A0A5K4F7H8_SCHMA Loading...

U6 snRNA-associated Sm-like protein LSm6

Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA. Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner, facilitating the efficient association of RNA processing factors with their substrates. Component of the cytoplasmic LSM1-LSM7 complex, which is thought to be involved in mRNA degradation by activating the decapping step in the 5'-to-3' mRNA decay pathway.

AlphaFold DB , UniProt , Accession A0A5K4F7H8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 78 aa.

						>A0A5K4F7H8_SCHMA|A0A5K4F7H8
MAHKQTPRDFLKLIVGRPVVVKLNSGADYRGVLISLDGYMNVVLEQTEEYIDGQLKNKYGDTFIRGNNVFYISTQKRW
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.2	Low	77.8	Confident	241 Å²	241	124.7 Å²	124.7	100%	1.187	63%	0.63	S	S	*	*				0	120.6	0	-63.7	174.9	-168.4	0	0	107	H3	M1-H3 PolarHBondContact O-N 3.26Å; M1-H3 VanDerWaalsContact O-N 3.16Å
2	A	65.3	Low	78.6	Confident	102 Å²	102	125.8 Å²	125.8	84%	0.843	63%	0.627	S	S	*	*			trans	-60.8	120.4	176.4	0	0	0	0	0	108.2	K4	A2-K4 PolarHBondContact O-N 2.82Å
3	H	67.4	Low	79.4	Confident	162 Å²	162	123 Å²	123	75%	0.75	62%	0.615	S	S	*	*			trans	-59.9	109.8	175.3	-173.4	37	0	0	0	107.2	M1 Q5	M1-H3 PolarHBondContact O-N 3.26Å; M1-H3 VanDerWaalsContact O-N 3.16Å; H3-Q5 PolarHBondContact O-N 2.88Å
4	K	76.9	Confident	80.3	Confident	188 Å²	188	114.4 Å²	114.4	82%	0.817	57%	0.573	S	S	*	*			trans	-66.4	101.7	-177.3	-167.1	176.3	-175.7	179.4	0	107.1	A2 T6	A2-K4 PolarHBondContact O-N 2.82Å; K4-T6 PolarHBondContact O-N 2.93Å; K4-T6 VanDerWaalsContact O-N 3.13Å
5	Q	80.6	Confident	81.3	Confident	141 Å²	141	111.4 Å²	111.4	66%	0.659	56%	0.562	S	S	*	*			trans	-57.3	120.2	176.7	-73.5	-176.5	-35.7	0	0	108.3	H3	H3-Q5 PolarHBondContact O-N 2.88Å
6	T	86.8	Confident	82.2	Confident	64 Å²	64	107.7 Å²	107.7	39%	0.393	56%	0.561	S	S	.	*			trans	-80.5	158.8	174.3	70.6	0	0	0	0	109.4	K4 R8 D9 F10	K4-T6 PolarHBondContact O-N 2.93Å; K4-T6 VanDerWaalsContact O-N 3.13Å; T6-R8 PolarHBondContact O-N 3.38Å; T6-R8 PolarHBondContact OG1-N 2.86Å; T6-D9 WeakPolarHBondContact CB-OD2 3.44Å; T6-D9 WeakPolarHBondContact CG2-OD2 3.34Å; T6-D9 PolarHBondContact N-OD2 2.85Å; T6-D9 PolarHBondContact O-N 3.3Å; T6-D9 PolarHBondContact OG1-N 2.93Å; T6-D9 VanDerWaalsContact OG1-N 3.17Å; T6-D9 PolarHBondContact OG1-OD2 2.84Å; T6-F10 PolarHBondContact O-N 3.1Å; T6-F10 VanDerWaalsContact O-N 3.12Å
7	P	82.8	Confident	83	Confident	110 Å²	110	110 Å²	110	71%	0.714	56%	0.56	S	S	*	*	H	α-helix	trans	-52	-37.6	170.3	-28.3	36	0	0	0	112.1	D9 F10 L11	P7-D9 VanDerWaalsContact C-N 3.34Å; P7-D9 PolarHBondContact O-N 2.8Å; P7-F10 WeakPolarHBondContact O-CB 3.18Å; P7-F10 PolarHBondContact O-N 3.26Å; P7-L11 WeakPolarHBondContact O-CG 3.46Å; P7-L11 PolarHBondContact O-N 3.26Å
8	R	84.4	Confident	83.7	Confident	183 Å²	183	108.2 Å²	108.2	69%	0.691	56%	0.557	S	S	*	*	H	α-helix	trans	-64.2	-36.5	177.4	-169.2	177	-174.8	173.7	1.7	112.9	T6 L11 K12	T6-R8 PolarHBondContact O-N 3.38Å; T6-R8 PolarHBondContact OG1-N 2.86Å; R8-L11 PolarHBondContact O-N 2.85Å; R8-K12 WeakPolarHBondContact O-CG 3.44Å; R8-K12 PolarHBondContact O-N 2.7Å; R8-K12 VanDerWaalsContact O-N 3.17Å
9	D	88.5	Confident	84.4	Confident	41 Å²	41	102.5 Å²	102.5	22%	0.219	53%	0.528	C	S	.	.	H	α-helix	trans	-68.3	-39.5	175.8	-57.7	-44.8	0	0	0	110.7	T6 P7 L11 K12 L13	T6-D9 WeakPolarHBondContact CB-OD2 3.44Å; T6-D9 WeakPolarHBondContact CG2-OD2 3.34Å; T6-D9 PolarHBondContact N-OD2 2.85Å; T6-D9 PolarHBondContact O-N 3.3Å; T6-D9 PolarHBondContact OG1-N 2.93Å; T6-D9 VanDerWaalsContact OG1-N 3.17Å; T6-D9 PolarHBondContact OG1-OD2 2.84Å; P7-D9 VanDerWaalsContact C-N 3.34Å; P7-D9 PolarHBondContact O-N 2.8Å; D9-L11 VanDerWaalsContact C-N 3.34Å; D9-L11 PolarHBondContact O-N 2.94Å; D9-K12 PolarHBondContact O-N 2.91Å; D9-L13 WeakPolarHBondContact O-CG 3.15Å; D9-L13 PolarHBondContact O-N 2.87Å
10	F	85.5	Confident	85.1	Confident	86 Å²	86	98.3 Å²	98.3	38%	0.377	51%	0.507	S	S	.	.	H	α-helix	trans	-59	-44.6	171.6	173.5	-104.2	0	0	0	111.9	T6 P7 K12 L13 I14	T6-F10 PolarHBondContact O-N 3.1Å; T6-F10 VanDerWaalsContact O-N 3.12Å; P7-F10 WeakPolarHBondContact O-CB 3.18Å; P7-F10 PolarHBondContact O-N 3.26Å; F10-K12 VanDerWaalsContact C-N 3.3Å; F10-K12 PolarHBondContact O-N 3.42Å; F10-L13 WeakPolarHBondContact O-CB 3.48Å; F10-L13 PolarHBondContact O-N 2.89Å; F10-I14 HydrophobicContact CD2-CG2 4.43Å; F10-I14 HydrophobicContact CE1-CD1 3.94Å; F10-I14 HydrophobicContact CE1-CG2 4.33Å; F10-I14 HydrophobicContact CE2-CG2 3.84Å; F10-I14 HydrophobicContact CZ-CD1 4.34Å; F10-I14 HydrophobicContact CZ-CG2 3.78Å; F10-I14 PolarHBondContact O-N 3.04Å
11	L	87.1	Confident	85.7	Confident	54 Å²	54	93.6 Å²	93.6	28%	0.283	48%	0.483	S	S	.	.	H	α-helix	trans	-58.3	-42.8	177.8	-60.6	-170.1	0	0	0	111.9	P7 R8 D9 L13 I14 V15 L36	P7-L11 WeakPolarHBondContact O-CG 3.46Å; P7-L11 PolarHBondContact O-N 3.26Å; R8-L11 PolarHBondContact O-N 2.85Å; D9-L11 VanDerWaalsContact C-N 3.34Å; D9-L11 PolarHBondContact O-N 2.94Å; L11-L13 VanDerWaalsContact C-N 3.25Å; L11-L13 PolarHBondContact O-N 2.97Å; L11-I14 HydrophobicContact CD2-CD1 4.27Å; L11-I14 WeakPolarHBondContact O-CG1 3.3Å; L11-I14 PolarHBondContact O-N 2.8Å; L11-V15 WeakPolarHBondContact O-CG2 3.4Å; L11-V15 PolarHBondContact O-N 3.1Å; L11-L36 HydrophobicContact CB-CD2 4.25Å; L11-L36 HydrophobicContact CD1-CD2 3.64Å; L11-L36 HydrophobicContact CD1-CG 4.11Å; L11-L36 HydrophobicContact CD2-CD2 3.34Å; L11-L36 HydrophobicContact CG-CD2 3.88Å
