A0A5K4F7V6_SCHMA Loading...

AGC-kinase C-terminal domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4F7V6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 104 aa.

						>A0A5K4F7V6_SCHMA|A0A5K4F7V6
MDASFLLLQKDKINRLGSENDFEEISKHRFFRDIDWIKLLERKLTAPFLPSVTSSTDTRNISPEFVNSSVPNSLICSVMRARNHHGIDETFSGFSYVPTKNIHS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	74.9	Confident	92.4	Very high	162 Å²	162	94 Å²	94	80%	0.798	47%	0.466	S	S	*	.				0	137.1	0	-66.7	-176.7	-165.4	0	0	110.3	L6 H28 R29	M1-L6 HydrophobicContact CB-CD1 4.38Å; M1-L6 HydrophobicContact CB-CD2 4.21Å; M1-L6 HydrophobicContact CB-CG 4.26Å; M1-L6 HydrophobicContact SD-CD2 4.02Å; M1-H28 PolarHBondContact O-NE2 3.03Å; M1-R29 PolarHBondContact O-NH1 3.49Å; M1-R29 PolarHBondContact O-NH2 3.34Å
2	D	89	Confident	92.7	Very high	72 Å²	72	98.4 Å²	98.4	39%	0.385	48%	0.481	S	S	.	.			trans	-60.1	147.5	178.4	-174.6	20.2	0	0	0	111.4	S4 F5 L6	D2-S4 PolarHBondContact O-N 3.17Å; D2-S4 WeakPolarHBondContact OD2-CB 3.47Å; D2-S4 PolarHBondContact OD2-OG 3.31Å; D2-F5 HydrophobicContact CB-CD2 3.94Å; D2-F5 HydrophobicContact CB-CE2 4.49Å; D2-F5 PolarHBondContact O-N 3.08Å; D2-L6 PolarHBondContact O-N 2.94Å
3	A	91	Very high	93	Very high	3 Å²	3	98.6 Å²	98.6	3%	0.025	48%	0.484	C	S	.	.	H	α-helix	trans	-59.8	-36.6	179.7	0	0	0	0	0	111.3	F5 L6 L7 F30	A3-F5 PolarHBondContact O-N 3.3Å; A3-L6 PolarHBondContact O-N 2.88Å; A3-L7 HydrophobicContact CB-CD1 4.43Å; A3-L7 WeakPolarHBondContact O-CB 3.37Å; A3-L7 WeakPolarHBondContact O-CG 3.23Å; A3-L7 PolarHBondContact O-N 3.13Å; A3-F30 HydrophobicContact CB-CB 3.77Å; A3-F30 HydrophobicContact CB-CD1 4.22Å; A3-F30 HydrophobicContact CB-CD2 4.48Å; A3-F30 HydrophobicContact CB-CG 3.91Å
4	S	90.9	Very high	93.1	Very high	49 Å²	49	99.1 Å²	99.1	34%	0.343	49%	0.489	S	S	.	.	H	α-helix	trans	-56.6	-47	179.7	66.1	0	0	0	0	112.5	D2 L6 L7 L8	D2-S4 PolarHBondContact O-N 3.17Å; D2-S4 WeakPolarHBondContact OD2-CB 3.47Å; D2-S4 PolarHBondContact OD2-OG 3.31Å; S4-L6 VanDerWaalsContact C-N 3.34Å; S4-L6 PolarHBondContact O-N 3.28Å; S4-L7 PolarHBondContact O-N 3.29Å; S4-L8 VanDerWaalsContact O-CB 3.31Å; S4-L8 WeakPolarHBondContact O-CB 3.22Å; S4-L8 WeakPolarHBondContact O-CG 3.45Å; S4-L8 PolarHBondContact O-N 3.5Å
5	F	92.8	Very high	93.4	Very high	156 Å²	156	99.4 Å²	99.4	68%	0.684	48%	0.483	S	S	*	.	H	α-helix	trans	-64.5	-36.9	177.8	-73.2	-65.2	0	0	0	112.7	D2 A3 Q9	D2-F5 HydrophobicContact CB-CD2 3.94Å; D2-F5 HydrophobicContact CB-CE2 4.49Å; D2-F5 PolarHBondContact O-N 3.08Å; A3-F5 PolarHBondContact O-N 3.3Å; F5-Q9 PolarHBondContact O-N 3.25Å
