N71	S68-K70 VanDerWaalsContact C-N 3.27Å; S68-K70 PolarHBondContact O-N 3.49Å; S68-N71 WeakPolarHBondContact O-CB 3Å; S68-N71 PolarHBondContact O-N 3.3Å; S68-N71 VanDerWaalsContact O-N 3.09Å
69	D	90.5	Very high	90.6	Very high	82 Å²	82	71.6 Å²	71.6	44%	0.439	39%	0.386	S	S	.	.	G	3₁₀ helix	trans	-51.5	-43.3	178.7	-67.3	-45.3	0	0	0	112.8	N71 C72 H75 K76 C77	D69-N71 PolarHBondContact O-N 2.97Å; D69-C72 WeakPolarHBondContact O-CB 3.34Å; D69-C72 PolarHBondContact O-N 3.37Å; D69-H75 WeakPolarHBondContact CB-O 3.34Å; D69-H75 CarbonylContact O-C 3.58Å; D69-H75 VanDerWaalsContact O-CA 3.3Å; D69-H75 WeakPolarHBondContact O-CA 3.49Å; D69-K76 WeakPolarHBondContact OD1-CA 3.43Å; D69-C77 WeakPolarHBondContact OD1-CA 3.02Å; D69-C77 WeakPolarHBondContact OD1-CB 3.49Å; D69-C77 PolarHBondContact OD1-N 2.83Å
70	K	88.7	Confident	90.5	Very high	158 Å²	158	71 Å²	71	69%	0.687	39%	0.386	S	S	*	.	G	3₁₀ helix	trans	-58.9	-19.9	-179.6	72.1	-178.8	-178	171.4	0	114.5	S68 C72	S68-K70 VanDerWaalsContact C-N 3.27Å; S68-K70 PolarHBondContact O-N 3.49Å; K70-C72 VanDerWaalsContact C-N 3.33Å
71	N	88.5	Confident	90.5	Very high	31 Å²	31	76 Å²	76	17%	0.166	41%	0.408	C	S	.	.	G	3₁₀ helix	trans	-78.7	-23	179.7	-60.2	-17.2	0	0	0	111.6	V45 L60 S68 D69	V45-N71 HydrophobicContact CG1-CB 3.99Å; L60-N71 WeakPolarHBondContact CB-O 3.3Å; L60-N71 HydrophobicContact CD1-CB 3.88Å; L60-N71 HydrophobicContact CG-CB 4.35Å; L60-N71 WeakPolarHBondContact CG-O 3.3Å; L60-N71 PolarHBondContact N-O 3.46Å; S68-N71 WeakPolarHBondContact O-CB 3Å; S68-N71 PolarHBondContact O-N 3.3Å; S68-N71 VanDerWaalsContact O-N 3.09Å; D69-N71 PolarHBondContact O-N 2.97Å
72	C	91.8	Very high	90.6	Very high	1 Å²	1	68.8 Å²	68.8	1%	0.007	38%	0.377	C	S	.	.	B	Isolated β-bridge	trans	-87.7	141.5	-177.3	-61.1	0	0	0	0	110.7	C66 D69 K70 S74 H75 K76 C82	C66-C72 VanDerWaalsContact CB-SG 3.55Å; D69-C72 WeakPolarHBondContact O-CB 3.34Å; D69-C72 PolarHBondContact O-N 3.37Å; K70-C72 VanDerWaalsContact C-N 3.33Å; C72-S74 PolarHBondContact O-N 3.35Å; C72-H75 PolarHBondContact O-N 3.31Å; C72-K76 PolarHBondContact SG-O 3.02Å; C72-C82 WeakPolarHBondContact CA-SG 3.34Å; C72-C82 HydrophobicContact CB-CB 3.69Å; C72-C82 WeakPolarHBondContact CB-SG 3.05Å; C72-C82 WeakPolarHBondContact SG-CA 3.47Å; C72-C82 WeakPolarHBondContact SG-CB 3.36Å; C72-C82 CovalentContact SG-SG 2.03Å; C72-C82 PolarHBondContact SG-SG 3.4Å