12	K	87.3	Confident	87.9	Confident	137 Å²	137	84.3 Å²	84.3	60%	0.596	44%	0.436	S	S	*	.	H	α-helix	trans	-61.8	-32.6	176.3	-69.1	174.5	-178.3	173.4	0	112.9	R8 D9 F10 I14	R8-K12 WeakPolarHBondContact O-CG 3.44Å; R8-K12 PolarHBondContact O-N 2.7Å; R8-K12 VanDerWaalsContact O-N 3.17Å; D9-K12 PolarHBondContact O-N 2.91Å; F10-K12 VanDerWaalsContact C-N 3.3Å; F10-K12 PolarHBondContact O-N 3.42Å; K12-I14 VanDerWaalsContact C-N 3.31Å
13	L	89.4	Confident	89.5	Confident	90 Å²	90	80.6 Å²	80.6	47%	0.471	40%	0.402	S	S	.	.	H	α-helix	trans	-70.9	-27.2	179.6	-68.6	172.8	0	0	0	113	D9 F10 L11 R17	D9-L13 WeakPolarHBondContact O-CG 3.15Å; D9-L13 PolarHBondContact O-N 2.87Å; F10-L13 WeakPolarHBondContact O-CB 3.48Å; F10-L13 PolarHBondContact O-N 2.89Å; L11-L13 VanDerWaalsContact C-N 3.25Å; L11-L13 PolarHBondContact O-N 2.97Å; L13-R17 VanDerWaalsContact O-CD 3.32Å; L13-R17 WeakPolarHBondContact O-CD 3.41Å; L13-R17 PolarHBondContact O-NE 2.69Å
14	I	92.2	Very high	91	Very high	3 Å²	3	77.6 Å²	77.6	2%	0.015	39%	0.391	C	S	.	.	H	α-helix	trans	-97.3	-13.8	-174.9	61.8	165.1	0	0	0	114	F10 L11 K12 R17 V19 L33 I72 T74	F10-I14 HydrophobicContact CD2-CG2 4.43Å; F10-I14 HydrophobicContact CE1-CD1 3.94Å; F10-I14 HydrophobicContact CE1-CG2 4.33Å; F10-I14 HydrophobicContact CE2-CG2 3.84Å; F10-I14 HydrophobicContact CZ-CD1 4.34Å; F10-I14 HydrophobicContact CZ-CG2 3.78Å; F10-I14 PolarHBondContact O-N 3.04Å; L11-I14 HydrophobicContact CD2-CD1 4.27Å; L11-I14 WeakPolarHBondContact O-CG1 3.3Å; L11-I14 PolarHBondContact O-N 2.8Å; K12-I14 VanDerWaalsContact C-N 3.31Å; I14-R17 WeakPolarHBondContact O-CB 3.35Å; I14-R17 PolarHBondContact O-N 3.09Å; I14-R17 VanDerWaalsContact O-N 3.09Å; I14-V19 HydrophobicContact CB-CG1 4.39Å; I14-L33 HydrophobicContact CB-CD2 4.36Å; I14-L33 HydrophobicContact CD1-CD2 3.75Å; I14-L33 HydrophobicContact CG1-CD2 3.69Å; I14-I72 HydrophobicContact CD1-CG2 4.11Å; I14-T74 HydrophobicContact CG2-CG2 3.56Å
15	V	94.8	Very high	91.9	Very high	69 Å²	69	73.3 Å²	73.3	42%	0.418	39%	0.385	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.8	137.2	170.6	173.3	0	0	0	0	109.9	L11 R17 L33	L11-V15 WeakPolarHBondContact O-CG2 3.4Å; L11-V15 PolarHBondContact O-N 3.1Å; V15-R17 VanDerWaalsContact C-N 3.26Å; V15-R17 PolarHBondContact O-N 2.72Å; V15-L33 HydrophobicContact CG2-CD2 4.18Å; V15-L33 HydrophobicContact CG2-CG 4.43Å
16	G	95.8	Very high	92.6	Very high	52 Å²	52	68.1 Å²	68.1	54%	0.536	37%	0.369	S	S	.	.	T	Hydrogen-bonded Turn	trans	77.2	4	-173.5	0	0	0	0	0	114.5	L33	G16-L33 WeakPolarHBondContact CA-O 3.26Å; G16-L33 PolarHBondContact N-O 3.47Å
17	R	95.9	Very high	93.2	Very high	147 Å²	147	65.3 Å²	65.3	56%	0.555	35%	0.352	S	S	*	.	S	Bend	trans	-109.4	154.4	-179.1	-56.9	-168.9	-177.3	-122.4	-5.4	112.2	L13 I14 V15 V19 L33	L13-R17 VanDerWaalsContact O-CD 3.32Å; L13-R17 WeakPolarHBondContact O-CD 3.41Å; L13-R17 PolarHBondContact O-NE 2.69Å; I14-R17 WeakPolarHBondContact O-CB 3.35Å; I14-R17 PolarHBondContact O-N 3.09Å; I14-R17 VanDerWaalsContact O-N 3.09Å; V15-R17 VanDerWaalsContact C-N 3.26Å; V15-R17 PolarHBondContact O-N 2.72Å; R17-V19 PolarHBondContact O-N 3.28Å; R17-L33 PolarHBondContact O-N 2.86Å
18	P	96.6	Very high	93.9	Very high	77 Å²	77	61.2 Å²	61.2	50%	0.5	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.5	126	167.1	-22.5	34.2	0	0	0	111.4	G31 Q75	P18-G31 WeakPolarHBondContact CA-O 3.29Å; P18-Q75 HydrophobicContact CB-CB 4.07Å; P18-Q75 HydrophobicContact CB-CG 3.99Å; P18-Q75 PolarHBondContact O-N 2.93Å; P18-Q75 VanDerWaalsContact O-N 3.16Å
19	V	96.9	Very high	94.5	Very high	0 Å²	0	54 Å²	54	0%	0	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	165.7	178.6	-62.5	0	0	0	0	111.2	I14 R17 V21 R30 G31 L33 L44 I72 S73	I14-V19 HydrophobicContact CB-CG1 4.39Å; R17-V19 PolarHBondContact O-N 3.28Å; V19-V21 HydrophobicContact CG2-CG2 4.22Å; V19-R30 WeakPolarHBondContact O-CA 3.44Å; V19-G31 PolarHBondContact N-O 2.97Å; V19-G31 PolarHBondContact O-N 2.93Å; V19-L33 HydrophobicContact CG1-CB 3.96Å; V19-L33 HydrophobicContact CG1-CD2 4.38Å; V19-L33 HydrophobicContact CG2-CB 3.86Å; V19-L44 HydrophobicContact CG2-CD2 3.65Å; V19-I72 HydrophobicContact CB-CG2 4.28Å; V19-I72 HydrophobicContact CG1-CG2 4.5Å; V19-S73 CarbonylContact C-O 3.55Å; V19-S73 VanDerWaalsContact CA-O 3.29Å; V19-S73 WeakPolarHBondContact CA-O 3.4Å; V19-S73 WeakPolarHBondContact CB-O 3.39Å
20	V	97.2	Very high	95	Very high	18 Å²	18	55 Å²	55	11%	0.109	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	127.9	163.4	-171.9	0	0	0	0	108.1	D28 Y29 R30 I72 S73 Q75	V20-D28 HydrophobicContact CG1-CB 3.99Å; V20-Y29 CarbonylContact C-O 3.58Å; V20-Y29 WeakPolarHBondContact CA-O 3.22Å; V20-R30 HydrophobicContact CG1-CG 4.33Å; V20-R30 HydrophobicContact CG2-CG 4.2Å; V20-I72 WeakPolarHBondContact O-CA 3.4Å; V20-S73 PolarHBondContact N-O 3.35Å; V20-S73 PolarHBondContact O-N 3.3Å; V20-Q75 HydrophobicContact CG2-CG 3.86Å
