A0A5K4F7U5_SCHMA Loading...

Heat shock factor-binding protein 1

AlphaFold DB , UniProt , Accession A0A5K4F7U5, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 76 aa.

						>A0A5K4F7U5_SCHMA|A0A5K4F7U5
MSLHTEIVRDRSFGIPDPHTVTELSNYMQNIFQQMQDTLQQTSEKITTRIEEMGSKIDSLEKNVADLMTQAGVHEG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.5	Very low	49.3	Very low	250 Å²	250	166.6 Å²	166.6	100%	1.232	82%	0.824	S	S	*	*				0	116.9	0	-62.2	-165.5	-78.2	0	0	107.1
2	S	52.2	Low	49.7	Very low	106 Å²	106	161.6 Å²	161.6	74%	0.741	82%	0.818	S	S	*	*			trans	-132.9	120.1	177.8	-165	0	0	0	0	107.5
3	L	48.8	Very low	49.9	Very low	181 Å²	181	164.2 Å²	164.2	95%	0.948	82%	0.821	S	S	*	*			trans	-94.6	107	177.6	-71.6	166.9	0	0	0	106.8
4	H	46.5	Very low	50.5	Low	150 Å²	150	157.5 Å²	157.5	69%	0.694	81%	0.814	S	S	*	*			trans	-102	155.3	179.2	-117.8	62.8	0	0	0	110.3
5	T	52.3	Low	51.2	Low	109 Å²	109	156.8 Å²	156.8	67%	0.669	81%	0.81	S	S	*	*			trans	71.7	100.4	154.5	54.7	0	0	0	0	116.5
6	E	51.9	Low	52.2	Low	171 Å²	171	152.2 Å²	152.2	80%	0.799	79%	0.793	S	S	*	*				88.2	101.2	72.1	-84.4	174.5	139	0	0	112.6	V8	E6-V8 PolarHBondContact O-N 2.93Å
7	I	49.7	Very low	53.5	Low	154 Å²	154	147.9 Å²	147.9	79%	0.79	77%	0.771	S	S	*	*			trans	-54.6	96.4	164	-62.9	157.7	0	0	0	108.3	R9	I7-R9 HydrophobicContact CG2-CG 4.18Å; I7-R9 PolarHBondContact O-N 3.4Å
8	V	52	Low	55	Low	137 Å²	137	144.7 Å²	144.7	83%	0.83	76%	0.761	S	S	*	*			trans	-85.4	105.4	162.8	-178.4	0	0	0	0	107.2	E6	E6-V8 PolarHBondContact O-N 2.93Å
9	R	48	Very low	56.6	Low	214 Å²	214	144.1 Å²	144.1	81%	0.808	75%	0.753	S	S	*	*			trans	-65.7	129.3	172.6	-61	-178.6	-153.8	108.4	5.5	110.5	I7	I7-R9 HydrophobicContact CG2-CG 4.18Å; I7-R9 PolarHBondContact O-N 3.4Å
10	D	44.6	Very low	58.1	Low	125 Å²	125	140.2 Å²	140.2	67%	0.668	74%	0.736	S	S	*	*			trans	-0.5	119.8	143.3	-172.5	52	0	0	0	117.6
11	R	53.7	Low	59.6	Low	236 Å²	236	137.3 Å²	137.3	89%	0.891	72%	0.724	S	S	*	*			trans	-154.7	46	161.8	-76.1	-156.3	-163.7	-163.8	5.1	113.6
12	S	54.1	Low	62	Low	106 Å²	106	129 Å²	129	74%	0.741	69%	0.688	S	S	*	*			trans	-115.4	58.2	166.1	-62.2	0	0	0	0	110.8	G14	S12-G14 PolarHBondContact O-N 2.9Å
13	F	52.2	Low	63.9	Low	196 Å²	196	130.3 Å²	130.3	86%	0.86	68%	0.682	S	S	*	*			trans	-64.7	109.5	158.3	-89.4	-96.4	0	0	0	108.5
14	G	58.6	Low	66.1	Low	70 Å²	70	126.4 Å²	126.4	72%	0.722	66%	0.661	S	S	*	*			trans	118	13.5	148.3	0	0	0	0	0	119.8	S12 P16	S12-G14 PolarHBondContact O-N 2.9Å; G14-P16 WeakPolarHBondContact O-CD 3.28Å
15	I	60.8	Low	68.4	Low	147 Å²	147	122.3 Å²	122.3	75%	0.754	65%	0.65	S	S	*	*	P	Polyproline II helix	trans	-84	116.6	157.4	-57.8	179.4	0	0	0	105.7	D17	I15-D17 PolarHBondContact O-N 3.07Å; I15-D17 VanDerWaalsContact O-N 3.17Å
16	P	66.8	Low	70.4	Confident	83 Å²	83	121.6 Å²	121.6	54%	0.539	64%	0.642	S	S	.	*	P	Polyproline II helix	trans	-52.3	127.3	171.4	-21	31.5	0	0	0	107.7	G14 V21	G14-P16 WeakPolarHBondContact O-CD 3.28Å; P16-V21 HydrophobicContact CB-CG2 3.76Å
17	D	75.7	Confident	72.5	Confident	79 Å²	79	120.6 Å²	120.6	42%	0.422	63%	0.632	S	S	.	*	P	Polyproline II helix	trans	-51.3	128.1	-179.7	-177.7	-44.5	0	0	0	108	I15 H19 T20 V21	I15-D17 PolarHBondContact O-N 3.07Å; I15-D17 VanDerWaalsContact O-N 3.17Å; D17-H19 PolarHBondContact O-N 3.22Å; D17-H19 WeakPolarHBondContact OD1-CA 3.24Å; D17-H19 WeakPolarHBondContact OD1-CB 3.43Å; D17-H19 IonicContact OD1-CD2 3.01Å; D17-H19 PolarHBondContact OD1-CD2 3.33Å; D17-H19 IonicContact OD1-CG 3.33Å; D17-H19 PolarHBondContact OD1-N 2.83Å; D17-H19 IonicContact OD2-CD2 3.94Å; D17-T20 HydrophobicContact CB-CG2 3.95Å; D17-T20 PolarHBondContact N-OG1 2.98Å; D17-T20 WeakPolarHBondContact O-CA 3.34Å; D17-T20 WeakPolarHBondContact O-CB 3.44Å; D17-T20 PolarHBondContact O-N 3.31Å; D17-T20 PolarHBondContact O-OG1 3.41Å; D17-V21 PolarHBondContact O-N 3.49Å; D17-V21 VanDerWaalsContact O-N 3.13Å
18	P	79.6	Confident	74.7	Confident	91 Å²	91	117.4 Å²	117.4	59%	0.591	61%	0.614	S	S	*	*	H	α-helix	trans	-53.3	-27.1	-179.6	20	-31.8	0	0	0	112.9	T22	P18-T22 WeakPolarHBondContact O-CB 3.33Å; P18-T22 PolarHBondContact O-N 2.83Å; P18-T22 PolarHBondContact O-OG1 3.16Å