6	L	95.2	Very high	93.6	Very high	40 Å²	40	94.2 Å²	94.2	21%	0.209	46%	0.458	C	S	.	.	H	α-helix	trans	-76.3	-37.6	-179.4	-58.1	174.7	0	0	0	111.8	M1 D2 A3 S4 Q9 R15 L16	M1-L6 HydrophobicContact CB-CD1 4.38Å; M1-L6 HydrophobicContact CB-CD2 4.21Å; M1-L6 HydrophobicContact CB-CG 4.26Å; M1-L6 HydrophobicContact SD-CD2 4.02Å; D2-L6 PolarHBondContact O-N 2.94Å; A3-L6 PolarHBondContact O-N 2.88Å; S4-L6 VanDerWaalsContact C-N 3.34Å; S4-L6 PolarHBondContact O-N 3.28Å; L6-Q9 WeakPolarHBondContact O-CB 3.37Å; L6-R15 WeakPolarHBondContact O-CA 3.22Å; L6-R15 WeakPolarHBondContact O-CG 3.46Å; L6-L16 HydrophobicContact CB-CB 3.76Å; L6-L16 HydrophobicContact CB-CD2 4.42Å; L6-L16 HydrophobicContact CD1-CD1 4.48Å; L6-L16 PolarHBondContact O-N 3.34Å
7	L	96.7	Very high	93.8	Very high	63 Å²	63	89.6 Å²	89.6	33%	0.33	44%	0.441	S	S	.	.	H	α-helix	trans	-70	-32.5	175.9	-73.5	168.3	0	0	0	112.3	A3 S4 R15 L16	A3-L7 HydrophobicContact CB-CD1 4.43Å; A3-L7 WeakPolarHBondContact O-CB 3.37Å; A3-L7 WeakPolarHBondContact O-CG 3.23Å; A3-L7 PolarHBondContact O-N 3.13Å; S4-L7 PolarHBondContact O-N 3.29Å; L7-R15 WeakPolarHBondContact O-CD 3.16Å; L7-R15 VanDerWaalsContact O-CG 3.29Å; L7-R15 WeakPolarHBondContact O-CG 3.38Å; L7-L16 HydrophobicContact CD2-CB 4.15Å; L7-L16 HydrophobicContact CD2-CD2 3.98Å; L7-L16 HydrophobicContact CD2-CG 4.42Å; L7-L16 HydrophobicContact CG-CB 4.42Å; L7-L16 HydrophobicContact CG-CD2 4.01Å
8	L	96.2	Very high	93.9	Very high	146 Å²	146	87.6 Å²	87.6	76%	0.764	44%	0.437	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.5	17.2	179.4	-59.7	178.6	0	0	0	113.1	S4 K10	S4-L8 VanDerWaalsContact O-CB 3.31Å; S4-L8 WeakPolarHBondContact O-CB 3.22Å; S4-L8 WeakPolarHBondContact O-CG 3.45Å; S4-L8 PolarHBondContact O-N 3.5Å; L8-K10 PolarHBondContact O-N 3.35Å
9	Q	96.4	Very high	94	Very high	75 Å²	75	91.1 Å²	91.1	35%	0.35	45%	0.452	S	S	.	.			trans	-57.3	129.8	174.3	-179.4	55.2	-88	0	0	110.2	F5 L6 D11 N14 R15	F5-Q9 PolarHBondContact O-N 3.25Å; L6-Q9 WeakPolarHBondContact O-CB 3.37Å; Q9-D11 WeakPolarHBondContact CG-O 3.47Å; Q9-N14 HydrophobicContact CG-CB 3.73Å; Q9-R15 HydrophobicContact CB-CB 4.11Å; Q9-R15 HydrophobicContact CB-CG 4.41Å; Q9-R15 PolarHBondContact O-NE 3.44Å; Q9-R15 PolarHBondContact O-NH2 3.11Å
10	K	97	Very high	94.1	Very high	193 Å²	193	91.7 Å²	91.7	84%	0.839	46%	0.457	S	S	*	.	S	Bend	trans	-66.7	-44.3	-174.4	-173.3	175.9	-177.7	178.4	0	111.1	L8 K12	L8-K10 PolarHBondContact O-N 3.35Å; K10-K12 PolarHBondContact O-N 3.21Å