21	V	97.4	Very high	95.5	Very high	0 Å²	0	51.3 Å²	51.3	0%	0	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	108.6	172.3	-176.7	0	0	0	0	107.4	V19 L23 Y29 V42 L44 I64 V69 I72	V19-V21 HydrophobicContact CG2-CG2 4.22Å; V21-L23 HydrophobicContact CG1-CD2 4.32Å; V21-Y29 PolarHBondContact N-O 3.32Å; V21-Y29 PolarHBondContact O-N 3.26Å; V21-V42 HydrophobicContact CG1-CG2 4.38Å; V21-V42 HydrophobicContact CG2-CG1 4.18Å; V21-V42 HydrophobicContact CG2-CG2 4.47Å; V21-L44 HydrophobicContact CG2-CD1 3.96Å; V21-L44 HydrophobicContact CG2-CD2 4.3Å; V21-I64 HydrophobicContact CB-CD1 4.09Å; V21-I64 HydrophobicContact CG1-CD1 3.89Å; V21-I64 HydrophobicContact CG2-CD1 4.48Å; V21-V69 HydrophobicContact CG1-CB 4.44Å; V21-V69 HydrophobicContact CG1-CG1 3.8Å; V21-V69 HydrophobicContact CG1-CG2 3.87Å; V21-I72 HydrophobicContact CG1-CG1 4.47Å; V21-I72 HydrophobicContact CG2-CG1 4.33Å; V21-I72 HydrophobicContact CG2-CG2 4.44Å
22	K	97.9	Very high	96	Very high	47 Å²	47	50.2 Å²	50.2	20%	0.204	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.8	127.5	175.4	-174.3	68.6	166.5	-176	0	108.6	G26 D28 F70 Y71	K22-G26 WeakPolarHBondContact CE-O 3.38Å; K22-G26 PolarHBondContact NZ-O 3.43Å; K22-D28 WeakPolarHBondContact CD-OD1 3.41Å; K22-D28 WeakPolarHBondContact CE-OD1 3.45Å; K22-D28 IonicContact NZ-OD1 2.68Å; K22-D28 PolarHBondContact NZ-OD1 2.86Å; K22-F70 HydrophobicContact CB-CB 4.33Å; K22-F70 HydrophobicContact CB-CD1 4.48Å; K22-F70 HydrophobicContact CG-CB 4.16Å; K22-F70 HydrophobicContact CG-CD1 3.94Å; K22-F70 WeakPolarHBondContact O-CB 3.48Å; K22-F70 PolarHBondContact O-N 3.17Å; K22-Y71 HydrophobicContact CB-CD1 3.76Å; K22-Y71 HydrophobicContact CB-CD2 4.03Å; K22-Y71 HydrophobicContact CB-CE1 3.48Å; K22-Y71 VanDerWaalsContact CB-CE1 3.48Å; K22-Y71 HydrophobicContact CB-CE2 3.77Å; K22-Y71 HydrophobicContact CB-CG 4Å; K22-Y71 VanDerWaalsContact CB-CZ 3.48Å; K22-Y71 HydrophobicContact CD-CE1 4.43Å; K22-Y71 HydrophobicContact CG-CD1 4.12Å; K22-Y71 HydrophobicContact CG-CE1 3.6Å; K22-Y71 PolarHBondContact N-O 3.22Å; K22-Y71 PolarHBondContact O-N 3.12Å
23	L	98.1	Very high	96.5	Very high	24 Å²	24	43.7 Å²	43.7	13%	0.126	25%	0.251	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.9	155.8	171.3	-57.6	-168.8	0	0	0	111.3	V21 S25 G26 A27 Y29 I64 N68	V21-L23 HydrophobicContact CG1-CD2 4.32Å; L23-S25 PolarHBondContact O-N 3.36Å; L23-S25 VanDerWaalsContact O-N 3.11Å; L23-G26 PolarHBondContact O-N 3.07Å; L23-A27 HydrophobicContact CD1-CB 4.48Å; L23-A27 PolarHBondContact N-O 2.9Å; L23-Y29 HydrophobicContact CD1-CD2 3.81Å; L23-Y29 HydrophobicContact CD1-CE2 3.47Å; L23-Y29 VanDerWaalsContact CD1-CE2 3.47Å; L23-Y29 HydrophobicContact CG-CD2 3.92Å; L23-Y29 HydrophobicContact CG-CE2 4.09Å; L23-I64 HydrophobicContact CD2-CG2 3.66Å; L23-N68 CarbonylContact C-O 3.52Å; L23-N68 VanDerWaalsContact CA-O 3.26Å; L23-N68 WeakPolarHBondContact CA-O 3.35Å; L23-N68 HydrophobicContact CD2-CB 4.49Å
24	N	97.9	Very high	96.9	Very high	98 Å²	98	42.5 Å²	42.5	52%	0.524	25%	0.245	S	C	.	.	T	Hydrogen-bonded Turn	trans	-56.8	-24.1	173.3	-67.7	-33.2	0	0	0	112.9	G26 N67 N68 F70	N24-G26 VanDerWaalsContact C-N 3.25Å; N24-G26 PolarHBondContact O-N 2.86Å; N24-N67 PolarHBondContact ND2-O 3.17Å; N24-N67 VanDerWaalsContact ND2-O 3.15Å; N24-N68 PolarHBondContact N-O 3.45Å; N24-N68 PolarHBondContact ND2-O 3.13Å; N24-F70 WeakPolarHBondContact OD1-CB 3.36Å
25	S	96.5	Very high	97	Very high	98 Å²	98	45.4 Å²	45.4	69%	0.685	27%	0.265	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.1	-10.8	175.7	59.3	0	0	0	0	114.3	L23	L23-S25 PolarHBondContact O-N 3.36Å; L23-S25 VanDerWaalsContact O-N 3.11Å
26	G	96.5	Very high	97	Very high	32 Å²	32	43.5 Å²	43.5	33%	0.33	25%	0.252	S	S	.	.	S	Bend	trans	93	-4.6	-172.9	0	0	0	0	0	114.6	K22 L23 N24	K22-G26 WeakPolarHBondContact CE-O 3.38Å; K22-G26 PolarHBondContact NZ-O 3.43Å; L23-G26 PolarHBondContact O-N 3.07Å; N24-G26 VanDerWaalsContact C-N 3.25Å; N24-G26 PolarHBondContact O-N 2.86Å
27	A	97.9	Very high	96.8	Very high	5 Å²	5	44 Å²	44	4%	0.041	24%	0.243	C	C	.	.	P	Polyproline II helix	trans	-74.6	141.6	174.4	0	0	0	0	0	111.8	L23 Y29 I51	L23-A27 HydrophobicContact CD1-CB 4.48Å; L23-A27 PolarHBondContact N-O 2.9Å; A27-Y29 HydrophobicContact CB-CD2 4.44Å; A27-Y29 HydrophobicContact CB-CE2 4Å; A27-I51 HydrophobicContact CB-CG1 4.32Å
28	D	97.7	Very high	96.6	Very high	25 Å²	25	40.9 Å²	40.9	13%	0.134	26%	0.257	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.9	125.4	172.8	-57.4	-18.5	0	0	0	109.5	V20 K22 R30 E49 Y50	V20-D28 HydrophobicContact CG1-CB 3.99Å; K22-D28 WeakPolarHBondContact CD-OD1 3.41Å; K22-D28 WeakPolarHBondContact CE-OD1 3.45Å; K22-D28 IonicContact NZ-OD1 2.68Å; K22-D28 PolarHBondContact NZ-OD1 2.86Å; D28-R30 IonicContact OD2-NH2 3.97Å; D28-E49 WeakPolarHBondContact O-CA 2.97Å; D28-Y50 PolarHBondContact N-O 2.85Å; D28-Y50 PolarHBondContact O-N 3.06Å
29	Y	98.1	Very high	96.4	Very high	30 Å²	30	46.3 Å²	46.3	12%	0.118	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.8	122.2	170.4	-78.4	-111.8	0	0	0	108.4	V20 V21 L23 A27 T47 E48 E49 Y59 T62 I64	V20-Y29 CarbonylContact C-O 3.58Å; V20-Y29 WeakPolarHBondContact CA-O 3.22Å; V21-Y29 PolarHBondContact N-O 3.32Å; V21-Y29 PolarHBondContact O-N 3.26Å; L23-Y29 HydrophobicContact CD1-CD2 3.81Å; L23-Y29 HydrophobicContact CD1-CE2 3.47Å; L23-Y29 VanDerWaalsContact CD1-CE2 3.47Å; L23-Y29 HydrophobicContact CG-CD2 3.92Å; L23-Y29 HydrophobicContact CG-CE2 4.09Å; A27-Y29 HydrophobicContact CB-CD2 4.44Å; A27-Y29 HydrophobicContact CB-CE2 4Å; Y29-T47 HydrophobicContact CD1-CG2 3.71Å; Y29-T47 HydrophobicContact CG-CG2 4.49Å; Y29-E48 WeakPolarHBondContact CA-O 3.11Å; Y29-E49 HydrophobicContact CE1-CB 4.25Å; Y29-E49 HydrophobicContact CE2-CB 4.39Å; Y29-E49 HydrophobicContact CE2-CG 3.99Å; Y29-E49 VanDerWaalsContact OH-CD 3.28Å; Y29-E49 PolarHBondContact OH-OE1 3.24Å; Y29-Y59 HydrophobicContact CE1-CD2 4.03Å; Y29-Y59 AromaticContact CE1-CE2 3.95Å; Y29-Y59 HydrophobicContact CE1-CE2 3.95Å; Y29-T62 HydrophobicContact CD1-CG2 4.27Å; Y29-T62 HydrophobicContact CE1-CG2 4.33Å; Y29-I64 HydrophobicContact CD1-CD1 4Å; Y29-I64 HydrophobicContact CG-CD1 3.86Å
