A0A5K4F7Q6_SCHMA Loading...

Succinate dehydrogenase, hydrophobic membrane anchor protein

AlphaFold DB , UniProt , Accession A0A5K4F7Q6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 43 aa.

						>A0A5K4F7Q6_SCHMA|A0A5K4F7Q6
MAISPRLIEYGLKAAGIITSALFFSMGGAYILARCIIDQLFLM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51	Low	79.5	Confident	235 Å²	235	123.3 Å²	123.3	100%	1.158	65%	0.652	S	S	*	*				0	88.3	0	-168.2	116	175.9	0	0	108	I3	M1-I3 PolarHBondContact O-N 3.07Å
2	A	69.7	Low	80.5	Confident	98 Å²	98	123.5 Å²	123.5	81%	0.81	65%	0.653	S	S	*	*			trans	-84.7	112.1	173.4	0	0	0	0	0	107	S4	A2-S4 PolarHBondContact O-N 3.07Å; A2-S4 VanDerWaalsContact O-N 3.12Å
3	I	72.8	Confident	81.2	Confident	113 Å²	113	125.5 Å²	125.5	58%	0.579	65%	0.653	S	S	*	*			trans	-63.4	115	167.2	-64	172.9	0	0	0	105.2	M1 P5 I8	M1-I3 PolarHBondContact O-N 3.07Å; I3-P5 VanDerWaalsContact O-N 3.16Å; I3-I8 HydrophobicContact CB-CD1 4.4Å; I3-I8 HydrophobicContact CG2-CD1 3.86Å; I3-I8 HydrophobicContact CG2-CG1 3.58Å
4	S	79.4	Confident	81.9	Confident	72 Å²	72	119.9 Å²	119.9	50%	0.503	63%	0.633	S	S	.	*			trans	-52.5	123.8	178.7	-61.3	0	0	0	0	108.5	A2 R6 L7 I8	A2-S4 PolarHBondContact O-N 3.07Å; A2-S4 VanDerWaalsContact O-N 3.12Å; S4-R6 PolarHBondContact O-N 2.87Å; S4-L7 WeakPolarHBondContact O-CA 3.44Å; S4-L7 VanDerWaalsContact O-CB 3.26Å; S4-L7 WeakPolarHBondContact O-CB 3.26Å; S4-L7 PolarHBondContact O-N 3.3Å; S4-I8 PolarHBondContact O-N 2.89Å
5	P	81.3	Confident	82.5	Confident	88 Å²	88	114.6 Å²	114.6	57%	0.571	61%	0.613	S	S	*	*	H	α-helix	trans	-56.4	-31.9	-176.7	20.2	-32.2	0	0	0	111.7	I3 L7 I8 E9	I3-P5 VanDerWaalsContact O-N 3.16Å; P5-L7 VanDerWaalsContact C-N 3.28Å; P5-L7 PolarHBondContact O-N 3.5Å; P5-I8 WeakPolarHBondContact O-CB 3.47Å; P5-I8 PolarHBondContact O-N 2.79Å; P5-E9 PolarHBondContact O-N 3.12Å
6	R	85.7	Confident	83	Confident	185 Å²	185	109.8 Å²	109.8	70%	0.698	60%	0.599	S	S	*	*	H	α-helix	trans	-54.5	-41.2	171.2	-66.4	-172.6	176.4	175.2	-0.6	113	S4 I8 E9 Y10	S4-R6 PolarHBondContact O-N 2.87Å; R6-I8 VanDerWaalsContact C-N 3.3Å; R6-I8 PolarHBondContact O-N 2.9Å; R6-E9 PolarHBondContact O-N 3.28Å; R6-Y10 HydrophobicContact CB-CD2 4.44Å; R6-Y10 HydrophobicContact CB-CE2 4.41Å; R6-Y10 WeakPolarHBondContact O-CD2 3.28Å; R6-Y10 PolarHBondContact O-N 3.45Å