19	H	84.7	Confident	76.8	Confident	132 Å²	132	116.4 Å²	116.4	61%	0.611	60%	0.601	S	S	*	*	H	α-helix	trans	-63.7	-45.8	170.6	-61	-66.3	0	0	0	111.8	D17 V21 T22 E23	D17-H19 PolarHBondContact O-N 3.22Å; D17-H19 WeakPolarHBondContact OD1-CA 3.24Å; D17-H19 WeakPolarHBondContact OD1-CB 3.43Å; D17-H19 IonicContact OD1-CD2 3.01Å; D17-H19 PolarHBondContact OD1-CD2 3.33Å; D17-H19 IonicContact OD1-CG 3.33Å; D17-H19 PolarHBondContact OD1-N 2.83Å; D17-H19 IonicContact OD2-CD2 3.94Å; H19-V21 VanDerWaalsContact C-N 3.35Å; H19-V21 PolarHBondContact O-N 3.44Å; H19-T22 WeakPolarHBondContact O-CB 3.28Å; H19-T22 PolarHBondContact O-N 2.85Å; H19-E23 WeakPolarHBondContact O-CG 3.47Å; H19-E23 PolarHBondContact O-N 3.21Å
20	T	87.1	Confident	79.2	Confident	67 Å²	67	110.7 Å²	110.7	41%	0.411	59%	0.586	S	S	.	*	H	α-helix	trans	-63.8	-38.4	177.2	64.9	0	0	0	0	112.5	D17 T22 E23 L24	D17-T20 HydrophobicContact CB-CG2 3.95Å; D17-T20 PolarHBondContact N-OG1 2.98Å; D17-T20 WeakPolarHBondContact O-CA 3.34Å; D17-T20 WeakPolarHBondContact O-CB 3.44Å; D17-T20 PolarHBondContact O-N 3.31Å; D17-T20 PolarHBondContact O-OG1 3.41Å; T20-T22 VanDerWaalsContact C-N 3.34Å; T20-E23 PolarHBondContact O-N 2.97Å; T20-L24 WeakPolarHBondContact O-CB 3.41Å; T20-L24 PolarHBondContact O-N 3.43Å
21	V	90	Very high	81.7	Confident	79 Å²	79	107.5 Å²	107.5	48%	0.479	57%	0.569	S	S	.	*	H	α-helix	trans	-65.5	-40.7	175.3	178.9	0	0	0	0	110.7	P16 D17 H19 L24 S25	P16-V21 HydrophobicContact CB-CG2 3.76Å; D17-V21 PolarHBondContact O-N 3.49Å; D17-V21 VanDerWaalsContact O-N 3.13Å; H19-V21 VanDerWaalsContact C-N 3.35Å; H19-V21 PolarHBondContact O-N 3.44Å; V21-L24 PolarHBondContact O-N 3.41Å; V21-S25 WeakPolarHBondContact O-CB 3.49Å; V21-S25 PolarHBondContact O-N 3.19Å
22	T	92.5	Very high	83.8	Confident	77 Å²	77	102.5 Å²	102.5	47%	0.472	55%	0.554	S	S	.	*	H	α-helix	trans	-65.4	-44.4	177.5	-57.3	0	0	0	0	111.4	P18 H19 T20 S25 N26	P18-T22 WeakPolarHBondContact O-CB 3.33Å; P18-T22 PolarHBondContact O-N 2.83Å; P18-T22 PolarHBondContact O-OG1 3.16Å; H19-T22 WeakPolarHBondContact O-CB 3.28Å; H19-T22 PolarHBondContact O-N 2.85Å; T20-T22 VanDerWaalsContact C-N 3.34Å; T22-S25 WeakPolarHBondContact O-CB 3.43Å; T22-S25 PolarHBondContact O-N 2.88Å; T22-N26 VanDerWaalsContact O-CG 3.24Å; T22-N26 PolarHBondContact O-N 2.93Å; T22-N26 PolarHBondContact O-ND2 3.28Å
23	E	93.1	Very high	85.9	Confident	133 Å²	133	101.2 Å²	101.2	62%	0.621	54%	0.536	S	S	*	.	H	α-helix	trans	-60.7	-45.9	175.6	-73.5	173.7	175	0	0	112	H19 T20 S25 N26 Y27	H19-E23 WeakPolarHBondContact O-CG 3.47Å; H19-E23 PolarHBondContact O-N 3.21Å; T20-E23 PolarHBondContact O-N 2.97Å; E23-S25 VanDerWaalsContact C-N 3.33Å; E23-S25 PolarHBondContact O-N 3.35Å; E23-N26 PolarHBondContact O-N 3.45Å; E23-Y27 WeakPolarHBondContact O-CB 3.48Å; E23-Y27 PolarHBondContact O-N 2.81Å
24	L	93.9	Very high	88.1	Confident	98 Å²	98	97.2 Å²	97.2	51%	0.513	52%	0.52	S	S	.	.	H	α-helix	trans	-62.2	-41.9	175.9	-179.9	62.2	0	0	0	111.4	T20 V21 Y27 M28	T20-L24 WeakPolarHBondContact O-CB 3.41Å; T20-L24 PolarHBondContact O-N 3.43Å; V21-L24 PolarHBondContact O-N 3.41Å; L24-Y27 PolarHBondContact O-N 3.35Å; L24-M28 HydrophobicContact CD1-CE 4.46Å; L24-M28 HydrophobicContact CD1-CG 4.43Å; L24-M28 HydrophobicContact CD2-CE 4.21Å; L24-M28 HydrophobicContact CG-CE 3.74Å; L24-M28 WeakPolarHBondContact O-CG 3.27Å; L24-M28 PolarHBondContact O-N 2.93Å
25	S	94.7	Very high	90	Very high	65 Å²	65	99 Å²	99	46%	0.455	51%	0.51	S	S	.	.	H	α-helix	trans	-60.8	-45.5	175.8	-171.7	0	0	0	0	111.6	V21 T22 E23 Y27 M28 Q29	V21-S25 WeakPolarHBondContact O-CB 3.49Å; V21-S25 PolarHBondContact O-N 3.19Å; T22-S25 WeakPolarHBondContact O-CB 3.43Å; T22-S25 PolarHBondContact O-N 2.88Å; E23-S25 VanDerWaalsContact C-N 3.33Å; E23-S25 PolarHBondContact O-N 3.35Å; S25-Y27 VanDerWaalsContact C-N 3.34Å; S25-Y27 PolarHBondContact O-N 3.45Å; S25-M28 PolarHBondContact O-N 3.21Å; S25-Q29 WeakPolarHBondContact O-CB 3.27Å; S25-Q29 PolarHBondContact O-N 3Å
26	N	95.5	Very high	91.8	Very high	93 Å²	93	97.5 Å²	97.5	50%	0.497	50%	0.501	S	S	.	.	H	α-helix	trans	-63	-41.8	176.8	-69.9	-28.2	0	0	0	111.5	T22 E23 Q29 N30	T22-N26 VanDerWaalsContact O-CG 3.24Å; T22-N26 PolarHBondContact O-N 2.93Å; T22-N26 PolarHBondContact O-ND2 3.28Å; E23-N26 PolarHBondContact O-N 3.45Å; N26-Q29 PolarHBondContact O-N 3.25Å; N26-N30 VanDerWaalsContact O-CG 3.28Å; N26-N30 PolarHBondContact O-N 3.01Å; N26-N30 PolarHBondContact O-ND2 3.48Å