30	R	97.5	Very high	96.2	Very high	64 Å²	64	49.8 Å²	49.8	24%	0.242	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.6	126.9	-178.5	-59.2	-173.7	-168.9	174.1	-2.8	108.3	V19 V20 D28 T47 E48 Y50 Q75	V19-R30 WeakPolarHBondContact O-CA 3.44Å; V20-R30 HydrophobicContact CG1-CG 4.33Å; V20-R30 HydrophobicContact CG2-CG 4.2Å; D28-R30 IonicContact OD2-NH2 3.97Å; R30-T47 CarbonylContact O-C 3.59Å; R30-T47 VanDerWaalsContact O-CA 3.29Å; R30-T47 WeakPolarHBondContact O-CA 3.26Å; R30-E48 PolarHBondContact N-O 3.17Å; R30-E48 PolarHBondContact O-N 2.8Å; R30-Y50 HydrophobicContact CB-CD2 4.45Å; R30-Y50 HydrophobicContact CB-CE2 4.16Å; R30-Y50 HydrophobicContact CG-CD2 3.88Å; R30-Y50 HydrophobicContact CG-CE2 3.91Å; R30-Q75 VanDerWaalsContact CD-NE2 3.31Å
31	G	97.6	Very high	96.2	Very high	8 Å²	8	50.7 Å²	50.7	8%	0.082	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-172.7	176.8	-177.8	0	0	0	0	0	112	P18 V19 E45	P18-G31 WeakPolarHBondContact CA-O 3.29Å; V19-G31 PolarHBondContact N-O 2.97Å; V19-G31 PolarHBondContact O-N 2.93Å; G31-E45 CarbonylContact C-O 3.58Å; G31-E45 WeakPolarHBondContact CA-O 3.11Å
32	V	97.4	Very high	96.2	Very high	31 Å²	31	50.7 Å²	50.7	19%	0.188	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.6	122.5	173.7	-178.3	0	0	0	0	108.6	I34 L44 E45	V32-I34 HydrophobicContact CG1-CD1 4.11Å; V32-I34 PolarHBondContact O-N 2.83Å; V32-L44 CarbonylContact O-C 3.45Å; V32-L44 VanDerWaalsContact O-CA 3.3Å; V32-L44 WeakPolarHBondContact O-CA 3.49Å; V32-E45 HydrophobicContact CB-CB 4.39Å; V32-E45 PolarHBondContact N-O 3.42Å; V32-E45 PolarHBondContact O-N 2.77Å
33	L	97.6	Very high	96.2	Very high	0 Å²	0	51 Å²	51	0%	0	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.6	116.1	179	-179.6	62.2	0	0	0	111.1	I14 V15 G16 R17 V19 S35 L36 V42 L44	I14-L33 HydrophobicContact CB-CD2 4.36Å; I14-L33 HydrophobicContact CD1-CD2 3.75Å; I14-L33 HydrophobicContact CG1-CD2 3.69Å; V15-L33 HydrophobicContact CG2-CD2 4.18Å; V15-L33 HydrophobicContact CG2-CG 4.43Å; G16-L33 WeakPolarHBondContact CA-O 3.26Å; G16-L33 PolarHBondContact N-O 3.47Å; R17-L33 PolarHBondContact O-N 2.86Å; V19-L33 HydrophobicContact CG1-CB 3.96Å; V19-L33 HydrophobicContact CG1-CD2 4.38Å; V19-L33 HydrophobicContact CG2-CB 3.86Å; L33-S35 WeakPolarHBondContact CD1-O 3.45Å; L33-L36 HydrophobicContact CD1-CB 4.31Å; L33-L36 HydrophobicContact CD2-CB 4.49Å; L33-V42 HydrophobicContact CD1-CG1 3.34Å; L33-L44 HydrophobicContact CB-CD2 4.38Å; L33-L44 HydrophobicContact CD1-CD2 4.1Å
34	I	97.4	Very high	96.2	Very high	64 Å²	64	49.9 Å²	49.9	33%	0.328	29%	0.29	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.4	-45.6	177.5	-56.3	-51.8	0	0	0	111.4	V32 V43 E45	V32-I34 HydrophobicContact CG1-CD1 4.11Å; V32-I34 PolarHBondContact O-N 2.83Å; I34-V43 HydrophobicContact CB-CB 4.25Å; I34-V43 HydrophobicContact CB-CG1 4.02Å; I34-V43 HydrophobicContact CG2-CG1 4.41Å; I34-V43 PolarHBondContact N-O 2.8Å; I34-E45 HydrophobicContact CD1-CB 4.06Å; I34-E45 HydrophobicContact CD1-CG 3.85Å; I34-E45 HydrophobicContact CG1-CB 4Å; I34-E45 HydrophobicContact CG1-CG 3.57Å
35	S	95.3	Very high	96.2	Very high	64 Å²	64	48.8 Å²	48.8	45%	0.448	28%	0.282	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.8	148.9	-178.6	-171	0	0	0	0	111.5	L33 V43	L33-S35 WeakPolarHBondContact CD1-O 3.45Å; S35-V43 PolarHBondContact N-O 3Å; S35-V43 PolarHBondContact O-N 3.11Å
36	L	94.1	Very high	96.2	Very high	29 Å²	29	51.1 Å²	51.1	15%	0.152	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.7	133.2	177.5	178.2	63.5	0	0	0	109.4	L11 L33 M40 N41 V42 I72	L11-L36 HydrophobicContact CB-CD2 4.25Å; L11-L36 HydrophobicContact CD1-CD2 3.64Å; L11-L36 HydrophobicContact CD1-CG 4.11Å; L11-L36 HydrophobicContact CD2-CD2 3.34Å; L11-L36 HydrophobicContact CG-CD2 3.88Å; L33-L36 HydrophobicContact CD1-CB 4.31Å; L33-L36 HydrophobicContact CD2-CB 4.49Å; L36-M40 HydrophobicContact CD1-CB 4.48Å; L36-N41 WeakPolarHBondContact CA-O 3.42Å; L36-V42 HydrophobicContact CD1-CG2 4Å; L36-I72 HydrophobicContact CD1-CD1 3.64Å; L36-I72 HydrophobicContact CD2-CD1 3.86Å; L36-I72 HydrophobicContact CG-CD1 4.44Å
37	D	92	Very high	96.3	Very high	62 Å²	62	49.6 Å²	49.6	33%	0.332	27%	0.266	S	S	.	.			trans	-112.2	178.9	177.4	74	15.2	0	0	0	113.5	Y39 M40 N41	D37-Y39 PolarHBondContact O-N 3.06Å; D37-Y39 WeakPolarHBondContact OD1-CA 3.48Å; D37-Y39 WeakPolarHBondContact OD1-CB 3.4Å; D37-Y39 PolarHBondContact OD1-N 3.22Å; D37-M40 PolarHBondContact O-N 3.15Å; D37-M40 PolarHBondContact OD1-N 2.9Å; D37-M40 VanDerWaalsContact OD1-N 3.07Å; D37-N41 PolarHBondContact N-O 2.81Å; D37-N41 PolarHBondContact OD1-N 3.49Å; D37-N41 PolarHBondContact OD1-ND2 3.03Å; D37-N41 WeakPolarHBondContact OD2-CB 3.45Å; D37-N41 PolarHBondContact OD2-ND2 2.86Å
38	G	90.1	Very high	96.3	Very high	83 Å²	83	51.7 Å²	51.7	86%	0.856	28%	0.275	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.6	-9.9	179.5	0	0	0	0	0	115