73	C	92.2	Very high	90.6	Very high	61 Å²	61	65.4 Å²	65.4	41%	0.412	36%	0.364	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.1	-25.1	174.6	-54.1	0	0	0	0	112.5	C59 L60 H75	C59-C73 HydrophobicContact CB-CB 3.87Å; C59-C73 WeakPolarHBondContact CB-SG 3.43Å; C59-C73 VanDerWaalsContact SG-CA 3.54Å; C59-C73 WeakPolarHBondContact SG-CB 3.23Å; C59-C73 CovalentContact SG-SG 2.03Å; C59-C73 PolarHBondContact SG-SG 2.98Å; L60-C73 PolarHBondContact O-N 3.41Å; L60-C73 PolarHBondContact O-SG 3.49Å; C73-H75 VanDerWaalsContact C-N 3.33Å
74	S	91.1	Very high	90.4	Very high	17 Å²	17	69.5 Å²	69.5	12%	0.119	37%	0.368	C	S	.	.	T	Hydrogen-bonded Turn	trans	-87.4	2.4	175.2	56.1	0	0	0	0	114.1	C72 K76 T83	C72-S74 PolarHBondContact O-N 3.35Å; S74-K76 PolarHBondContact O-N 3.45Å; S74-K76 VanDerWaalsContact O-N 3.08Å; S74-T83 WeakPolarHBondContact CB-O 3.48Å; S74-T83 PolarHBondContact OG-O 2.75Å
75	H	91.5	Very high	89.3	Confident	134 Å²	134	73.6 Å²	73.6	62%	0.62	39%	0.386	S	S	*	.	S	Bend	trans	51.6	31.6	-172.7	-63.3	-86.3	0	0	0	113.9	D69 C72 C73	D69-H75 WeakPolarHBondContact CB-O 3.34Å; D69-H75 CarbonylContact O-C 3.58Å; D69-H75 VanDerWaalsContact O-CA 3.3Å; D69-H75 WeakPolarHBondContact O-CA 3.49Å; C72-H75 PolarHBondContact O-N 3.31Å; C73-H75 VanDerWaalsContact C-N 3.33Å
76	K	91.8	Very high	87.8	Confident	71 Å²	71	75.6 Å²	75.6	31%	0.309	39%	0.389	S	S	.	.			trans	-142.8	110.5	-176.1	-164.8	172.9	-176.8	165.4	0	112.8	D69 C72 S74 C82 T83	D69-K76 WeakPolarHBondContact OD1-CA 3.43Å; C72-K76 PolarHBondContact SG-O 3.02Å; S74-K76 PolarHBondContact O-N 3.45Å; S74-K76 VanDerWaalsContact O-N 3.08Å; K76-C82 WeakPolarHBondContact O-CA 3.43Å; K76-T83 WeakPolarHBondContact CD-OG1 3.47Å; K76-T83 VanDerWaalsContact CG-OG1 3.31Å; K76-T83 WeakPolarHBondContact CG-OG1 3.35Å; K76-T83 PolarHBondContact O-N 3.26Å
77	C	91.7	Very high	86	Confident	27 Å²	27	82 Å²	82	18%	0.182	42%	0.418	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.6	98.6	177.7	-175.3	0	0	0	0	109.7	C66 D69 K81	C66-C77 HydrophobicContact CB-CB 3.86Å; C66-C77 WeakPolarHBondContact CB-SG 3.41Å; C66-C77 PolarHBondContact O-SG 3.39Å; C66-C77 WeakPolarHBondContact SG-CA 3.45Å; C66-C77 WeakPolarHBondContact SG-CB 3.27Å; C66-C77 CovalentContact SG-SG 2.01Å; C66-C77 PolarHBondContact SG-SG 3.23Å; D69-C77 WeakPolarHBondContact OD1-CA 3.02Å; D69-C77 WeakPolarHBondContact OD1-CB 3.49Å; D69-C77 PolarHBondContact OD1-N 2.83Å; C77-K81 CarbonylContact C-O 3.58Å