27	Y	95.4	Very high	93.3	Very high	151 Å²	151	97 Å²	97	59%	0.592	49%	0.493	S	S	*	.	H	α-helix	trans	-61.4	-48.2	175.2	179.1	-99.7	0	0	0	111.7	E23 L24 S25 Q29 N30 I31	E23-Y27 WeakPolarHBondContact O-CB 3.48Å; E23-Y27 PolarHBondContact O-N 2.81Å; L24-Y27 PolarHBondContact O-N 3.35Å; S25-Y27 VanDerWaalsContact C-N 3.34Å; S25-Y27 PolarHBondContact O-N 3.45Å; Y27-Q29 VanDerWaalsContact C-N 3.34Å; Y27-Q29 PolarHBondContact O-N 3.01Å; Y27-N30 WeakPolarHBondContact O-CB 3.46Å; Y27-N30 PolarHBondContact O-N 2.93Å; Y27-I31 HydrophobicContact CD1-CG1 4.32Å; Y27-I31 HydrophobicContact CE1-CD1 4.45Å; Y27-I31 HydrophobicContact CE1-CG1 3.89Å; Y27-I31 HydrophobicContact CE2-CD1 4.38Å; Y27-I31 HydrophobicContact CE2-CG1 4.41Å; Y27-I31 WeakPolarHBondContact O-CG1 3.5Å; Y27-I31 PolarHBondContact O-N 3.08Å
28	M	95.4	Very high	94.4	Very high	86 Å²	86	97.1 Å²	97.1	42%	0.424	50%	0.497	S	S	.	.	H	α-helix	trans	-60.2	-43.6	176.7	-74.6	-170.5	-74.2	0	0	111.7	L24 S25 N30 I31 F32	L24-M28 HydrophobicContact CD1-CE 4.46Å; L24-M28 HydrophobicContact CD1-CG 4.43Å; L24-M28 HydrophobicContact CD2-CE 4.21Å; L24-M28 HydrophobicContact CG-CE 3.74Å; L24-M28 WeakPolarHBondContact O-CG 3.27Å; L24-M28 PolarHBondContact O-N 2.93Å; S25-M28 PolarHBondContact O-N 3.21Å; M28-N30 VanDerWaalsContact C-N 3.28Å; M28-N30 PolarHBondContact O-N 2.91Å; M28-I31 PolarHBondContact O-N 2.96Å; M28-I31 VanDerWaalsContact O-N 3.14Å; M28-F32 HydrophobicContact CB-CD2 4.39Å; M28-F32 HydrophobicContact CB-CE2 4.28Å; M28-F32 WeakPolarHBondContact O-CD2 3.32Å; M28-F32 PolarHBondContact O-N 2.89Å
29	Q	97.3	Very high	95.3	Very high	116 Å²	116	98.4 Å²	98.4	54%	0.542	50%	0.498	S	S	.	.	H	α-helix	trans	-58.6	-41.2	176.6	-172.8	61	58.1	0	0	111.8	S25 N26 Y27 F32 Q33	S25-Q29 WeakPolarHBondContact O-CB 3.27Å; S25-Q29 PolarHBondContact O-N 3Å; N26-Q29 PolarHBondContact O-N 3.25Å; Y27-Q29 VanDerWaalsContact C-N 3.34Å; Y27-Q29 PolarHBondContact O-N 3.01Å; Q29-F32 PolarHBondContact O-N 3.27Å; Q29-Q33 WeakPolarHBondContact O-CB 3.42Å; Q29-Q33 PolarHBondContact O-N 2.83Å
30	N	97.3	Very high	95.9	Very high	95 Å²	95	97 Å²	97	51%	0.508	49%	0.492	S	S	.	.	H	α-helix	trans	-65.4	-38.2	176	-71.3	-29.4	0	0	0	112.6	N26 Y27 M28 Q34	N26-N30 VanDerWaalsContact O-CG 3.28Å; N26-N30 PolarHBondContact O-N 3.01Å; N26-N30 PolarHBondContact O-ND2 3.48Å; Y27-N30 WeakPolarHBondContact O-CB 3.46Å; Y27-N30 PolarHBondContact O-N 2.93Å; M28-N30 VanDerWaalsContact C-N 3.28Å; M28-N30 PolarHBondContact O-N 2.91Å; N30-Q34 WeakPolarHBondContact O-CG 3.47Å; N30-Q34 PolarHBondContact O-N 2.94Å; N30-Q34 VanDerWaalsContact O-N 3.1Å; N30-Q34 PolarHBondContact O-NE2 3.04Å
31	I	97.8	Very high	96.5	Very high	58 Å²	58	98.7 Å²	98.7	30%	0.297	50%	0.495	S	S	.	.	H	α-helix	trans	-68.6	-44.8	176.5	-64.6	-61.9	0	0	0	110.8	Y27 M28 Q33 Q34 M35	Y27-I31 HydrophobicContact CD1-CG1 4.32Å; Y27-I31 HydrophobicContact CE1-CD1 4.45Å; Y27-I31 HydrophobicContact CE1-CG1 3.89Å; Y27-I31 HydrophobicContact CE2-CD1 4.38Å; Y27-I31 HydrophobicContact CE2-CG1 4.41Å; Y27-I31 WeakPolarHBondContact O-CG1 3.5Å; Y27-I31 PolarHBondContact O-N 3.08Å; M28-I31 PolarHBondContact O-N 2.96Å; M28-I31 VanDerWaalsContact O-N 3.14Å; I31-Q33 VanDerWaalsContact C-N 3.29Å; I31-Q33 PolarHBondContact O-N 3.24Å; I31-Q34 PolarHBondContact O-N 3.45Å; I31-M35 HydrophobicContact CG2-CG 4.48Å; I31-M35 HydrophobicContact CG2-SD 4.34Å; I31-M35 WeakPolarHBondContact O-CG 3.46Å; I31-M35 PolarHBondContact O-N 3.26Å
32	F	97.8	Very high	96.9	Very high	131 Å²	131	98.2 Å²	98.2	58%	0.575	49%	0.492	S	S	*	.	H	α-helix	trans	-60.5	-40.4	176.4	-77.8	-60.3	0	0	0	111.9	M28 Q29 M35 Q36	M28-F32 HydrophobicContact CB-CD2 4.39Å; M28-F32 HydrophobicContact CB-CE2 4.28Å; M28-F32 WeakPolarHBondContact O-CD2 3.32Å; M28-F32 PolarHBondContact O-N 2.89Å; Q29-F32 PolarHBondContact O-N 3.27Å; F32-M35 PolarHBondContact O-N 2.98Å; F32-Q36 WeakPolarHBondContact O-CB 3.48Å; F32-Q36 PolarHBondContact O-N 2.95Å
33	Q	98.2	Very high	97.2	Very high	79 Å²	79	97.4 Å²	97.4	37%	0.369	49%	0.49	S	S	.	.	H	α-helix	trans	-61.3	-47.9	174.8	-170.7	61.6	58.6	0	0	111.4	Q29 I31 M35 Q36 D37	Q29-Q33 WeakPolarHBondContact O-CB 3.42Å; Q29-Q33 PolarHBondContact O-N 2.83Å; I31-Q33 VanDerWaalsContact C-N 3.29Å; I31-Q33 PolarHBondContact O-N 3.24Å; Q33-M35 VanDerWaalsContact C-N 3.3Å; Q33-M35 PolarHBondContact O-N 3.45Å; Q33-Q36 WeakPolarHBondContact O-CB 3.35Å; Q33-Q36 PolarHBondContact O-N 3.46Å; Q33-Q36 VanDerWaalsContact O-N 3.17Å; Q33-D37 PolarHBondContact NE2-OD1 3.23Å; Q33-D37 WeakPolarHBondContact O-CB 3.46Å; Q33-D37 PolarHBondContact O-N 3.23Å