39	Y	92.9	Very high	96.4	Very high	190 Å²	190	51.6 Å²	51.6	75%	0.745	27%	0.274	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.4	5.5	172.1	-62.5	-72.5	0	0	0	112	D37 N41 G66	D37-Y39 PolarHBondContact O-N 3.06Å; D37-Y39 WeakPolarHBondContact OD1-CA 3.48Å; D37-Y39 WeakPolarHBondContact OD1-CB 3.4Å; D37-Y39 PolarHBondContact OD1-N 3.22Å; Y39-N41 VanDerWaalsContact C-N 3.25Å; Y39-N41 PolarHBondContact O-N 3.33Å; Y39-G66 VanDerWaalsContact O-CA 3.32Å; Y39-G66 WeakPolarHBondContact O-CA 3.34Å
40	M	93.3	Very high	96.4	Very high	74 Å²	74	51.8 Å²	51.8	37%	0.365	27%	0.274	S	S	.	.			trans	64.2	22.5	-174.8	-56.1	180	60.2	0	0	114.3	L36 D37 V42 G66 V69 I72	L36-M40 HydrophobicContact CD1-CB 4.48Å; D37-M40 PolarHBondContact O-N 3.15Å; D37-M40 PolarHBondContact OD1-N 2.9Å; D37-M40 VanDerWaalsContact OD1-N 3.07Å; M40-V42 VanDerWaalsContact O-CG2 3.26Å; M40-V42 WeakPolarHBondContact O-CG2 3.35Å; M40-V42 PolarHBondContact O-N 3.32Å; M40-G66 WeakPolarHBondContact O-CA 3.41Å; M40-V69 HydrophobicContact CE-CB 4.06Å; M40-V69 HydrophobicContact CE-CG1 3.52Å; M40-I72 HydrophobicContact CE-CD1 4.42Å; M40-I72 HydrophobicContact CE-CG1 4.4Å
41	N	96.5	Very high	96.4	Very high	37 Å²	37	51.9 Å²	51.9	20%	0.198	28%	0.279	C	S	.	.			trans	-66.9	131.9	168.6	-60.6	-54	0	0	0	109	L36 D37 Y39 F63 I64 G66	L36-N41 WeakPolarHBondContact CA-O 3.42Å; D37-N41 PolarHBondContact N-O 2.81Å; D37-N41 PolarHBondContact OD1-N 3.49Å; D37-N41 PolarHBondContact OD1-ND2 3.03Å; D37-N41 WeakPolarHBondContact OD2-CB 3.45Å; D37-N41 PolarHBondContact OD2-ND2 2.86Å; Y39-N41 VanDerWaalsContact C-N 3.25Å; Y39-N41 PolarHBondContact O-N 3.33Å; N41-F63 HydrophobicContact CB-CE2 3.89Å; N41-F63 HydrophobicContact CB-CZ 4.01Å; N41-I64 WeakPolarHBondContact CA-O 3.29Å; N41-G66 PolarHBondContact OD1-N 3.19Å
42	V	97.3	Very high	96.2	Very high	0 Å²	0	58.8 Å²	58.8	0%	0	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	132.9	-172.8	-162.2	0	0	0	0	110	V21 L33 L36 M40 L44 F63 I64 V69 I72	V21-V42 HydrophobicContact CG1-CG2 4.38Å; V21-V42 HydrophobicContact CG2-CG1 4.18Å; V21-V42 HydrophobicContact CG2-CG2 4.47Å; L33-V42 HydrophobicContact CD1-CG1 3.34Å; L36-V42 HydrophobicContact CD1-CG2 4Å; M40-V42 VanDerWaalsContact O-CG2 3.26Å; M40-V42 WeakPolarHBondContact O-CG2 3.35Å; M40-V42 PolarHBondContact O-N 3.32Å; V42-L44 HydrophobicContact CG1-CD2 3.66Å; V42-L44 HydrophobicContact CG1-CG 3.88Å; V42-F63 CarbonylContact O-C 3.58Å; V42-F63 WeakPolarHBondContact O-CA 3.32Å; V42-I64 HydrophobicContact CB-CB 4.21Å; V42-I64 PolarHBondContact N-O 3.43Å; V42-I64 PolarHBondContact O-N 3.03Å; V42-V69 HydrophobicContact CG2-CG2 4.15Å; V42-I72 HydrophobicContact CG2-CD1 3.93Å
43	V	98.1	Very high	96	Very high	53 Å²	53	59.8 Å²	59.8	32%	0.321	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	120.7	163.2	-177.4	0	0	0	0	107.6	I34 S35 T62 F63	I34-V43 HydrophobicContact CB-CB 4.25Å; I34-V43 HydrophobicContact CB-CG1 4.02Å; I34-V43 HydrophobicContact CG2-CG1 4.41Å; I34-V43 PolarHBondContact N-O 2.8Å; S35-V43 PolarHBondContact N-O 3Å; S35-V43 PolarHBondContact O-N 3.11Å; V43-T62 WeakPolarHBondContact CA-O 3.36Å; V43-F63 HydrophobicContact CG2-CD2 4.13Å
44	L	98.4	Very high	96	Very high	0 Å²	0	65.5 Å²	65.5	0%	0	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.5	148.3	175	-62.4	-178.5	0	0	0	110.3	V19 V21 V32 L33 V42 T47 D61 T62 I64	V19-L44 HydrophobicContact CG2-CD2 3.65Å; V21-L44 HydrophobicContact CG2-CD1 3.96Å; V21-L44 HydrophobicContact CG2-CD2 4.3Å; V32-L44 CarbonylContact O-C 3.45Å; V32-L44 VanDerWaalsContact O-CA 3.3Å; V32-L44 WeakPolarHBondContact O-CA 3.49Å; L33-L44 HydrophobicContact CB-CD2 4.38Å; L33-L44 HydrophobicContact CD1-CD2 4.1Å; V42-L44 HydrophobicContact CG1-CD2 3.66Å; V42-L44 HydrophobicContact CG1-CG 3.88Å; L44-T47 HydrophobicContact CB-CG2 4.33Å; L44-T47 WeakPolarHBondContact CB-OG1 3.48Å; L44-T47 HydrophobicContact CD1-CG2 3.94Å; L44-D61 CarbonylContact O-C 3.55Å; L44-D61 WeakPolarHBondContact O-CA 3.39Å; L44-T62 PolarHBondContact N-O 3.19Å; L44-T62 PolarHBondContact O-N 2.97Å; L44-I64 HydrophobicContact CD1-CD1 3.88Å
45	E	98.1	Very high	96	Very high	76 Å²	76	66.3 Å²	66.3	36%	0.355	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.4	158.8	165.8	-83.9	174.4	-161.4	0	0	110.6	G31 V32 I34 T47 G60	G31-E45 CarbonylContact C-O 3.58Å; G31-E45 WeakPolarHBondContact CA-O 3.11Å; V32-E45 HydrophobicContact CB-CB 4.39Å; V32-E45 PolarHBondContact N-O 3.42Å; V32-E45 PolarHBondContact O-N 2.77Å; I34-E45 HydrophobicContact CD1-CB 4.06Å; I34-E45 HydrophobicContact CD1-CG 3.85Å; I34-E45 HydrophobicContact CG1-CB 4Å; I34-E45 HydrophobicContact CG1-CG 3.57Å; E45-T47 PolarHBondContact O-N 3.29Å; E45-G60 CarbonylContact C-O 3.58Å
46	Q	97.3	Very high	96.1	Very high	147 Å²	147	67.7 Å²	67.7	69%	0.687	36%	0.36	S	S	*	.	E	Extended strand (participates in β ladder)	trans	52.1	41.9	179.8	-58.2	174.3	46.1	0	0	112.1	G60	Q46-G60 PolarHBondContact N-O 2.86Å; Q46-G60 VanDerWaalsContact N-O 3.1Å