7	L	83.7	Confident	83.5	Confident	123 Å²	123	109.9 Å²	109.9	64%	0.644	60%	0.598	S	S	*	*	H	α-helix	trans	-65	-37.5	178.6	-139.4	80	0	0	0	111.3	S4 P5 G11	S4-L7 WeakPolarHBondContact O-CA 3.44Å; S4-L7 VanDerWaalsContact O-CB 3.26Å; S4-L7 WeakPolarHBondContact O-CB 3.26Å; S4-L7 PolarHBondContact O-N 3.3Å; P5-L7 VanDerWaalsContact C-N 3.28Å; P5-L7 PolarHBondContact O-N 3.5Å; L7-G11 PolarHBondContact O-N 3.28Å
8	I	86	Confident	83.8	Confident	100 Å²	100	109.3 Å²	109.3	51%	0.513	59%	0.593	S	S	.	*	H	α-helix	trans	-67.8	-44.1	174.7	-56.8	177.2	0	0	0	109.9	I3 S4 P5 R6 Y10 G11 L12	I3-I8 HydrophobicContact CB-CD1 4.4Å; I3-I8 HydrophobicContact CG2-CD1 3.86Å; I3-I8 HydrophobicContact CG2-CG1 3.58Å; S4-I8 PolarHBondContact O-N 2.89Å; P5-I8 WeakPolarHBondContact O-CB 3.47Å; P5-I8 PolarHBondContact O-N 2.79Å; R6-I8 VanDerWaalsContact C-N 3.3Å; R6-I8 PolarHBondContact O-N 2.9Å; I8-Y10 PolarHBondContact O-N 3.47Å; I8-G11 PolarHBondContact O-N 2.74Å; I8-L12 WeakPolarHBondContact O-CB 3.32Å; I8-L12 PolarHBondContact O-N 3.5Å
9	E	87	Confident	84.1	Confident	130 Å²	130	107.3 Å²	107.3	61%	0.607	59%	0.585	S	S	*	*	H	α-helix	trans	-60.5	-45.7	176.1	-72.2	172.2	-163.4	0	0	112	P5 R6 L12 K13	P5-E9 PolarHBondContact O-N 3.12Å; R6-E9 PolarHBondContact O-N 3.28Å; E9-L12 PolarHBondContact O-N 3.46Å; E9-K13 VanDerWaalsContact O-CB 3.28Å; E9-K13 WeakPolarHBondContact O-CB 3Å; E9-K13 PolarHBondContact O-N 2.94Å
10	Y	89.3	Confident	84.3	Confident	172 Å²	172	105.1 Å²	105.1	68%	0.675	58%	0.577	S	S	*	*	H	α-helix	trans	-62.4	-44.6	174.8	-79.7	-67.9	0	0	0	111.5	R6 I8 K13 A14	R6-Y10 HydrophobicContact CB-CD2 4.44Å; R6-Y10 HydrophobicContact CB-CE2 4.41Å; R6-Y10 WeakPolarHBondContact O-CD2 3.28Å; R6-Y10 PolarHBondContact O-N 3.45Å; I8-Y10 PolarHBondContact O-N 3.47Å; Y10-K13 PolarHBondContact O-N 3.42Å; Y10-A14 WeakPolarHBondContact O-CB 3.19Å; Y10-A14 PolarHBondContact O-N 2.74Å
11	G	89	Confident	84.4	Confident	40 Å²	40	102.6 Å²	102.6	41%	0.412	57%	0.57	S	S	.	*	H	α-helix	trans	-64.4	-41.9	177.7	0	0	0	0	0	112.8	L7 I8 A14 A15	L7-G11 PolarHBondContact O-N 3.28Å; I8-G11 PolarHBondContact O-N 2.74Å; G11-A14 PolarHBondContact O-N 2.88Å; G11-A15 WeakPolarHBondContact O-CB 3.48Å; G11-A15 PolarHBondContact O-N 3.33Å
12	L	90.7	Very high	86	Confident	126 Å²	126	96.2 Å²	96.2	66%	0.66	54%	0.54	S	S	*	.	H	α-helix	trans	-68	-40.6	178.1	-171.3	69.3	0	0	0	111.1	I8 E9 A15 G16	I8-L12 WeakPolarHBondContact O-CB 3.32Å; I8-L12 PolarHBondContact O-N 3.5Å; E9-L12 PolarHBondContact O-N 3.46Å; L12-A15 PolarHBondContact O-N 3.5Å; L12-G16 PolarHBondContact O-N 3.36Å