11	D	96.6	Very high	94.1	Very high	75 Å²	75	92.8 Å²	92.8	40%	0.401	47%	0.465	S	S	.	.	S	Bend	trans	-76.2	120.4	171.9	-176.9	0.3	0	0	0	110.2	Q9 I13 N14 R15	Q9-D11 WeakPolarHBondContact CG-O 3.47Å; D11-I13 PolarHBondContact O-N 2.89Å; D11-I13 PolarHBondContact OD1-N 3.47Å; D11-I13 VanDerWaalsContact OD1-N 3.13Å; D11-N14 HydrophobicContact CB-CB 4.45Å; D11-N14 PolarHBondContact O-N 3.28Å; D11-N14 PolarHBondContact OD2-ND2 2.94Å; D11-R15 PolarHBondContact O-N 3.28Å
12	K	95.9	Very high	95.1	Very high	147 Å²	147	89.7 Å²	89.7	64%	0.639	45%	0.447	S	S	*	.	G	3₁₀ helix	trans	-61.9	-31.8	-177	67.7	177.5	-177.3	175.9	0	112.9	K10 N14 R15 S18	K10-K12 PolarHBondContact O-N 3.21Å; K12-N14 VanDerWaalsContact C-N 3.27Å; K12-N14 PolarHBondContact O-N 3.45Å; K12-R15 WeakPolarHBondContact O-CB 3.2Å; K12-R15 PolarHBondContact O-N 3.25Å; K12-S18 VanDerWaalsContact O-CB 3.23Å; K12-S18 WeakPolarHBondContact O-CB 3.39Å; K12-S18 PolarHBondContact O-OG 3.23Å
13	I	96	Very high	95.5	Very high	101 Å²	101	91.5 Å²	91.5	52%	0.518	45%	0.453	S	S	.	.	G	3₁₀ helix	trans	-69.6	-30.9	-177	-56.8	-59.6	0	0	0	111	D11 S18	D11-I13 PolarHBondContact O-N 2.89Å; D11-I13 PolarHBondContact OD1-N 3.47Å; D11-I13 VanDerWaalsContact OD1-N 3.13Å; I13-S18 WeakPolarHBondContact O-CB 3.27Å
14	N	94.8	Very high	95.7	Very high	106 Å²	106	94 Å²	94	57%	0.567	46%	0.464	S	S	*	.	G	3₁₀ helix	trans	-93.9	3.2	-180	-69.9	-60.1	0	0	0	112.9	Q9 D11 K12	Q9-N14 HydrophobicContact CG-CB 3.73Å; D11-N14 HydrophobicContact CB-CB 4.45Å; D11-N14 PolarHBondContact O-N 3.28Å; D11-N14 PolarHBondContact OD2-ND2 2.94Å; K12-N14 VanDerWaalsContact C-N 3.27Å; K12-N14 PolarHBondContact O-N 3.45Å
15	R	97.2	Very high	96	Very high	103 Å²	103	93.7 Å²	93.7	39%	0.389	46%	0.458	S	S	.	.	S	Bend	trans	-80.4	137.8	-178.5	-171.7	-180	-65	166.1	3.1	109.9	L6 L7 Q9 D11 K12 G17 S18	L6-R15 WeakPolarHBondContact O-CA 3.22Å; L6-R15 WeakPolarHBondContact O-CG 3.46Å; L7-R15 WeakPolarHBondContact O-CD 3.16Å; L7-R15 VanDerWaalsContact O-CG 3.29Å; L7-R15 WeakPolarHBondContact O-CG 3.38Å; Q9-R15 HydrophobicContact CB-CB 4.11Å; Q9-R15 HydrophobicContact CB-CG 4.41Å; Q9-R15 PolarHBondContact O-NE 3.44Å; Q9-R15 PolarHBondContact O-NH2 3.11Å; D11-R15 PolarHBondContact O-N 3.28Å; K12-R15 WeakPolarHBondContact O-CB 3.2Å; K12-R15 PolarHBondContact O-N 3.25Å; R15-G17 PolarHBondContact O-N 3.35Å; R15-S18 WeakPolarHBondContact O-CB 3.49Å; R15-S18 PolarHBondContact O-N 3.22Å