47	T	98.3	Very high	96.3	Very high	0 Å²	0	70 Å²	70	0%	0	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.8	132	-167.2	-49.7	0	0	0	0	112.4	Y29 R30 L44 E45 K58 Y59 G60 T62	Y29-T47 HydrophobicContact CD1-CG2 3.71Å; Y29-T47 HydrophobicContact CG-CG2 4.49Å; R30-T47 CarbonylContact O-C 3.59Å; R30-T47 VanDerWaalsContact O-CA 3.29Å; R30-T47 WeakPolarHBondContact O-CA 3.26Å; L44-T47 HydrophobicContact CB-CG2 4.33Å; L44-T47 WeakPolarHBondContact CB-OG1 3.48Å; L44-T47 HydrophobicContact CD1-CG2 3.94Å; E45-T47 PolarHBondContact O-N 3.29Å; T47-K58 CarbonylContact O-C 3.55Å; T47-K58 WeakPolarHBondContact O-CA 3.48Å; T47-Y59 PolarHBondContact O-N 2.77Å; T47-G60 WeakPolarHBondContact CB-O 3.18Å; T47-G60 PolarHBondContact N-O 2.71Å; T47-G60 PolarHBondContact OG1-O 2.68Å; T47-T62 VanDerWaalsContact CB-OG1 3.26Å; T47-T62 WeakPolarHBondContact CB-OG1 3.45Å; T47-T62 HydrophobicContact CG2-CG2 4.17Å; T47-T62 WeakPolarHBondContact OG1-CB 3.47Å; T47-T62 PolarHBondContact OG1-OG1 3.34Å
48	E	98.1	Very high	96.6	Very high	49 Å²	49	73.6 Å²	73.6	23%	0.229	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	134.8	174.4	-63.7	-172.6	152.6	0	0	110.1	Y29 R30 Y50 L55 N57 K58	Y29-E48 WeakPolarHBondContact CA-O 3.11Å; R30-E48 PolarHBondContact N-O 3.17Å; R30-E48 PolarHBondContact O-N 2.8Å; E48-Y50 HydrophobicContact CB-CD2 4.35Å; E48-Y50 HydrophobicContact CB-CE2 3.65Å; E48-Y50 PolarHBondContact OE2-OH 3.22Å; E48-L55 HydrophobicContact CB-CD1 3.77Å; E48-L55 HydrophobicContact CG-CD1 4.19Å; E48-N57 WeakPolarHBondContact CA-O 3.26Å; E48-K58 HydrophobicContact CG-CD 4.26Å; E48-K58 HydrophobicContact CG-CG 4.14Å; E48-K58 WeakPolarHBondContact OE1-CE 3.23Å; E48-K58 IonicContact OE1-NZ 2.7Å; E48-K58 PolarHBondContact OE1-NZ 3.45Å
49	E	98.3	Very high	96.8	Very high	22 Å²	22	74.7 Å²	74.7	10%	0.103	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	132.1	176.9	170.9	179.9	-130.3	0	0	110.6	D28 Y29 K56 N57 Y59	D28-E49 WeakPolarHBondContact O-CA 2.97Å; Y29-E49 HydrophobicContact CE1-CB 4.25Å; Y29-E49 HydrophobicContact CE2-CB 4.39Å; Y29-E49 HydrophobicContact CE2-CG 3.99Å; Y29-E49 VanDerWaalsContact OH-CD 3.28Å; Y29-E49 PolarHBondContact OH-OE1 3.24Å; E49-K56 HydrophobicContact CG-CB 4.42Å; E49-K56 PolarHBondContact O-N 2.89Å; E49-N57 HydrophobicContact CB-CB 4.37Å; E49-N57 PolarHBondContact N-O 3.33Å; E49-N57 PolarHBondContact OE2-ND2 2.93Å; E49-N57 VanDerWaalsContact OE2-ND2 3.1Å; E49-Y59 HydrophobicContact CB-CD2 4.35Å; E49-Y59 HydrophobicContact CB-CE2 3.71Å; E49-Y59 HydrophobicContact CG-CE2 4.48Å; E49-Y59 WeakPolarHBondContact OE2-CE2 3.34Å; E49-Y59 PolarHBondContact OE2-OH 3.11Å
50	Y	98.2	Very high	96.9	Very high	34 Å²	34	67.1 Å²	67.1	13%	0.133	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.5	135.4	175.4	-64.5	-105.5	0	0	0	110.9	D28 R30 E48 Q54 L55	D28-Y50 PolarHBondContact N-O 2.85Å; D28-Y50 PolarHBondContact O-N 3.06Å; R30-Y50 HydrophobicContact CB-CD2 4.45Å; R30-Y50 HydrophobicContact CB-CE2 4.16Å; R30-Y50 HydrophobicContact CG-CD2 3.88Å; R30-Y50 HydrophobicContact CG-CE2 3.91Å; E48-Y50 HydrophobicContact CB-CD2 4.35Å; E48-Y50 HydrophobicContact CB-CE2 3.65Å; E48-Y50 PolarHBondContact OE2-OH 3.22Å; Y50-Q54 VanDerWaalsContact CA-O 3.23Å; Y50-Q54 WeakPolarHBondContact CA-O 3.49Å; Y50-L55 HydrophobicContact CD1-CB 4.24Å; Y50-L55 HydrophobicContact CE1-CB 3.9Å; Y50-L55 HydrophobicContact CE1-CD1 4.38Å; Y50-L55 HydrophobicContact CE2-CD1 4.07Å
51	I	97.6	Very high	97.1	Very high	66 Å²	66	69.9 Å²	69.9	34%	0.338	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.6	127.3	170.4	-57.8	179.8	0	0	0	106.6	A27 G53 Q54 K56	A27-I51 HydrophobicContact CB-CG1 4.32Å; I51-G53 PolarHBondContact O-N 2.98Å; I51-Q54 PolarHBondContact N-O 3.36Å; I51-Q54 PolarHBondContact O-N 3.16Å; I51-K56 HydrophobicContact CB-CG 3.9Å; I51-K56 HydrophobicContact CD1-CG 4.02Å; I51-K56 HydrophobicContact CG1-CG 3.85Å
52	D	94.5	Very high	97.2	Very high	154 Å²	154	69.1 Å²	69.1	82%	0.824	36%	0.357	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.9	37.6	-175.7	-55	-40.4	0	0	0	113.3	Q54	D52-Q54 PolarHBondContact O-N 2.85Å
53	G	93.2	Very high	97.2	Very high	52 Å²	52	75.5 Å²	75.5	54%	0.536	39%	0.385	S	S	.	.	T	Hydrogen-bonded Turn	trans	74.7	-2.2	-179	0	0	0	0	0	115.2	I51	I51-G53 PolarHBondContact O-N 2.98Å
54	Q	97.5	Very high	97.2	Very high	120 Å²	120	73.4 Å²	73.4	56%	0.561	37%	0.372	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.7	132.9	176.3	-62.6	-175.9	-3.8	0	0	111.2	Y50 I51 D52 K56	Y50-Q54 VanDerWaalsContact CA-O 3.23Å; Y50-Q54 WeakPolarHBondContact CA-O 3.49Å; I51-Q54 PolarHBondContact N-O 3.36Å; I51-Q54 PolarHBondContact O-N 3.16Å; D52-Q54 PolarHBondContact O-N 2.85Å; Q54-K56 PolarHBondContact O-N 2.84Å
55	L	97.5	Very high	97.2	Very high	80 Å²	80	81.1 Å²	81.1	42%	0.419	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.1	124.6	172	178.5	67.3	0	0	0	109.6	E48 Y50	E48-L55 HydrophobicContact CB-CD1 3.77Å; E48-L55 HydrophobicContact CG-CD1 4.19Å; Y50-L55 HydrophobicContact CD1-CB 4.24Å; Y50-L55 HydrophobicContact CE1-CB 3.9Å; Y50-L55 HydrophobicContact CE1-CD1 4.38Å; Y50-L55 HydrophobicContact CE2-CD1 4.07Å
56	K	97.7	Very high	97.2	Very high	93 Å²	93	77.8 Å²	77.8	40%	0.404	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	-46	178	-62.9	-53.6	-175	-172.7	0	112.3	E49 I51 Q54	E49-K56 HydrophobicContact CG-CB 4.42Å; E49-K56 PolarHBondContact O-N 2.89Å; I51-K56 HydrophobicContact CB-CG 3.9Å; I51-K56 HydrophobicContact CD1-CG 4.02Å; I51-K56 HydrophobicContact CG1-CG 3.85Å; Q54-K56 PolarHBondContact O-N 2.84Å