34	Q	98.1	Very high	97.4	Very high	112 Å²	112	95.9 Å²	95.9	52%	0.523	48%	0.483	S	S	.	.	H	α-helix	trans	-61	-38.8	177.6	-73.9	171.2	58.8	0	0	112.8	N30 I31 T38	N30-Q34 WeakPolarHBondContact O-CG 3.47Å; N30-Q34 PolarHBondContact O-N 2.94Å; N30-Q34 VanDerWaalsContact O-N 3.1Å; N30-Q34 PolarHBondContact O-NE2 3.04Å; I31-Q34 PolarHBondContact O-N 3.45Å; Q34-T38 WeakPolarHBondContact O-CB 3.39Å; Q34-T38 PolarHBondContact O-N 2.89Å; Q34-T38 PolarHBondContact O-OG1 2.94Å
35	M	98	Very high	97.7	Very high	106 Å²	106	97.9 Å²	97.9	52%	0.522	49%	0.487	S	S	.	.	H	α-helix	trans	-64.8	-44.9	175	-73.4	-174.9	68.7	0	0	111.4	I31 F32 Q33 T38 L39	I31-M35 HydrophobicContact CG2-CG 4.48Å; I31-M35 HydrophobicContact CG2-SD 4.34Å; I31-M35 WeakPolarHBondContact O-CG 3.46Å; I31-M35 PolarHBondContact O-N 3.26Å; F32-M35 PolarHBondContact O-N 2.98Å; Q33-M35 VanDerWaalsContact C-N 3.3Å; Q33-M35 PolarHBondContact O-N 3.45Å; M35-T38 PolarHBondContact O-N 3.24Å; M35-L39 WeakPolarHBondContact O-CB 3.35Å; M35-L39 VanDerWaalsContact O-CG 3.29Å; M35-L39 WeakPolarHBondContact O-CG 3.37Å; M35-L39 PolarHBondContact O-N 3.18Å
36	Q	98.5	Very high	97.9	Very high	117 Å²	117	99 Å²	99	55%	0.547	49%	0.487	S	S	.	.	H	α-helix	trans	-60.9	-45.9	176.7	-174.2	173.6	18.9	0	0	111.2	F32 Q33 T38 L39 Q40	F32-Q36 WeakPolarHBondContact O-CB 3.48Å; F32-Q36 PolarHBondContact O-N 2.95Å; Q33-Q36 WeakPolarHBondContact O-CB 3.35Å; Q33-Q36 PolarHBondContact O-N 3.46Å; Q33-Q36 VanDerWaalsContact O-N 3.17Å; Q36-T38 VanDerWaalsContact C-N 3.31Å; Q36-T38 PolarHBondContact O-N 3.04Å; Q36-L39 PolarHBondContact O-N 2.95Å; Q36-Q40 VanDerWaalsContact O-CB 3.26Å; Q36-Q40 WeakPolarHBondContact O-CB 3.27Å; Q36-Q40 PolarHBondContact O-N 3.06Å
37	D	98.6	Very high	98	Very high	71 Å²	71	97.6 Å²	97.6	38%	0.38	48%	0.482	S	S	.	.	H	α-helix	trans	-62.2	-40.7	178.3	-63.9	-15	0	0	0	111.3	Q33 Q41	Q33-D37 PolarHBondContact NE2-OD1 3.23Å; Q33-D37 WeakPolarHBondContact O-CB 3.46Å; Q33-D37 PolarHBondContact O-N 3.23Å; D37-Q41 WeakPolarHBondContact O-CB 3.39Å; D37-Q41 VanDerWaalsContact O-CG 3.23Å; D37-Q41 WeakPolarHBondContact O-CG 3.35Å; D37-Q41 PolarHBondContact O-N 3.1Å; D37-Q41 PolarHBondContact O-NE2 3.07Å
38	T	98.4	Very high	98.2	Very high	82 Å²	82	93.6 Å²	93.6	50%	0.503	47%	0.474	S	S	.	.	H	α-helix	trans	-66.1	-47	177.4	-59.2	0	0	0	0	111	Q34 M35 Q36 Q40 Q41 T42	Q34-T38 WeakPolarHBondContact O-CB 3.39Å; Q34-T38 PolarHBondContact O-N 2.89Å; Q34-T38 PolarHBondContact O-OG1 2.94Å; M35-T38 PolarHBondContact O-N 3.24Å; Q36-T38 VanDerWaalsContact C-N 3.31Å; Q36-T38 PolarHBondContact O-N 3.04Å; T38-Q40 VanDerWaalsContact C-N 3.33Å; T38-Q40 PolarHBondContact O-N 3.33Å; T38-Q41 PolarHBondContact O-N 3.38Å; T38-T42 PolarHBondContact O-N 2.86Å; T38-T42 PolarHBondContact O-OG1 3.36Å; T38-T42 VanDerWaalsContact O-OG1 3.12Å
39	L	98.6	Very high	98.3	Very high	119 Å²	119	96.7 Å²	96.7	62%	0.623	48%	0.481	S	S	*	.	H	α-helix	trans	-62.4	-41.7	178.1	-72.6	172.1	0	0	0	111.5	M35 Q36 T42 S43	M35-L39 WeakPolarHBondContact O-CB 3.35Å; M35-L39 VanDerWaalsContact O-CG 3.29Å; M35-L39 WeakPolarHBondContact O-CG 3.37Å; M35-L39 PolarHBondContact O-N 3.18Å; Q36-L39 PolarHBondContact O-N 2.95Å; L39-T42 PolarHBondContact O-N 3.02Å; L39-S43 WeakPolarHBondContact O-CB 3.44Å; L39-S43 PolarHBondContact O-N 3.11Å
40	Q	98.6	Very high	98.4	Very high	103 Å²	103	96.2 Å²	96.2	48%	0.481	48%	0.481	S	S	.	.	H	α-helix	trans	-61.4	-49.6	176.7	-176.7	58.3	45.6	0	0	111	Q36 T38 T42 S43 E44	Q36-Q40 VanDerWaalsContact O-CB 3.26Å; Q36-Q40 WeakPolarHBondContact O-CB 3.27Å; Q36-Q40 PolarHBondContact O-N 3.06Å; T38-Q40 VanDerWaalsContact C-N 3.33Å; T38-Q40 PolarHBondContact O-N 3.33Å; Q40-T42 VanDerWaalsContact C-N 3.33Å; Q40-T42 PolarHBondContact O-N 2.92Å; Q40-S43 WeakPolarHBondContact O-CB 3.26Å; Q40-S43 PolarHBondContact O-N 2.91Å; Q40-E44 WeakPolarHBondContact CG-OE1 3.29Å; Q40-E44 PolarHBondContact NE2-OE1 3.3Å; Q40-E44 WeakPolarHBondContact O-CG 3.42Å; Q40-E44 PolarHBondContact O-N 3.46Å