16	L	96.5	Very high	96.1	Very high	16 Å²	16	87.2 Å²	87.2	8%	0.084	43%	0.432	C	S	.	.	T	Hydrogen-bonded Turn	trans	-53.4	124.6	174.9	-173.1	71.4	0	0	0	110.1	L6 L7 E24 I25 H28	L6-L16 HydrophobicContact CB-CB 3.76Å; L6-L16 HydrophobicContact CB-CD2 4.42Å; L6-L16 HydrophobicContact CD1-CD1 4.48Å; L6-L16 PolarHBondContact O-N 3.34Å; L7-L16 HydrophobicContact CD2-CB 4.15Å; L7-L16 HydrophobicContact CD2-CD2 3.98Å; L7-L16 HydrophobicContact CD2-CG 4.42Å; L7-L16 HydrophobicContact CG-CB 4.42Å; L7-L16 HydrophobicContact CG-CD2 4.01Å; L16-E24 HydrophobicContact CD1-CG 3.92Å; L16-I25 HydrophobicContact CD2-CG1 4.39Å; L16-I25 HydrophobicContact CG-CG1 4.08Å; L16-H28 HydrophobicContact CD1-CB 4.49Å; L16-H28 HydrophobicContact CD2-CB 4.21Å
17	G	96.7	Very high	96.1	Very high	17 Å²	17	92.7 Å²	92.7	18%	0.175	46%	0.455	C	S	.	.	T	Hydrogen-bonded Turn	trans	95.5	5	-175.3	0	0	0	0	0	114.1	R15 D21 E24	R15-G17 PolarHBondContact O-N 3.35Å; G17-D21 WeakPolarHBondContact CA-O 3.23Å; G17-D21 WeakPolarHBondContact O-CA 3.43Å; G17-D21 PolarHBondContact O-N 3.43Å; G17-E24 VanDerWaalsContact CA-OE2 3.22Å; G17-E24 WeakPolarHBondContact CA-OE2 3.23Å; G17-E24 PolarHBondContact N-OE1 3.38Å; G17-E24 PolarHBondContact N-OE2 3.29Å
18	S	97.1	Very high	96.1	Very high	53 Å²	53	90.8 Å²	90.8	37%	0.371	44%	0.444	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79.6	-31	179.1	-171.9	0	0	0	0	113.7	K12 I13 R15 E24	K12-S18 VanDerWaalsContact O-CB 3.23Å; K12-S18 WeakPolarHBondContact O-CB 3.39Å; K12-S18 PolarHBondContact O-OG 3.23Å; I13-S18 WeakPolarHBondContact O-CB 3.27Å; R15-S18 WeakPolarHBondContact O-CB 3.49Å; R15-S18 PolarHBondContact O-N 3.22Å; S18-E24 PolarHBondContact N-OE2 2.77Å
19	E	94.7	Very high	96.1	Very high	153 Å²	153	90.5 Å²	90.5	72%	0.715	43%	0.432	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.7	-44.2	-174.1	-68.7	-171.9	164.7	0	0	112.2	E24	E19-E24 PolarHBondContact N-OE2 2.82Å
20	N	96	Very high	96	Very high	104 Å²	104	93.1 Å²	93.1	56%	0.556	44%	0.443	S	S	*	.	T	Hydrogen-bonded Turn	trans	-133.9	27.6	-176.4	-63.4	-69.1	0	0	0	112.7	F22 E23	N20-F22 PolarHBondContact O-N 2.81Å; N20-E23 HydrophobicContact CB-CB 4.28Å; N20-E23 WeakPolarHBondContact O-CB 3.44Å; N20-E23 PolarHBondContact O-N 3.29Å; N20-E23 VanDerWaalsContact O-N 3.08Å
21	D	95.2	Very high	96	Very high	115 Å²	115	85.6 Å²	85.6	62%	0.615	41%	0.41	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.5	-125.8	175	-168.8	18.3	0	0	0	112.8	G17 E23 E24 I25	G17-D21 WeakPolarHBondContact CA-O 3.23Å; G17-D21 WeakPolarHBondContact O-CA 3.43Å; G17-D21 PolarHBondContact O-N 3.43Å; D21-E23 VanDerWaalsContact C-N 3.26Å; D21-E23 PolarHBondContact O-N 3.29Å; D21-E24 PolarHBondContact O-N 2.87Å; D21-I25 PolarHBondContact O-N 3.1Å