57	N	97.6	Very high	97.2	Very high	77 Å²	77	75.2 Å²	75.2	41%	0.412	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.9	163.3	-175.8	-72.7	-55	0	0	0	112.6	E48 E49 Y59	E48-N57 WeakPolarHBondContact CA-O 3.26Å; E49-N57 HydrophobicContact CB-CB 4.37Å; E49-N57 PolarHBondContact N-O 3.33Å; E49-N57 PolarHBondContact OE2-ND2 2.93Å; E49-N57 VanDerWaalsContact OE2-ND2 3.1Å; N57-Y59 HydrophobicContact CB-CD2 4.31Å; N57-Y59 HydrophobicContact CB-CE1 4.06Å; N57-Y59 HydrophobicContact CB-CE2 3.59Å; N57-Y59 VanDerWaalsContact CB-CZ 3.43Å; N57-Y59 WeakPolarHBondContact CB-OH 3.34Å; N57-Y59 PolarHBondContact ND2-OH 2.95Å
58	K	98.2	Very high	97.2	Very high	139 Å²	139	78.8 Å²	78.8	60%	0.604	40%	0.397	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-126.4	128.9	168.3	-51.8	-161.4	-176.6	-151.7	0	109	T47 E48	T47-K58 CarbonylContact O-C 3.55Å; T47-K58 WeakPolarHBondContact O-CA 3.48Å; E48-K58 HydrophobicContact CG-CD 4.26Å; E48-K58 HydrophobicContact CG-CG 4.14Å; E48-K58 WeakPolarHBondContact OE1-CE 3.23Å; E48-K58 IonicContact OE1-NZ 2.7Å; E48-K58 PolarHBondContact OE1-NZ 3.45Å
59	Y	93.9	Very high	97.1	Very high	106 Å²	106	77 Å²	77	42%	0.416	39%	0.389	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	-13.8	-172.4	-63.1	-69.9	0	0	0	113.5	Y29 T47 E49 N57 D61 T62	Y29-Y59 HydrophobicContact CE1-CD2 4.03Å; Y29-Y59 AromaticContact CE1-CE2 3.95Å; Y29-Y59 HydrophobicContact CE1-CE2 3.95Å; T47-Y59 PolarHBondContact O-N 2.77Å; E49-Y59 HydrophobicContact CB-CD2 4.35Å; E49-Y59 HydrophobicContact CB-CE2 3.71Å; E49-Y59 HydrophobicContact CG-CE2 4.48Å; E49-Y59 WeakPolarHBondContact OE2-CE2 3.34Å; E49-Y59 PolarHBondContact OE2-OH 3.11Å; N57-Y59 HydrophobicContact CB-CD2 4.31Å; N57-Y59 HydrophobicContact CB-CE1 4.06Å; N57-Y59 HydrophobicContact CB-CE2 3.59Å; N57-Y59 VanDerWaalsContact CB-CZ 3.43Å; N57-Y59 WeakPolarHBondContact CB-OH 3.34Å; N57-Y59 PolarHBondContact ND2-OH 2.95Å; Y59-D61 PolarHBondContact O-N 3.2Å; Y59-T62 WeakPolarHBondContact CB-OG1 3.32Å
60	G	95.1	Very high	97.1	Very high	31 Å²	31	82.4 Å²	82.4	32%	0.32	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	69.2	-114.5	-174.7	0	0	0	0	0	110.3	E45 Q46 T47	E45-G60 CarbonylContact C-O 3.58Å; Q46-G60 PolarHBondContact N-O 2.86Å; Q46-G60 VanDerWaalsContact N-O 3.1Å; T47-G60 WeakPolarHBondContact CB-O 3.18Å; T47-G60 PolarHBondContact N-O 2.71Å; T47-G60 PolarHBondContact OG1-O 2.68Å
61	D	97.6	Very high	97	Very high	131 Å²	131	85.4 Å²	85.4	70%	0.701	42%	0.424	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.6	124.3	175.2	-61.9	0	0	0	0	109.4	L44 Y59	L44-D61 CarbonylContact O-C 3.55Å; L44-D61 WeakPolarHBondContact O-CA 3.39Å; Y59-D61 PolarHBondContact O-N 3.2Å
62	T	98.1	Very high	96.8	Very high	21 Å²	21	83.7 Å²	83.7	13%	0.129	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.1	128.3	-173.5	-59.3	0	0	0	0	110.9	Y29 V43 L44 T47 Y59 I64	Y29-T62 HydrophobicContact CD1-CG2 4.27Å; Y29-T62 HydrophobicContact CE1-CG2 4.33Å; V43-T62 WeakPolarHBondContact CA-O 3.36Å; L44-T62 PolarHBondContact N-O 3.19Å; L44-T62 PolarHBondContact O-N 2.97Å; T47-T62 VanDerWaalsContact CB-OG1 3.26Å; T47-T62 WeakPolarHBondContact CB-OG1 3.45Å; T47-T62 HydrophobicContact CG2-CG2 4.17Å; T47-T62 WeakPolarHBondContact OG1-CB 3.47Å; T47-T62 PolarHBondContact OG1-OG1 3.34Å; Y59-T62 WeakPolarHBondContact CB-OG1 3.32Å; T62-I64 HydrophobicContact CG2-CG1 4.09Å
63	F	98.1	Very high	96.8	Very high	134 Å²	134	78.3 Å²	78.3	59%	0.588	39%	0.39	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.3	125.3	170.4	176.3	-99.4	0	0	0	110.1	N41 V42 V43 R65	N41-F63 HydrophobicContact CB-CE2 3.89Å; N41-F63 HydrophobicContact CB-CZ 4.01Å; V42-F63 CarbonylContact O-C 3.58Å; V42-F63 WeakPolarHBondContact O-CA 3.32Å; V43-F63 HydrophobicContact CG2-CD2 4.13Å; F63-R65 HydrophobicContact CE1-CB 4.32Å
64	I	98.1	Very high	96.8	Very high	10 Å²	10	79.2 Å²	79.2	5%	0.051	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	121.8	175.9	-56.4	175.2	0	0	0	108.3	V21 L23 Y29 N41 V42 L44 T62 V69	V21-I64 HydrophobicContact CB-CD1 4.09Å; V21-I64 HydrophobicContact CG1-CD1 3.89Å; V21-I64 HydrophobicContact CG2-CD1 4.48Å; L23-I64 HydrophobicContact CD2-CG2 3.66Å; Y29-I64 HydrophobicContact CD1-CD1 4Å; Y29-I64 HydrophobicContact CG-CD1 3.86Å; N41-I64 WeakPolarHBondContact CA-O 3.29Å; V42-I64 HydrophobicContact CB-CB 4.21Å; V42-I64 PolarHBondContact N-O 3.43Å; V42-I64 PolarHBondContact O-N 3.03Å; L44-I64 HydrophobicContact CD1-CD1 3.88Å; T62-I64 HydrophobicContact CG2-CG1 4.09Å; I64-V69 HydrophobicContact CG2-CG2 3.72Å
65	R	98.3	Very high	96.2	Very high	162 Å²	162	76.5 Å²	76.5	61%	0.611	37%	0.373	S	S	*	.			trans	-70.4	130	174.5	-165.5	-175.9	170.4	178.8	-2.9	110.4	F63 N67 N68	F63-R65 HydrophobicContact CE1-CB 4.32Å; R65-N67 VanDerWaalsContact C-N 3.33Å; R65-N67 WeakPolarHBondContact CD-OD1 3.41Å; R65-N67 WeakPolarHBondContact CG-OD1 3.39Å; R65-N67 PolarHBondContact NE-OD1 2.65Å; R65-N67 PolarHBondContact O-N 2.96Å; R65-N68 WeakPolarHBondContact O-CB 3.41Å; R65-N68 PolarHBondContact O-N 3Å
66	G	97.4	Very high	95.2	Very high	5 Å²	5	81.1 Å²	81.1	5%	0.052	39%	0.389	C	S	.	.	G	3₁₀ helix	trans	-65.2	-26.9	-167.3	0	0	0	0	0	116.3	Y39 M40 N41 N68 V69	Y39-G66 VanDerWaalsContact O-CA 3.32Å; Y39-G66 WeakPolarHBondContact O-CA 3.34Å; M40-G66 WeakPolarHBondContact O-CA 3.41Å; N41-G66 PolarHBondContact OD1-N 3.19Å; G66-N68 PolarHBondContact O-N 3.44Å; G66-N68 VanDerWaalsContact O-N 3.11Å; G66-V69 WeakPolarHBondContact O-CB 2.86Å; G66-V69 PolarHBondContact O-N 3.47Å