41	Q	98.5	Very high	98.4	Very high	102 Å²	102	97.6 Å²	97.6	48%	0.477	48%	0.484	S	S	.	.	H	α-helix	trans	-61.1	-39.1	176.6	-74.7	173	59.8	0	0	112.9	D37 T38 K45	D37-Q41 WeakPolarHBondContact O-CB 3.39Å; D37-Q41 VanDerWaalsContact O-CG 3.23Å; D37-Q41 WeakPolarHBondContact O-CG 3.35Å; D37-Q41 PolarHBondContact O-N 3.1Å; D37-Q41 PolarHBondContact O-NE2 3.07Å; T38-Q41 PolarHBondContact O-N 3.38Å; Q41-K45 WeakPolarHBondContact O-CG 3.45Å; Q41-K45 PolarHBondContact O-N 2.88Å; Q41-K45 VanDerWaalsContact O-N 3.12Å
42	T	98.4	Very high	98.5	Very high	68 Å²	68	99.6 Å²	99.6	42%	0.417	49%	0.492	S	S	.	.	H	α-helix	trans	-66.6	-43	175.5	-64.3	0	0	0	0	111.1	T38 L39 Q40 E44 K45 I46	T38-T42 PolarHBondContact O-N 2.86Å; T38-T42 PolarHBondContact O-OG1 3.36Å; T38-T42 VanDerWaalsContact O-OG1 3.12Å; L39-T42 PolarHBondContact O-N 3.02Å; Q40-T42 VanDerWaalsContact C-N 3.33Å; Q40-T42 PolarHBondContact O-N 2.92Å; T42-E44 VanDerWaalsContact C-N 3.35Å; T42-E44 PolarHBondContact O-N 3.12Å; T42-K45 PolarHBondContact O-N 3.18Å; T42-I46 HydrophobicContact CG2-CD1 3.98Å; T42-I46 WeakPolarHBondContact O-CG1 3.46Å; T42-I46 PolarHBondContact O-N 2.93Å
43	S	98.6	Very high	98.5	Very high	61 Å²	61	98 Å²	98	43%	0.427	49%	0.488	S	S	.	.	H	α-helix	trans	-59.9	-45.4	176.5	-169.3	0	0	0	0	111.2	L39 Q40 K45 I46 T47	L39-S43 WeakPolarHBondContact O-CB 3.44Å; L39-S43 PolarHBondContact O-N 3.11Å; Q40-S43 WeakPolarHBondContact O-CB 3.26Å; Q40-S43 PolarHBondContact O-N 2.91Å; S43-K45 PolarHBondContact O-N 3.49Å; S43-I46 PolarHBondContact O-N 3.12Å; S43-T47 PolarHBondContact O-N 3.42Å; S43-T47 PolarHBondContact O-OG1 2.87Å; S43-T47 VanDerWaalsContact O-OG1 3.07Å
44	E	98.7	Very high	98.5	Very high	101 Å²	101	95.6 Å²	95.6	47%	0.472	48%	0.484	S	S	.	.	H	α-helix	trans	-59.5	-45.4	177	-74.3	166.7	-169.9	0	0	111.9	Q40 T42 I46 T47 T48	Q40-E44 WeakPolarHBondContact CG-OE1 3.29Å; Q40-E44 PolarHBondContact NE2-OE1 3.3Å; Q40-E44 WeakPolarHBondContact O-CG 3.42Å; Q40-E44 PolarHBondContact O-N 3.46Å; T42-E44 VanDerWaalsContact C-N 3.35Å; T42-E44 PolarHBondContact O-N 3.12Å; E44-I46 VanDerWaalsContact C-N 3.31Å; E44-I46 PolarHBondContact O-N 3.38Å; E44-T47 PolarHBondContact O-N 2.85Å; E44-T48 PolarHBondContact O-N 3.38Å; E44-T48 PolarHBondContact O-OG1 3.32Å; E44-T48 VanDerWaalsContact O-OG1 3.11Å
45	K	98.6	Very high	98.6	Very high	139 Å²	139	94 Å²	94	60%	0.604	49%	0.485	S	S	*	.	H	α-helix	trans	-60.8	-39.4	175.5	-72.6	171.7	-176.2	173.1	0	112.6	Q41 T42 S43 R49	Q41-K45 WeakPolarHBondContact O-CG 3.45Å; Q41-K45 PolarHBondContact O-N 2.88Å; Q41-K45 VanDerWaalsContact O-N 3.12Å; T42-K45 PolarHBondContact O-N 3.18Å; S43-K45 PolarHBondContact O-N 3.49Å; K45-R49 WeakPolarHBondContact O-CG 3.41Å; K45-R49 PolarHBondContact O-N 3.47Å; K45-R49 VanDerWaalsContact O-N 3.1Å
46	I	98.6	Very high	98.6	Very high	89 Å²	89	95.4 Å²	95.4	46%	0.456	49%	0.488	S	S	.	.	H	α-helix	trans	-66	-46.5	176.7	-69	167.2	0	0	0	109.8	T42 S43 E44 R49 I50	T42-I46 HydrophobicContact CG2-CD1 3.98Å; T42-I46 WeakPolarHBondContact O-CG1 3.46Å; T42-I46 PolarHBondContact O-N 2.93Å; S43-I46 PolarHBondContact O-N 3.12Å; E44-I46 VanDerWaalsContact C-N 3.31Å; E44-I46 PolarHBondContact O-N 3.38Å; I46-R49 PolarHBondContact O-N 3.32Å; I46-I50 HydrophobicContact CG2-CD1 3.79Å; I46-I50 HydrophobicContact CG2-CG1 4.44Å; I46-I50 WeakPolarHBondContact O-CG1 3.23Å; I46-I50 PolarHBondContact O-N 2.92Å
47	T	98.6	Very high	98.6	Very high	64 Å²	64	93.8 Å²	93.8	39%	0.393	48%	0.482	S	S	.	.	H	α-helix	trans	-56.8	-51	176.2	-60	0	0	0	0	111.3	S43 E44 R49 I50 E51	S43-T47 PolarHBondContact O-N 3.42Å; S43-T47 PolarHBondContact O-OG1 2.87Å; S43-T47 VanDerWaalsContact O-OG1 3.07Å; E44-T47 PolarHBondContact O-N 2.85Å; T47-R49 VanDerWaalsContact C-N 3.3Å; T47-R49 PolarHBondContact O-N 3.35Å; T47-I50 WeakPolarHBondContact O-CB 3.37Å; T47-I50 PolarHBondContact O-N 3.35Å; T47-E51 HydrophobicContact CG2-CG 4.48Å; T47-E51 WeakPolarHBondContact O-CG 3.41Å; T47-E51 PolarHBondContact O-N 2.96Å
48	T	98.7	Very high	98.6	Very high	67 Å²	67	95.1 Å²	95.1	41%	0.411	49%	0.489	S	S	.	.	H	α-helix	trans	-57.8	-42	177.7	-57.7	0	0	0	0	112	E44 I50 E51 E52	E44-T48 PolarHBondContact O-N 3.38Å; E44-T48 PolarHBondContact O-OG1 3.32Å; E44-T48 VanDerWaalsContact O-OG1 3.11Å; T48-I50 VanDerWaalsContact C-N 3.34Å; T48-I50 PolarHBondContact O-N 2.9Å; T48-E51 PolarHBondContact O-N 2.85Å; T48-E52 WeakPolarHBondContact O-CG 3.39Å; T48-E52 PolarHBondContact O-N 3.17Å