13	K	89.9	Confident	86.7	Confident	150 Å²	150	98.9 Å²	98.9	65%	0.652	53%	0.534	S	S	*	.	H	α-helix	trans	-62.7	-43.7	173.9	-169.4	175.4	-174.8	179.4	0	111.1	E9 Y10 G16 I17	E9-K13 VanDerWaalsContact O-CB 3.28Å; E9-K13 WeakPolarHBondContact O-CB 3Å; E9-K13 PolarHBondContact O-N 2.94Å; Y10-K13 PolarHBondContact O-N 3.42Å; K13-G16 PolarHBondContact O-N 3.14Å; K13-I17 HydrophobicContact CG-CD1 4.38Å; K13-I17 VanDerWaalsContact O-CG1 3.32Å; K13-I17 WeakPolarHBondContact O-CG1 3.45Å; K13-I17 PolarHBondContact O-N 2.87Å; K13-I17 VanDerWaalsContact O-N 3.14Å
14	A	91.2	Very high	87.3	Confident	46 Å²	46	101.7 Å²	101.7	38%	0.38	54%	0.542	S	S	.	.	H	α-helix	trans	-62.6	-44.7	174.7	0	0	0	0	0	111.6	Y10 G11 G16 I17 I18	Y10-A14 WeakPolarHBondContact O-CB 3.19Å; Y10-A14 PolarHBondContact O-N 2.74Å; G11-A14 PolarHBondContact O-N 2.88Å; A14-G16 PolarHBondContact O-N 2.97Å; A14-I17 PolarHBondContact O-N 3.34Å; A14-I18 WeakPolarHBondContact O-CD1 3.35Å; A14-I18 VanDerWaalsContact O-CG1 3.24Å; A14-I18 WeakPolarHBondContact O-CG1 3.42Å; A14-I18 PolarHBondContact O-N 3.45Å
15	A	91.1	Very high	87.5	Confident	41 Å²	41	102 Å²	102	34%	0.339	54%	0.544	S	S	.	.	H	α-helix	trans	-59.2	-45.7	176.5	0	0	0	0	0	111.7	G11 L12 I17 I18 T19	G11-A15 WeakPolarHBondContact O-CB 3.48Å; G11-A15 PolarHBondContact O-N 3.33Å; L12-A15 PolarHBondContact O-N 3.5Å; A15-I17 VanDerWaalsContact C-N 3.34Å; A15-I17 PolarHBondContact O-N 3.39Å; A15-I18 PolarHBondContact O-N 2.82Å; A15-T19 WeakPolarHBondContact O-CB 3.33Å; A15-T19 PolarHBondContact O-N 3.24Å; A15-T19 PolarHBondContact O-OG1 2.83Å
16	G	90.3	Very high	87.7	Confident	37 Å²	37	104.5 Å²	104.5	38%	0.381	55%	0.55	S	S	.	*	H	α-helix	trans	-60.6	-39.4	177.3	0	0	0	0	0	113.5	L12 K13 A14 S20	L12-G16 PolarHBondContact O-N 3.36Å; K13-G16 PolarHBondContact O-N 3.14Å; A14-G16 PolarHBondContact O-N 2.97Å; G16-S20 WeakPolarHBondContact O-CB 3.39Å; G16-S20 PolarHBondContact O-N 2.94Å; G16-S20 PolarHBondContact O-OG 3.24Å
17	I	91.2	Very high	87.6	Confident	112 Å²	112	97.2 Å²	97.2	57%	0.574	53%	0.533	S	S	*	.	H	α-helix	trans	-65.9	-46.6	175.6	-66.4	165.4	0	0	0	110.5	K13 A14 A15 S20 A21	K13-I17 HydrophobicContact CG-CD1 4.38Å; K13-I17 VanDerWaalsContact O-CG1 3.32Å; K13-I17 WeakPolarHBondContact O-CG1 3.45Å; K13-I17 PolarHBondContact O-N 2.87Å; K13-I17 VanDerWaalsContact O-N 3.14Å; A14-I17 PolarHBondContact O-N 3.34Å; A15-I17 VanDerWaalsContact C-N 3.34Å; A15-I17 PolarHBondContact O-N 3.39Å; I17-S20 PolarHBondContact O-N 3.27Å; I17-A21 WeakPolarHBondContact O-CB 3.36Å; I17-A21 PolarHBondContact O-N 2.99Å