67	N	97.5	Very high	93.3	Very high	94 Å²	94	88.1 Å²	88.1	50%	0.503	41%	0.413	S	S	.	.	G	3₁₀ helix	trans	-67.8	-10.5	175.7	73	-75.5	0	0	0	113.7	N24 R65	N24-N67 PolarHBondContact ND2-O 3.17Å; N24-N67 VanDerWaalsContact ND2-O 3.15Å; R65-N67 VanDerWaalsContact C-N 3.33Å; R65-N67 WeakPolarHBondContact CD-OD1 3.41Å; R65-N67 WeakPolarHBondContact CG-OD1 3.39Å; R65-N67 PolarHBondContact NE-OD1 2.65Å; R65-N67 PolarHBondContact O-N 2.96Å
68	N	98	Very high	91.2	Very high	75 Å²	75	98.9 Å²	98.9	40%	0.401	45%	0.448	S	S	.	.	G	3₁₀ helix	trans	-95.8	-9.7	173.9	-63.7	-39.3	0	0	0	112.6	L23 N24 R65 G66	L23-N68 CarbonylContact C-O 3.52Å; L23-N68 VanDerWaalsContact CA-O 3.26Å; L23-N68 WeakPolarHBondContact CA-O 3.35Å; L23-N68 HydrophobicContact CD2-CB 4.49Å; N24-N68 PolarHBondContact N-O 3.45Å; N24-N68 PolarHBondContact ND2-O 3.13Å; R65-N68 WeakPolarHBondContact O-CB 3.41Å; R65-N68 PolarHBondContact O-N 3Å; G66-N68 PolarHBondContact O-N 3.44Å; G66-N68 VanDerWaalsContact O-N 3.11Å
69	V	97.7	Very high	90.9	Very high	12 Å²	12	96.9 Å²	96.9	7%	0.073	44%	0.44	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.5	126.2	-177.3	-178	0	0	0	0	109.6	V21 M40 V42 I64 G66 I72	V21-V69 HydrophobicContact CG1-CB 4.44Å; V21-V69 HydrophobicContact CG1-CG1 3.8Å; V21-V69 HydrophobicContact CG1-CG2 3.87Å; M40-V69 HydrophobicContact CE-CB 4.06Å; M40-V69 HydrophobicContact CE-CG1 3.52Å; V42-V69 HydrophobicContact CG2-CG2 4.15Å; I64-V69 HydrophobicContact CG2-CG2 3.72Å; G66-V69 WeakPolarHBondContact O-CB 2.86Å; G66-V69 PolarHBondContact O-N 3.47Å; V69-I72 HydrophobicContact CG1-CD1 4.47Å; V69-I72 HydrophobicContact CG1-CG1 3.9Å
70	F	97.5	Very high	90.7	Very high	135 Å²	135	96.4 Å²	96.4	59%	0.592	44%	0.442	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88	-50.7	173.6	-175.2	-117	0	0	0	111.2	K22 N24	K22-F70 HydrophobicContact CB-CB 4.33Å; K22-F70 HydrophobicContact CB-CD1 4.48Å; K22-F70 HydrophobicContact CG-CB 4.16Å; K22-F70 HydrophobicContact CG-CD1 3.94Å; K22-F70 WeakPolarHBondContact O-CB 3.48Å; K22-F70 PolarHBondContact O-N 3.17Å; N24-F70 WeakPolarHBondContact OD1-CB 3.36Å
71	Y	95.3	Very high	90.5	Very high	97 Å²	97	100.1 Å²	100.1	38%	0.38	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154	164.7	170.1	67.9	-106.1	0	0	0	112	K22	K22-Y71 HydrophobicContact CB-CD1 3.76Å; K22-Y71 HydrophobicContact CB-CD2 4.03Å; K22-Y71 HydrophobicContact CB-CE1 3.48Å; K22-Y71 VanDerWaalsContact CB-CE1 3.48Å; K22-Y71 HydrophobicContact CB-CE2 3.77Å; K22-Y71 HydrophobicContact CB-CG 4Å; K22-Y71 VanDerWaalsContact CB-CZ 3.48Å; K22-Y71 HydrophobicContact CD-CE1 4.43Å; K22-Y71 HydrophobicContact CG-CD1 4.12Å; K22-Y71 HydrophobicContact CG-CE1 3.6Å; K22-Y71 PolarHBondContact N-O 3.22Å; K22-Y71 PolarHBondContact O-N 3.12Å
72	I	94.9	Very high	90.1	Very high	30 Å²	30	98.2 Å²	98.2	15%	0.154	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121	131.2	170	-54	175.6	0	0	0	108	I14 V19 V20 V21 L36 M40 V42 V69	I14-I72 HydrophobicContact CD1-CG2 4.11Å; V19-I72 HydrophobicContact CB-CG2 4.28Å; V19-I72 HydrophobicContact CG1-CG2 4.5Å; V20-I72 WeakPolarHBondContact O-CA 3.4Å; V21-I72 HydrophobicContact CG1-CG1 4.47Å; V21-I72 HydrophobicContact CG2-CG1 4.33Å; V21-I72 HydrophobicContact CG2-CG2 4.44Å; L36-I72 HydrophobicContact CD1-CD1 3.64Å; L36-I72 HydrophobicContact CD2-CD1 3.86Å; L36-I72 HydrophobicContact CG-CD1 4.44Å; M40-I72 HydrophobicContact CE-CD1 4.42Å; M40-I72 HydrophobicContact CE-CG1 4.4Å; V42-I72 HydrophobicContact CG2-CD1 3.93Å; V69-I72 HydrophobicContact CG1-CD1 4.47Å; V69-I72 HydrophobicContact CG1-CG1 3.9Å
73	S	94.4	Very high	89.6	Confident	40 Å²	40	103.1 Å²	103.1	28%	0.28	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.4	153.7	176.7	70.2	0	0	0	0	111.5	V19 V20	V19-S73 CarbonylContact C-O 3.55Å; V19-S73 VanDerWaalsContact CA-O 3.29Å; V19-S73 WeakPolarHBondContact CA-O 3.4Å; V19-S73 WeakPolarHBondContact CB-O 3.39Å; V20-S73 PolarHBondContact N-O 3.35Å; V20-S73 PolarHBondContact O-N 3.3Å
74	T	92.6	Very high	89	Confident	72 Å²	72	101 Å²	101	44%	0.442	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.8	138	169	54.5	0	0	0	0	109.5	I14 K76	I14-T74 HydrophobicContact CG2-CG2 3.56Å; T74-K76 PolarHBondContact O-N 3.16Å
75	Q	84.7	Confident	88.3	Confident	63 Å²	63	107.5 Å²	107.5	29%	0.294	47%	0.472	S	S	.	.	P	Polyproline II helix	trans	-60	129.8	164.7	-78.5	-111.1	1.5	0	0	109.7	P18 V20 R30 R77	P18-Q75 HydrophobicContact CB-CB 4.07Å; P18-Q75 HydrophobicContact CB-CG 3.99Å; P18-Q75 PolarHBondContact O-N 2.93Å; P18-Q75 VanDerWaalsContact O-N 3.16Å; V20-Q75 HydrophobicContact CG2-CG 3.86Å; R30-Q75 VanDerWaalsContact CD-NE2 3.31Å; Q75-R77 PolarHBondContact O-N 2.95Å
76	K	77.4	Confident	87.6	Confident	176 Å²	176	103.3 Å²	103.3	77%	0.765	46%	0.461	S	S	*	.	P	Polyproline II helix	trans	-64.7	124	168.5	-94.4	-175.8	175.2	179.8	0	108.3	T74	T74-K76 PolarHBondContact O-N 3.16Å
77	R	57.8	Low	86.8	Confident	241 Å²	241	111.5 Å²	111.5	91%	0.909	50%	0.495	S	S	*	.	P	Polyproline II helix	trans	-74.3	121.6	162.5	-75.2	177.2	68.9	-148.5	2.6	107.4	Q75	Q75-R77 PolarHBondContact O-N 2.95Å
78	W	53.3	Low	85.8	Confident	303 Å²	303	113.1 Å²	113.1	100%	1.148	49%	0.494	S	S	*	.			trans	-72.5	0	165.4	-35.1	86	0	0	0	109.4

Retrieved 78 of 78 residues in 73.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).