49	R	98.6	Very high	98.6	Very high	151 Å²	151	94.3 Å²	94.3	57%	0.57	49%	0.487	S	S	*	.	H	α-helix	trans	-65.4	-36.5	176.2	-77.9	-169	63.6	-110.3	-9.6	113.1	K45 I46 T47 M53	K45-R49 WeakPolarHBondContact O-CG 3.41Å; K45-R49 PolarHBondContact O-N 3.47Å; K45-R49 VanDerWaalsContact O-N 3.1Å; I46-R49 PolarHBondContact O-N 3.32Å; T47-R49 VanDerWaalsContact C-N 3.3Å; T47-R49 PolarHBondContact O-N 3.35Å; R49-M53 WeakPolarHBondContact O-CB 3.11Å; R49-M53 VanDerWaalsContact O-CG 3.27Å; R49-M53 WeakPolarHBondContact O-CG 3.5Å; R49-M53 PolarHBondContact O-N 2.91Å
50	I	98.7	Very high	98.6	Very high	105 Å²	105	93.9 Å²	93.9	54%	0.538	49%	0.485	S	S	.	.	H	α-helix	trans	-66.6	-42.5	175.9	-70.4	168.6	0	0	0	110	I46 T47 T48 M53 G54	I46-I50 HydrophobicContact CG2-CD1 3.79Å; I46-I50 HydrophobicContact CG2-CG1 4.44Å; I46-I50 WeakPolarHBondContact O-CG1 3.23Å; I46-I50 PolarHBondContact O-N 2.92Å; T47-I50 WeakPolarHBondContact O-CB 3.37Å; T47-I50 PolarHBondContact O-N 3.35Å; T48-I50 VanDerWaalsContact C-N 3.34Å; T48-I50 PolarHBondContact O-N 2.9Å; I50-M53 PolarHBondContact O-N 3.33Å; I50-G54 PolarHBondContact O-N 2.97Å
51	E	98.6	Very high	98.5	Very high	124 Å²	124	94.9 Å²	94.9	58%	0.579	49%	0.49	S	S	*	.	H	α-helix	trans	-61	-45.1	175.7	-68.9	169.4	168	0	0	111.7	T47 T48 M53 G54 S55	T47-E51 HydrophobicContact CG2-CG 4.48Å; T47-E51 WeakPolarHBondContact O-CG 3.41Å; T47-E51 PolarHBondContact O-N 2.96Å; T48-E51 PolarHBondContact O-N 2.85Å; E51-M53 VanDerWaalsContact C-N 3.34Å; E51-M53 PolarHBondContact O-N 2.79Å; E51-G54 PolarHBondContact O-N 2.86Å; E51-S55 PolarHBondContact O-N 2.88Å
52	E	98.7	Very high	98.5	Very high	101 Å²	101	96.4 Å²	96.4	47%	0.472	50%	0.495	S	S	.	.	H	α-helix	trans	-60.8	-41.6	174	-73.6	176.7	-174.9	0	0	112.3	T48 K56	T48-E52 WeakPolarHBondContact O-CG 3.39Å; T48-E52 PolarHBondContact O-N 3.17Å; E52-K56 WeakPolarHBondContact O-CG 3.43Å; E52-K56 PolarHBondContact O-N 3.14Å
53	M	98.6	Very high	98.4	Very high	98 Å²	98	97 Å²	97	48%	0.483	50%	0.495	S	S	.	.	H	α-helix	trans	-64.5	-42.4	175.6	-75.7	176.7	60.7	0	0	111.2	R49 I50 E51 K56 I57	R49-M53 WeakPolarHBondContact O-CB 3.11Å; R49-M53 VanDerWaalsContact O-CG 3.27Å; R49-M53 WeakPolarHBondContact O-CG 3.5Å; R49-M53 PolarHBondContact O-N 2.91Å; I50-M53 PolarHBondContact O-N 3.33Å; E51-M53 VanDerWaalsContact C-N 3.34Å; E51-M53 PolarHBondContact O-N 2.79Å; M53-K56 PolarHBondContact O-N 3.24Å; M53-I57 VanDerWaalsContact O-CG1 3.27Å; M53-I57 WeakPolarHBondContact O-CG1 3.44Å; M53-I57 PolarHBondContact O-N 3.4Å
54	G	98.6	Very high	98.3	Very high	27 Å²	27	97.9 Å²	97.9	28%	0.278	50%	0.498	S	S	.	.	H	α-helix	trans	-56.1	-52.1	173.7	0	0	0	0	0	111.7	I50 E51 K56 I57 D58	I50-G54 PolarHBondContact O-N 2.97Å; E51-G54 PolarHBondContact O-N 2.86Å; G54-K56 VanDerWaalsContact C-N 3.29Å; G54-K56 PolarHBondContact O-N 3.36Å; G54-I57 WeakPolarHBondContact O-CA 3.34Å; G54-I57 WeakPolarHBondContact O-CB 3.5Å; G54-I57 PolarHBondContact O-N 2.97Å; G54-D58 VanDerWaalsContact O-CG 3.28Å; G54-D58 PolarHBondContact O-N 3.04Å
55	S	98.6	Very high	98.1	Very high	78 Å²	78	95.4 Å²	95.4	55%	0.545	50%	0.495	S	S	.	.	H	α-helix	trans	-60.3	-36.1	178.1	178.2	0	0	0	0	113.5	E51 S59	E51-S55 PolarHBondContact O-N 2.88Å; S55-S59 WeakPolarHBondContact O-CB 3.4Å; S55-S59 PolarHBondContact O-N 3.25Å; S55-S59 VanDerWaalsContact O-N 3.08Å
56	K	98.6	Very high	98	Very high	136 Å²	136	92.3 Å²	92.3	59%	0.591	49%	0.485	S	S	*	.	H	α-helix	trans	-68	-38.9	174.1	-72.9	174.5	-172	176.7	0	111.9	E52 M53 G54 S59 L60	E52-K56 WeakPolarHBondContact O-CG 3.43Å; E52-K56 PolarHBondContact O-N 3.14Å; M53-K56 PolarHBondContact O-N 3.24Å; G54-K56 VanDerWaalsContact C-N 3.29Å; G54-K56 PolarHBondContact O-N 3.36Å; K56-S59 PolarHBondContact O-N 3.1Å; K56-L60 WeakPolarHBondContact O-CB 3.4Å; K56-L60 VanDerWaalsContact O-CG 3.27Å; K56-L60 WeakPolarHBondContact O-CG 3.45Å; K56-L60 PolarHBondContact O-N 2.87Å
57	I	98.7	Very high	97.8	Very high	83 Å²	83	93.2 Å²	93.2	43%	0.426	49%	0.49	S	S	.	.	H	α-helix	trans	-63.1	-49.1	175.1	-69.3	163.6	0	0	0	109.5	M53 G54 S59 L60 E61	M53-I57 VanDerWaalsContact O-CG1 3.27Å; M53-I57 WeakPolarHBondContact O-CG1 3.44Å; M53-I57 PolarHBondContact O-N 3.4Å; G54-I57 WeakPolarHBondContact O-CA 3.34Å; G54-I57 WeakPolarHBondContact O-CB 3.5Å; G54-I57 PolarHBondContact O-N 2.97Å; I57-S59 VanDerWaalsContact C-N 3.26Å; I57-S59 PolarHBondContact O-N 3.46Å; I57-L60 CarbonylContact O-C 3.57Å; I57-L60 WeakPolarHBondContact O-CA 3.46Å; I57-L60 WeakPolarHBondContact O-CB 3.46Å; I57-L60 PolarHBondContact O-N 3.22Å; I57-E61 HydrophobicContact CG2-CG 4.23Å; I57-E61 WeakPolarHBondContact O-CG 3.48Å; I57-E61 PolarHBondContact O-N 2.9Å