18	I	89.9	Confident	87.4	Confident	100 Å²	100	93.2 Å²	93.2	51%	0.513	52%	0.521	S	S	.	.	H	α-helix	trans	-64	-47	-179.6	-65.4	162.9	0	0	0	110.4	A14 A15 S20 A21 L22	A14-I18 WeakPolarHBondContact O-CD1 3.35Å; A14-I18 VanDerWaalsContact O-CG1 3.24Å; A14-I18 WeakPolarHBondContact O-CG1 3.42Å; A14-I18 PolarHBondContact O-N 3.45Å; A15-I18 PolarHBondContact O-N 2.82Å; I18-S20 VanDerWaalsContact C-N 3.33Å; I18-S20 PolarHBondContact O-N 2.99Å; I18-A21 PolarHBondContact O-N 2.93Å; I18-L22 HydrophobicContact CG2-CD1 4.06Å; I18-L22 HydrophobicContact CG2-CG 4.45Å; I18-L22 WeakPolarHBondContact O-CG 3.24Å; I18-L22 PolarHBondContact O-N 3.23Å
19	T	89	Confident	87.2	Confident	71 Å²	71	91.2 Å²	91.2	44%	0.436	52%	0.52	S	S	.	.	H	α-helix	trans	-58.6	-46.6	176.6	-60.2	0	0	0	0	110.6	A15 A21 L22 F23	A15-T19 WeakPolarHBondContact O-CB 3.33Å; A15-T19 PolarHBondContact O-N 3.24Å; A15-T19 PolarHBondContact O-OG1 2.83Å; T19-A21 PolarHBondContact O-N 3.4Å; T19-L22 PolarHBondContact O-N 2.94Å; T19-F23 HydrophobicContact CG2-CD2 3.68Å; T19-F23 HydrophobicContact CG2-CE2 3.71Å; T19-F23 WeakPolarHBondContact O-CD2 3.36Å; T19-F23 PolarHBondContact O-N 3.42Å
20	S	87.1	Confident	87.1	Confident	63 Å²	63	91.8 Å²	91.8	44%	0.441	52%	0.517	S	S	.	.	H	α-helix	trans	-58.9	-46.4	177	-58	0	0	0	0	111.7	G16 I17 I18 L22 F23 F24	G16-S20 WeakPolarHBondContact O-CB 3.39Å; G16-S20 PolarHBondContact O-N 2.94Å; G16-S20 PolarHBondContact O-OG 3.24Å; I17-S20 PolarHBondContact O-N 3.27Å; I18-S20 VanDerWaalsContact C-N 3.33Å; I18-S20 PolarHBondContact O-N 2.99Å; S20-L22 VanDerWaalsContact C-N 3.33Å; S20-L22 PolarHBondContact O-N 2.93Å; S20-F23 PolarHBondContact O-N 3.24Å; S20-F24 VanDerWaalsContact O-CD2 3.24Å; S20-F24 WeakPolarHBondContact O-CD2 3.32Å; S20-F24 PolarHBondContact O-N 3.44Å
21	A	86.9	Confident	86.8	Confident	52 Å²	52	89.1 Å²	89.1	43%	0.43	51%	0.514	S	S	.	.	H	α-helix	trans	-60.7	-40.8	178	0	0	0	0	0	112.5	I17 I18 T19 S25	I17-A21 WeakPolarHBondContact O-CB 3.36Å; I17-A21 PolarHBondContact O-N 2.99Å; I18-A21 PolarHBondContact O-N 2.93Å; T19-A21 PolarHBondContact O-N 3.4Å; A21-S25 WeakPolarHBondContact O-CB 3.24Å; A21-S25 PolarHBondContact O-N 2.88Å; A21-S25 PolarHBondContact O-OG 2.98Å