78	N	92.4	Very high	84.2	Confident	86 Å²	86	84.9 Å²	84.9	46%	0.46	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.7	132.5	-178.2	-169	17.5	0	0	0	110.6	G80 K81 T83	N78-G80 PolarHBondContact O-N 3.31Å; N78-K81 PolarHBondContact N-O 3.28Å; N78-K81 PolarHBondContact O-N 3.27Å; N78-T83 HydrophobicContact CB-CG2 3.79Å
79	I	90.7	Very high	81.7	Confident	162 Å²	162	96.8 Å²	96.8	83%	0.831	46%	0.463	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.9	40.6	-176.9	-45.5	175.5	0	0	0	111	K81	I79-K81 PolarHBondContact O-N 3.17Å
80	G	90.6	Very high	81.2	Confident	32 Å²	32	97.6 Å²	97.6	33%	0.33	47%	0.465	S	S	.	.	T	Hydrogen-bonded Turn	trans	69	13.2	-179.3	0	0	0	0	0	115.4	L65 C66 N78	L65-G80 CarbonylContact C-O 3.57Å; L65-G80 VanDerWaalsContact CA-O 3.26Å; L65-G80 WeakPolarHBondContact CA-O 3.45Å; L65-G80 WeakPolarHBondContact CD2-O 3.22Å; C66-G80 PolarHBondContact N-O 3.18Å; C66-G80 VanDerWaalsContact SG-C 3.51Å; N78-G80 PolarHBondContact O-N 3.31Å
81	K	91.7	Very high	80.8	Confident	109 Å²	109	94.4 Å²	94.4	47%	0.474	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	146	176.1	-69.7	-178.7	-179.5	179.1	0	112.3	T64 L65 C66 C77 N78 I79 T83	T64-K81 CarbonylContact O-C 3.59Å; T64-K81 VanDerWaalsContact O-CA 3.32Å; T64-K81 WeakPolarHBondContact O-CA 3.49Å; L65-K81 HydrophobicContact CD2-CG 4.09Å; C66-K81 WeakPolarHBondContact SG-CA 3.24Å; C66-K81 PolarHBondContact SG-N 3.49Å; C66-K81 VanDerWaalsContact SG-N 3.4Å; C66-K81 PolarHBondContact SG-O 3.37Å; C77-K81 CarbonylContact C-O 3.58Å; N78-K81 PolarHBondContact N-O 3.28Å; N78-K81 PolarHBondContact O-N 3.27Å; I79-K81 PolarHBondContact O-N 3.17Å; K81-T83 PolarHBondContact O-N 3.03Å
82	C	92.9	Very high	80.4	Confident	3 Å²	3	97.9 Å²	97.9	2%	0.02	47%	0.469	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.4	126.8	171.7	-64.5	0	0	0	0	109.7	L60 K61 E62 G63 T64 C66 C72 K76	L60-C82 VanDerWaalsContact CB-SG 3.52Å; K61-C82 VanDerWaalsContact O-CB 3.24Å; K61-C82 WeakPolarHBondContact O-CB 3.49Å; E62-C82 WeakPolarHBondContact CA-O 3.39Å; G63-C82 PolarHBondContact N-O 2.97Å; T64-C82 PolarHBondContact O-N 2.76Å; C66-C82 PolarHBondContact SG-N 2.99Å; C66-C82 VanDerWaalsContact SG-N 3.37Å; C72-C82 WeakPolarHBondContact CA-SG 3.34Å; C72-C82 HydrophobicContact CB-CB 3.69Å; C72-C82 WeakPolarHBondContact CB-SG 3.05Å; C72-C82 WeakPolarHBondContact SG-CA 3.47Å; C72-C82 WeakPolarHBondContact SG-CB 3.36Å; C72-C82 CovalentContact SG-SG 2.03Å; C72-C82 PolarHBondContact SG-SG 3.4Å; K76-C82 WeakPolarHBondContact O-CA 3.43Å