58	D	98.5	Very high	97.6	Very high	99 Å²	99	93.5 Å²	93.5	53%	0.529	49%	0.488	S	S	.	.	H	α-helix	trans	-56.6	-41.7	178	-59.5	-21	0	0	0	111.8	G54 E61 K62	G54-D58 VanDerWaalsContact O-CG 3.28Å; G54-D58 PolarHBondContact O-N 3.04Å; D58-E61 PolarHBondContact O-N 3.44Å; D58-K62 PolarHBondContact O-N 3.04Å
59	S	98.4	Very high	97.3	Very high	66 Å²	66	95.4 Å²	95.4	46%	0.462	50%	0.5	S	S	.	.	H	α-helix	trans	-65.8	-41	175.7	-176.7	0	0	0	0	112.3	S55 K56 I57 K62 N63	S55-S59 WeakPolarHBondContact O-CB 3.4Å; S55-S59 PolarHBondContact O-N 3.25Å; S55-S59 VanDerWaalsContact O-N 3.08Å; K56-S59 PolarHBondContact O-N 3.1Å; I57-S59 VanDerWaalsContact C-N 3.26Å; I57-S59 PolarHBondContact O-N 3.46Å; S59-K62 PolarHBondContact O-N 3.5Å; S59-N63 WeakPolarHBondContact O-CB 3.42Å; S59-N63 PolarHBondContact O-N 2.89Å; S59-N63 PolarHBondContact O-ND2 3.32Å
60	L	98.3	Very high	97	Very high	110 Å²	110	95.5 Å²	95.5	58%	0.576	51%	0.507	S	S	*	.	H	α-helix	trans	-64.9	-44	175	-74.5	171.3	0	0	0	111.6	K56 I57 K62 N63 V64	K56-L60 WeakPolarHBondContact O-CB 3.4Å; K56-L60 VanDerWaalsContact O-CG 3.27Å; K56-L60 WeakPolarHBondContact O-CG 3.45Å; K56-L60 PolarHBondContact O-N 2.87Å; I57-L60 CarbonylContact O-C 3.57Å; I57-L60 WeakPolarHBondContact O-CA 3.46Å; I57-L60 WeakPolarHBondContact O-CB 3.46Å; I57-L60 PolarHBondContact O-N 3.22Å; L60-K62 VanDerWaalsContact C-N 3.32Å; L60-K62 PolarHBondContact O-N 3.19Å; L60-N63 PolarHBondContact O-N 3.4Å; L60-V64 WeakPolarHBondContact O-CG2 3.36Å; L60-V64 PolarHBondContact O-N 3.13Å
61	E	97.7	Very high	96.6	Very high	123 Å²	123	94 Å²	94	58%	0.575	51%	0.51	S	S	*	.	H	α-helix	trans	-57.8	-45.4	175.5	-72.3	-179.7	162.2	0	0	111.1	I57 D58 V64 A65	I57-E61 HydrophobicContact CG2-CG 4.23Å; I57-E61 WeakPolarHBondContact O-CG 3.48Å; I57-E61 PolarHBondContact O-N 2.9Å; D58-E61 PolarHBondContact O-N 3.44Å; E61-V64 PolarHBondContact O-N 3.35Å; E61-A65 WeakPolarHBondContact O-CB 3.44Å; E61-A65 PolarHBondContact O-N 3.22Å
62	K	97.5	Very high	96	Very high	135 Å²	135	90.8 Å²	90.8	59%	0.587	51%	0.509	S	S	*	.	H	α-helix	trans	-59.8	-49.1	173.6	176.9	171.5	178.4	160	0	112.4	D58 S59 L60 V64 A65 D66	D58-K62 PolarHBondContact O-N 3.04Å; S59-K62 PolarHBondContact O-N 3.5Å; L60-K62 VanDerWaalsContact C-N 3.32Å; L60-K62 PolarHBondContact O-N 3.19Å; K62-V64 VanDerWaalsContact C-N 3.27Å; K62-V64 PolarHBondContact O-N 3.44Å; K62-A65 PolarHBondContact O-N 2.9Å; K62-D66 PolarHBondContact O-N 3.23Å
63	N	97	Very high	95	Very high	80 Å²	80	89.9 Å²	89.9	43%	0.428	51%	0.511	S	S	.	.	H	α-helix	trans	-61	-38.3	-179.9	-69.3	-33.7	0	0	0	111.6	S59 L60 L67	S59-N63 WeakPolarHBondContact O-CB 3.42Å; S59-N63 PolarHBondContact O-N 2.89Å; S59-N63 PolarHBondContact O-ND2 3.32Å; L60-N63 PolarHBondContact O-N 3.4Å; N63-L67 WeakPolarHBondContact O-CB 3.4Å; N63-L67 VanDerWaalsContact O-CG 3.24Å; N63-L67 WeakPolarHBondContact O-CG 3.44Å; N63-L67 PolarHBondContact O-N 2.91Å
64	V	96.1	Very high	93.5	Very high	80 Å²	80	93.5 Å²	93.5	49%	0.485	53%	0.526	S	S	.	.	H	α-helix	trans	-66.3	-44.6	175.3	171.1	0	0	0	0	111	L60 E61 K62 D66 L67 M68	L60-V64 WeakPolarHBondContact O-CG2 3.36Å; L60-V64 PolarHBondContact O-N 3.13Å; E61-V64 PolarHBondContact O-N 3.35Å; K62-V64 VanDerWaalsContact C-N 3.27Å; K62-V64 PolarHBondContact O-N 3.44Å; V64-D66 VanDerWaalsContact C-N 3.32Å; V64-D66 PolarHBondContact O-N 3.29Å; V64-L67 PolarHBondContact O-N 3.19Å; V64-M68 HydrophobicContact CG1-CG 4.3Å; V64-M68 HydrophobicContact CG1-SD 4.03Å; V64-M68 WeakPolarHBondContact O-CG 3.43Å; V64-M68 PolarHBondContact O-N 3.48Å
65	A	95.1	Very high	91.9	Very high	49 Å²	49	100.3 Å²	100.3	41%	0.405	55%	0.551	S	S	.	*	H	α-helix	trans	-60.4	-41.9	176.4	0	0	0	0	0	112.2	E61 K62 M68 T69	E61-A65 WeakPolarHBondContact O-CB 3.44Å; E61-A65 PolarHBondContact O-N 3.22Å; K62-A65 PolarHBondContact O-N 2.9Å; A65-M68 PolarHBondContact O-N 3.3Å; A65-T69 WeakPolarHBondContact O-CB 3.37Å; A65-T69 PolarHBondContact O-N 2.98Å; A65-T69 PolarHBondContact O-OG1 3.47Å