22	L	85.5	Confident	86.5	Confident	101 Å²	101	92.5 Å²	92.5	53%	0.529	52%	0.522	S	S	.	.	H	α-helix	trans	-65.1	-42.9	175.7	-70.8	172.3	0	0	0	112	I18 T19 S20 S25 M26	I18-L22 HydrophobicContact CG2-CD1 4.06Å; I18-L22 HydrophobicContact CG2-CG 4.45Å; I18-L22 WeakPolarHBondContact O-CG 3.24Å; I18-L22 PolarHBondContact O-N 3.23Å; T19-L22 PolarHBondContact O-N 2.94Å; S20-L22 VanDerWaalsContact C-N 3.33Å; S20-L22 PolarHBondContact O-N 2.93Å; L22-S25 PolarHBondContact O-N 3.42Å; L22-M26 WeakPolarHBondContact O-CG 3.49Å; L22-M26 PolarHBondContact O-N 3.48Å
23	F	84.3	Confident	86.3	Confident	154 Å²	154	88.7 Å²	88.7	68%	0.675	51%	0.508	S	S	*	.	H	α-helix	trans	-63.5	-44.6	176.5	-93.2	-86.7	0	0	0	112.2	T19 S20 S25 M26 G27	T19-F23 HydrophobicContact CG2-CD2 3.68Å; T19-F23 HydrophobicContact CG2-CE2 3.71Å; T19-F23 WeakPolarHBondContact O-CD2 3.36Å; T19-F23 PolarHBondContact O-N 3.42Å; S20-F23 PolarHBondContact O-N 3.24Å; F23-S25 VanDerWaalsContact C-N 3.31Å; F23-S25 PolarHBondContact O-N 3.34Å; F23-M26 PolarHBondContact O-N 2.89Å; F23-G27 PolarHBondContact O-N 2.88Å
24	F	83.9	Confident	86	Confident	172 Å²	172	88.9 Å²	88.9	75%	0.754	51%	0.505	S	S	*	.	H	α-helix	trans	-62.7	-38.9	174.5	-85.5	-73.5	0	0	0	112	S20 G27 G28	S20-F24 VanDerWaalsContact O-CD2 3.24Å; S20-F24 WeakPolarHBondContact O-CD2 3.32Å; S20-F24 PolarHBondContact O-N 3.44Å; F24-G27 PolarHBondContact O-N 2.71Å; F24-G28 PolarHBondContact O-N 2.94Å
25	S	85	Confident	85.7	Confident	78 Å²	78	90.1 Å²	90.1	55%	0.545	51%	0.509	S	S	.	.	H	α-helix	trans	-66.5	-45.2	178.2	-59.1	0	0	0	0	111.9	A21 L22 F23 G28 A29	A21-S25 WeakPolarHBondContact O-CB 3.24Å; A21-S25 PolarHBondContact O-N 2.88Å; A21-S25 PolarHBondContact O-OG 2.98Å; L22-S25 PolarHBondContact O-N 3.42Å; F23-S25 VanDerWaalsContact C-N 3.31Å; F23-S25 PolarHBondContact O-N 3.34Å; S25-G28 PolarHBondContact O-N 2.93Å; S25-A29 WeakPolarHBondContact O-CB 3.3Å; S25-A29 PolarHBondContact O-N 3.38Å
26	M	84.3	Confident	85.5	Confident	141 Å²	141	93.1 Å²	93.1	70%	0.695	52%	0.519	S	S	*	.	H	α-helix	trans	-65.7	-40.9	175.6	-74.7	-169.2	177.7	0	0	112	L22 F23 A29 Y30	L22-M26 WeakPolarHBondContact O-CG 3.49Å; L22-M26 PolarHBondContact O-N 3.48Å; F23-M26 PolarHBondContact O-N 2.89Å; M26-A29 PolarHBondContact O-N 3.45Å; M26-Y30 WeakPolarHBondContact O-CB 3.26Å; M26-Y30 PolarHBondContact O-N 2.83Å
27	G	84.1	Confident	85.2	Confident	33 Å²	33	96.8 Å²	96.8	34%	0.34	53%	0.529	S	S	.	.	H	α-helix	trans	-61.2	-44.7	174.6	0	0	0	0	0	112.2	F23 F24 Y30 I31	F23-G27 PolarHBondContact O-N 2.88Å; F24-G27 PolarHBondContact O-N 2.71Å; G27-Y30 PolarHBondContact O-N 3.45Å; G27-I31 VanDerWaalsContact O-CG1 3.3Å; G27-I31 WeakPolarHBondContact O-CG1 3.47Å; G27-I31 PolarHBondContact O-N 3.28Å