83	T	91.2	Very high	79.7	Confident	40 Å²	40	103.6 Å²	103.6	25%	0.245	50%	0.496	C	S	.	.			trans	-114	154.5	176.9	57.2	0	0	0	0	110.4	S74 K76 N78 K81 E85	S74-T83 WeakPolarHBondContact CB-O 3.48Å; S74-T83 PolarHBondContact OG-O 2.75Å; K76-T83 WeakPolarHBondContact CD-OG1 3.47Å; K76-T83 VanDerWaalsContact CG-OG1 3.31Å; K76-T83 WeakPolarHBondContact CG-OG1 3.35Å; K76-T83 PolarHBondContact O-N 3.26Å; N78-T83 HydrophobicContact CB-CG2 3.79Å; K81-T83 PolarHBondContact O-N 3.03Å; T83-E85 PolarHBondContact O-N 3.3Å
84	K	84.3	Confident	79	Confident	136 Å²	136	106.3 Å²	106.3	59%	0.591	50%	0.501	S	S	*	.			trans	-49.3	138.7	168.2	-77.2	-176.5	-179.4	-170.4	0	110.2	E62 K86	E62-K84 HydrophobicContact CG-CG 4.05Å; E62-K84 WeakPolarHBondContact OE1-CE 3.02Å; E62-K84 WeakPolarHBondContact OE1-CG 2.96Å; E62-K84 WeakPolarHBondContact OE2-CE 3.49Å; E62-K84 VanDerWaalsContact OE2-CG 3.23Å; E62-K84 WeakPolarHBondContact OE2-CG 3.34Å; E62-K84 IonicContact OE2-NZ 3.32Å; K84-K86 PolarHBondContact O-N 3.32Å; K84-K86 VanDerWaalsContact O-N 3.1Å
85	E	67.7	Low	78.1	Confident	107 Å²	107	112.2 Å²	112.2	50%	0.5	53%	0.527	S	S	.	.			trans	-58.6	119.1	162	-161.1	176	175.4	0	0	105.8	T83 H87	T83-E85 PolarHBondContact O-N 3.3Å; E85-H87 PolarHBondContact O-N 3.32Å; E85-H87 IonicContact OE1-CE1 3.91Å; E85-H87 IonicContact OE2-CE1 3.94Å; E85-H87 PolarHBondContact OE2-CE1 3.36Å; E85-H87 VanDerWaalsContact OE2-CE1 3.32Å; E85-H87 IonicContact OE2-NE2 3.63Å
86	K	57.5	Low	77.2	Confident	156 Å²	156	110.6 Å²	110.6	68%	0.678	52%	0.52	S	S	*	.			trans	-73.9	85.6	170.1	-74.1	-167	178.2	-174.7	0	104.7	K84 H88	K84-K86 PolarHBondContact O-N 3.32Å; K84-K86 VanDerWaalsContact O-N 3.1Å; K86-H88 PolarHBondContact O-N 3.11Å
87	H	53.3	Low	76.1	Confident	146 Å²	146	113.7 Å²	113.7	68%	0.676	54%	0.536	S	S	*	.			trans	-59.2	108.6	161.7	-66.5	-67.6	0	0	0	105.9	E85 Y89	E85-H87 PolarHBondContact O-N 3.32Å; E85-H87 IonicContact OE1-CE1 3.91Å; E85-H87 IonicContact OE2-CE1 3.94Å; E85-H87 PolarHBondContact OE2-CE1 3.36Å; E85-H87 VanDerWaalsContact OE2-CE1 3.32Å; E85-H87 IonicContact OE2-NE2 3.63Å; H87-Y89 PolarHBondContact O-N 3.39Å
88	H	49.7	Very low	74.8	Confident	177 Å²	177	120.9 Å²	120.9	82%	0.819	57%	0.566	S	S	*	*			trans	-69.4	105.7	166.7	-79.7	-97.5	0	0	0	106.3	K86	K86-H88 PolarHBondContact O-N 3.11Å
89	Y	35.3	Very low	73.2	Confident	297 Å²	297	124.1 Å²	124.1	100%	1.165	58%	0.575	S	S	*	*			trans	44.3	0	165.9	-166	-98.8	0	0	0	117.8	H87	H87-Y89 PolarHBondContact O-N 3.39Å

Retrieved 89 of 89 residues in 27.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).