66	D	95.8	Very high	89.6	Confident	73 Å²	73	103.6 Å²	103.6	39%	0.39	60%	0.597	S	S	.	*	H	α-helix	trans	-63.9	-42.3	175.6	-71.5	-20.6	0	0	0	111.1	K62 V64 T69 Q70	K62-D66 PolarHBondContact O-N 3.23Å; V64-D66 VanDerWaalsContact C-N 3.32Å; V64-D66 PolarHBondContact O-N 3.29Å; D66-T69 PolarHBondContact O-N 3.47Å; D66-Q70 WeakPolarHBondContact O-CB 3.47Å; D66-Q70 VanDerWaalsContact O-CG 3.28Å; D66-Q70 WeakPolarHBondContact O-CG 3.14Å; D66-Q70 PolarHBondContact O-N 3.17Å
67	L	95.5	Very high	89.2	Confident	108 Å²	108	102 Å²	102	57%	0.565	60%	0.598	S	S	*	*	H	α-helix	trans	-65.6	-42.2	175.6	-74.8	172.3	0	0	0	112.7	N63 V64 T69 Q70 A71	N63-L67 WeakPolarHBondContact O-CB 3.4Å; N63-L67 VanDerWaalsContact O-CG 3.24Å; N63-L67 WeakPolarHBondContact O-CG 3.44Å; N63-L67 PolarHBondContact O-N 2.91Å; V64-L67 PolarHBondContact O-N 3.19Å; L67-T69 VanDerWaalsContact C-N 3.31Å; L67-T69 PolarHBondContact O-N 2.89Å; L67-Q70 PolarHBondContact O-N 3.02Å; L67-A71 VanDerWaalsContact O-CB 3.28Å; L67-A71 WeakPolarHBondContact O-CB 3.47Å; L67-A71 PolarHBondContact O-N 3.01Å
68	M	92.4	Very high	88.7	Confident	71 Å²	71	103 Å²	103	35%	0.35	61%	0.607	S	S	.	*	H	α-helix	trans	-61.5	-42.7	176.1	-73.3	179.1	71.3	0	0	111	V64 A65 A71 G72 V73 E75	V64-M68 HydrophobicContact CG1-CG 4.3Å; V64-M68 HydrophobicContact CG1-SD 4.03Å; V64-M68 WeakPolarHBondContact O-CG 3.43Å; V64-M68 PolarHBondContact O-N 3.48Å; A65-M68 PolarHBondContact O-N 3.3Å; M68-A71 PolarHBondContact O-N 3.22Å; M68-G72 PolarHBondContact O-N 3.34Å; M68-V73 HydrophobicContact CE-CG1 4.39Å; M68-V73 PolarHBondContact O-N 2.8Å; M68-V73 VanDerWaalsContact O-N 3.07Å; M68-E75 HydrophobicContact CE-CG 4.38Å
69	T	93.3	Very high	88.1	Confident	107 Å²	107	103.2 Å²	103.2	66%	0.656	61%	0.611	S	S	*	*	H	α-helix	trans	-61.5	-46.6	174.6	-57.3	0	0	0	0	111.3	A65 D66 L67 G72	A65-T69 WeakPolarHBondContact O-CB 3.37Å; A65-T69 PolarHBondContact O-N 2.98Å; A65-T69 PolarHBondContact O-OG1 3.47Å; D66-T69 PolarHBondContact O-N 3.47Å; L67-T69 VanDerWaalsContact C-N 3.31Å; L67-T69 PolarHBondContact O-N 2.89Å; T69-G72 PolarHBondContact O-N 2.76Å; T69-G72 VanDerWaalsContact O-N 3.16Å
70	Q	92.1	Very high	87.5	Confident	153 Å²	153	105.4 Å²	105.4	72%	0.715	62%	0.62	S	S	*	*	H	α-helix	trans	-66	-36.7	178.5	-75	174.4	42	0	0	113.2	D66 L67 G72	D66-Q70 WeakPolarHBondContact O-CB 3.47Å; D66-Q70 VanDerWaalsContact O-CG 3.28Å; D66-Q70 WeakPolarHBondContact O-CG 3.14Å; D66-Q70 PolarHBondContact O-N 3.17Å; L67-Q70 PolarHBondContact O-N 3.02Å; Q70-G72 PolarHBondContact O-N 2.73Å
71	A	91.7	Very high	86.8	Confident	74 Å²	74	105.1 Å²	105.1	61%	0.612	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71	-6	176.4	0	0	0	0	0	112.8	L67 M68 V73	L67-A71 VanDerWaalsContact O-CB 3.28Å; L67-A71 WeakPolarHBondContact O-CB 3.47Å; L67-A71 PolarHBondContact O-N 3.01Å; M68-A71 PolarHBondContact O-N 3.22Å; A71-V73 HydrophobicContact CB-CG2 3.91Å; A71-V73 PolarHBondContact O-N 2.62Å
72	G	84.5	Confident	86.1	Confident	55 Å²	55	103.9 Å²	103.9	57%	0.567	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	67.9	17.9	-176.1	0	0	0	0	0	112.9	M68 T69 Q70 H74	M68-G72 PolarHBondContact O-N 3.34Å; T69-G72 PolarHBondContact O-N 2.76Å; T69-G72 VanDerWaalsContact O-N 3.16Å; Q70-G72 PolarHBondContact O-N 2.73Å; G72-H74 PolarHBondContact O-N 3.01Å
73	V	77.3	Confident	85.3	Confident	83 Å²	83	101.7 Å²	101.7	50%	0.503	63%	0.628	S	S	.	*			trans	-77.2	78.7	173	-175	0	0	0	0	106.7	M68 A71 E75	M68-V73 HydrophobicContact CE-CG1 4.39Å; M68-V73 PolarHBondContact O-N 2.8Å; M68-V73 VanDerWaalsContact O-N 3.07Å; A71-V73 HydrophobicContact CB-CG2 3.91Å; A71-V73 PolarHBondContact O-N 2.62Å; V73-E75 PolarHBondContact O-N 3.44Å
74	H	67.5	Low	84.4	Confident	173 Å²	173	103.4 Å²	103.4	80%	0.801	64%	0.644	S	S	*	*			trans	-66	121.5	155.7	-98.5	53	0	0	0	106.2	G72 G76	G72-H74 PolarHBondContact O-N 3.01Å; H74-G76 VanDerWaalsContact C-N 3.34Å; H74-G76 PolarHBondContact O-N 3.03Å
75	E	65.2	Low	83.4	Confident	170 Å²	170	105.3 Å²	105.3	79%	0.794	66%	0.657	S	S	*	*			trans	-55.5	108.3	158.9	-65	-168.5	141.5	0	0	106.2	M68 V73	M68-E75 HydrophobicContact CE-CG 4.38Å; V73-E75 PolarHBondContact O-N 3.44Å
76	G	50.8	Low	82.4	Confident	148 Å²	148	110.5 Å²	110.5	100%	1.526	68%	0.68	S	S	*	*			trans	-76.2	0	168.6	0	0	0	0	0	109.8	H74	H74-G76 VanDerWaalsContact C-N 3.34Å; H74-G76 PolarHBondContact O-N 3.03Å

Retrieved 76 of 76 residues in 307.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).