28	G	80	Confident	84.8	Confident	38 Å²	38	96.6 Å²	96.6	39%	0.392	53%	0.529	S	S	.	.	H	α-helix	trans	-63.4	-44.1	176	0	0	0	0	0	112.8	F24 S25 Y30 I31 L32	F24-G28 PolarHBondContact O-N 2.94Å; S25-G28 PolarHBondContact O-N 2.93Å; G28-Y30 VanDerWaalsContact C-N 3.34Å; G28-Y30 PolarHBondContact O-N 3.34Å; G28-I31 PolarHBondContact O-N 2.88Å; G28-L32 WeakPolarHBondContact O-CB 3.44Å; G28-L32 PolarHBondContact O-N 2.91Å
29	A	81.9	Confident	84.4	Confident	58 Å²	58	97.4 Å²	97.4	48%	0.479	53%	0.53	S	S	.	.	H	α-helix	trans	-63.4	-39.2	175.5	0	0	0	0	0	112.1	S25 M26 L32 A33	S25-A29 WeakPolarHBondContact O-CB 3.3Å; S25-A29 PolarHBondContact O-N 3.38Å; M26-A29 PolarHBondContact O-N 3.45Å; A29-L32 PolarHBondContact O-N 3.28Å; A29-A33 VanDerWaalsContact O-CB 3.3Å; A29-A33 WeakPolarHBondContact O-CB 3.39Å; A29-A33 PolarHBondContact O-N 2.86Å
30	Y	83.7	Confident	84.2	Confident	142 Å²	142	100.3 Å²	100.3	56%	0.557	54%	0.543	S	S	*	.	H	α-helix	trans	-64.4	-43.8	175.8	-178.2	-97.4	0	0	0	111.9	M26 G27 G28 A33 R34	M26-Y30 WeakPolarHBondContact O-CB 3.26Å; M26-Y30 PolarHBondContact O-N 2.83Å; G27-Y30 PolarHBondContact O-N 3.45Å; G28-Y30 VanDerWaalsContact C-N 3.34Å; G28-Y30 PolarHBondContact O-N 3.34Å; Y30-A33 PolarHBondContact O-N 2.87Å; Y30-R34 VanDerWaalsContact O-CB 3.25Å; Y30-R34 WeakPolarHBondContact O-CB 3.25Å; Y30-R34 PolarHBondContact O-N 3.45Å; Y30-R34 PolarHBondContact OH-NH1 3.03Å
31	I	83.4	Confident	83.9	Confident	117 Å²	117	106.2 Å²	106.2	60%	0.6	56%	0.561	S	S	*	*	H	α-helix	trans	-63.7	-43.9	176	-67.3	164.9	0	0	0	110.5	G27 G28 R34 C35	G27-I31 VanDerWaalsContact O-CG1 3.3Å; G27-I31 WeakPolarHBondContact O-CG1 3.47Å; G27-I31 PolarHBondContact O-N 3.28Å; G28-I31 PolarHBondContact O-N 2.88Å; I31-R34 PolarHBondContact O-N 3.48Å; I31-C35 VanDerWaalsContact O-CB 3.26Å; I31-C35 WeakPolarHBondContact O-CB 3.33Å; I31-C35 PolarHBondContact O-N 3.42Å
32	L	84.1	Confident	83.4	Confident	111 Å²	111	110.4 Å²	110.4	58%	0.581	58%	0.575	S	S	*	*	H	α-helix	trans	-62.4	-46.6	177.6	-171.7	71.5	0	0	0	111.4	G28 A29 R34 C35 I36	G28-L32 WeakPolarHBondContact O-CB 3.44Å; G28-L32 PolarHBondContact O-N 2.91Å; A29-L32 PolarHBondContact O-N 3.28Å; L32-R34 PolarHBondContact O-N 2.9Å; L32-C35 WeakPolarHBondContact O-CB 3.17Å; L32-C35 PolarHBondContact O-N 2.85Å; L32-I36 HydrophobicContact CG-CD1 4.08Å; L32-I36 VanDerWaalsContact O-CG1 3.29Å; L32-I36 WeakPolarHBondContact O-CG1 3.29Å; L32-I36 PolarHBondContact O-N 3.49Å
33	A	84.9	Confident	82.2	Confident	45 Å²	45	116.2 Å²	116.2	37%	0.372	60%	0.602	S	S	.	*	H	α-helix	trans	-62.5	-43.2	177.4	0	0	0	0	0	111.5	A29 Y30 C35 I36 I37	A29-A33 VanDerWaalsContact O-CB 3.3Å; A29-A33 WeakPolarHBondContact O-CB 3.39Å; A29-A33 PolarHBondContact O-N 2.86Å; Y30-A33 PolarHBondContact O-N 2.87Å; A33-C35 VanDerWaalsContact C-N 3.34Å; A33-C35 PolarHBondContact O-N 3.45Å; A33-I36 PolarHBondContact O-N 3.46Å; A33-I37 WeakPolarHBondContact O-CB 3.31Å; A33-I37 VanDerWaalsContact O-CG1 3.22Å; A33-I37 WeakPolarHBondContact O-CG1 3.3Å; A33-I37 PolarHBondContact O-N 2.92Å
34	R	84.1	Confident	82.1	Confident	155 Å²	155	114.3 Å²	114.3	59%	0.585	60%	0.598	S	S	*	*	H	α-helix	trans	-65.3	-37.8	176.8	-168.2	161.8	173.4	151.5	-4.3	111.7	Y30 I31 L32 I37 D38	Y30-R34 VanDerWaalsContact O-CB 3.25Å; Y30-R34 WeakPolarHBondContact O-CB 3.25Å; Y30-R34 PolarHBondContact O-N 3.45Å; Y30-R34 PolarHBondContact OH-NH1 3.03Å; I31-R34 PolarHBondContact O-N 3.48Å; L32-R34 PolarHBondContact O-N 2.9Å; R34-I37 PolarHBondContact O-N 3.41Å; R34-D38 WeakPolarHBondContact O-CB 3.3Å; R34-D38 PolarHBondContact O-N 2.92Å
35	C	84.8	Confident	82	Confident	71 Å²	71	111.3 Å²	111.3	48%	0.48	59%	0.59	S	S	.	*	H	α-helix	trans	-63.9	-44.4	173.4	-174.7	0	0	0	0	112	I31 L32 A33 D38 Q39	I31-C35 VanDerWaalsContact O-CB 3.26Å; I31-C35 WeakPolarHBondContact O-CB 3.33Å; I31-C35 PolarHBondContact O-N 3.42Å; L32-C35 WeakPolarHBondContact O-CB 3.17Å; L32-C35 PolarHBondContact O-N 2.85Å; A33-C35 VanDerWaalsContact C-N 3.34Å; A33-C35 PolarHBondContact O-N 3.45Å; C35-D38 PolarHBondContact O-N 2.9Å; C35-Q39 VanDerWaalsContact O-CB 3.31Å; C35-Q39 WeakPolarHBondContact O-CB 3.22Å; C35-Q39 VanDerWaalsContact O-CG 3.22Å; C35-Q39 WeakPolarHBondContact O-CG 3.45Å; C35-Q39 PolarHBondContact O-N 3.31Å
36	I	86.8	Confident	81.9	Confident	105 Å²	105	113.1 Å²	113.1	54%	0.538	59%	0.593	S	S	.	*	H	α-helix	trans	-63.3	-43.5	176.3	-67	164.9	0	0	0	110.8	L32 A33 L40	L32-I36 HydrophobicContact CG-CD1 4.08Å; L32-I36 VanDerWaalsContact O-CG1 3.29Å; L32-I36 WeakPolarHBondContact O-CG1 3.29Å; L32-I36 PolarHBondContact O-N 3.49Å; A33-I36 PolarHBondContact O-N 3.46Å; I36-L40 VanDerWaalsContact O-CB 3.3Å; I36-L40 WeakPolarHBondContact O-CB 3.22Å; I36-L40 PolarHBondContact O-N 3.49Å
37	I	85.5	Confident	81.7	Confident	114 Å²	114	111.5 Å²	111.5	59%	0.585	59%	0.587	S	S	*	*	H	α-helix	trans	-67.2	-42.6	178.8	-67.5	165.5	0	0	0	111.1	A33 R34 L40 F41	A33-I37 WeakPolarHBondContact O-CB 3.31Å; A33-I37 VanDerWaalsContact O-CG1 3.22Å; A33-I37 WeakPolarHBondContact O-CG1 3.3Å; A33-I37 PolarHBondContact O-N 2.92Å; R34-I37 PolarHBondContact O-N 3.41Å; I37-L40 PolarHBondContact O-N 3.41Å; I37-F41 PolarHBondContact O-N 3.28Å
38	D	82.9	Confident	81.6	Confident	108 Å²	108	116.4 Å²	116.4	58%	0.578	60%	0.602	S	S	*	*	H	α-helix	trans	-63.3	-44.8	177.9	-162.9	-104.7	0	0	0	110.9	R34 C35 L40 F41 L42	R34-D38 WeakPolarHBondContact O-CB 3.3Å; R34-D38 PolarHBondContact O-N 2.92Å; C35-D38 PolarHBondContact O-N 2.9Å; D38-L40 VanDerWaalsContact C-N 3.33Å; D38-L40 PolarHBondContact O-N 2.98Å; D38-F41 PolarHBondContact O-N 2.98Å; D38-L42 WeakPolarHBondContact O-CB 3.38Å; D38-L42 PolarHBondContact O-N 3.43Å
39	Q	80.4	Confident	81.7	Confident	117 Å²	117	121.6 Å²	121.6	55%	0.547	62%	0.616	S	S	.	*	H	α-helix	trans	-63.2	-36	173.3	-73.8	-83.6	73.5	0	0	112.9	C35 M43	C35-Q39 VanDerWaalsContact O-CB 3.31Å; C35-Q39 WeakPolarHBondContact O-CB 3.22Å; C35-Q39 VanDerWaalsContact O-CG 3.22Å; C35-Q39 WeakPolarHBondContact O-CG 3.45Å; C35-Q39 PolarHBondContact O-N 3.31Å; Q39-M43 PolarHBondContact O-N 3.25Å
40	L	84.7	Confident	81.7	Confident	132 Å²	132	126.1 Å²	126.1	69%	0.691	63%	0.626	S	S	*	*	H	α-helix	trans	-70.9	-31.5	177.7	-175.3	66.4	0	0	0	112.4	I36 I37 D38	I36-L40 VanDerWaalsContact O-CB 3.3Å; I36-L40 WeakPolarHBondContact O-CB 3.22Å; I36-L40 PolarHBondContact O-N 3.49Å; I37-L40 PolarHBondContact O-N 3.41Å; D38-L40 VanDerWaalsContact C-N 3.33Å; D38-L40 PolarHBondContact O-N 2.98Å
41	F	80	Confident	81.5	Confident	187 Å²	187	124.9 Å²	124.9	82%	0.82	63%	0.631	S	S	*	*	H	α-helix	trans	-86.7	-22	179.6	-162.3	-98.2	0	0	0	113	I37 D38	I37-F41 PolarHBondContact O-N 3.28Å; D38-F41 PolarHBondContact O-N 2.98Å
42	L	77	Confident	81.4	Confident	140 Å²	140	125.6 Å²	125.6	73%	0.733	63%	0.634	S	S	*	*	H	α-helix	trans	-79.9	-19.5	174.8	-163.1	72.4	0	0	0	113	D38	D38-L42 WeakPolarHBondContact O-CB 3.38Å; D38-L42 PolarHBondContact O-N 3.43Å
43	M	61.2	Low	81.1	Confident	222 Å²	222	126.9 Å²	126.9	100%	1.094	64%	0.638	S	S	*	*			trans	-84.8	0	169.3	-84.9	-170	176.5	0	0	111.9	Q39	Q39-M43 PolarHBondContact O-N 3.25Å

Retrieved 43 of 43 residues in 64.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).