22	F	96	Very high	95.9	Very high	97 Å²	97	91.2 Å²	91.2	43%	0.425	43%	0.426	S	S	.	.	H	α-helix	trans	-59.9	-31.6	-177.6	173.3	-104.3	0	0	0	113.7	N20 E24 I25 S26 W36	N20-F22 PolarHBondContact O-N 2.81Å; F22-E24 VanDerWaalsContact C-N 3.26Å; F22-E24 PolarHBondContact O-N 2.94Å; F22-I25 PolarHBondContact O-N 3.15Å; F22-S26 VanDerWaalsContact O-CB 3.27Å; F22-S26 WeakPolarHBondContact O-CB 3.19Å; F22-S26 PolarHBondContact O-N 2.91Å; F22-S26 PolarHBondContact O-OG 2.99Å; F22-W36 HydrophobicContact CE2-CD2 4.1Å; F22-W36 AromaticContact CE2-CE3 3.86Å; F22-W36 HydrophobicContact CE2-CE3 3.86Å; F22-W36 HydrophobicContact CE2-CH2 4.24Å; F22-W36 HydrophobicContact CE2-CZ2 4.45Å; F22-W36 AromaticContact CE2-CZ3 3.95Å; F22-W36 HydrophobicContact CE2-CZ3 3.95Å; F22-W36 HydrophobicContact CZ-CB 4.33Å; F22-W36 AromaticContact CZ-CD2 3.66Å; F22-W36 HydrophobicContact CZ-CD2 3.66Å; F22-W36 AromaticContact CZ-CE3 3.77Å; F22-W36 HydrophobicContact CZ-CE3 3.77Å; F22-W36 AromaticContact CZ-CG 3.91Å; F22-W36 HydrophobicContact CZ-CG 3.91Å; F22-W36 HydrophobicContact CZ-CZ3 4.33Å
23	E	96.2	Very high	95.9	Very high	109 Å²	109	90.5 Å²	90.5	51%	0.509	43%	0.429	S	S	.	.	H	α-helix	trans	-63.6	-35.7	-179.4	-71.1	-164.4	-159.1	0	0	112.2	N20 D21 S26 K27	N20-E23 HydrophobicContact CB-CB 4.28Å; N20-E23 WeakPolarHBondContact O-CB 3.44Å; N20-E23 PolarHBondContact O-N 3.29Å; N20-E23 VanDerWaalsContact O-N 3.08Å; D21-E23 VanDerWaalsContact C-N 3.26Å; D21-E23 PolarHBondContact O-N 3.29Å; E23-S26 WeakPolarHBondContact CA-OG 3.29Å; E23-S26 PolarHBondContact O-OG 3.25Å; E23-S26 VanDerWaalsContact O-OG 3.11Å; E23-K27 WeakPolarHBondContact O-CB 3.44Å; E23-K27 VanDerWaalsContact O-CD 3.23Å; E23-K27 WeakPolarHBondContact O-CD 3.13Å; E23-K27 WeakPolarHBondContact O-CG 3.39Å; E23-K27 PolarHBondContact O-N 2.98Å; E23-K27 IonicContact OE2-NZ 2.66Å; E23-K27 PolarHBondContact OE2-NZ 3.47Å
24	E	95.8	Very high	95.9	Very high	57 Å²	57	88.4 Å²	88.4	27%	0.266	42%	0.419	S	S	.	.	H	α-helix	trans	-69.6	-44.7	177.2	-161.8	-168.2	151.8	0	0	110.8	L16 G17 S18 E19 D21 F22 H28	L16-E24 HydrophobicContact CD1-CG 3.92Å; G17-E24 VanDerWaalsContact CA-OE2 3.22Å; G17-E24 WeakPolarHBondContact CA-OE2 3.23Å; G17-E24 PolarHBondContact N-OE1 3.38Å; G17-E24 PolarHBondContact N-OE2 3.29Å; S18-E24 PolarHBondContact N-OE2 2.77Å; E19-E24 PolarHBondContact N-OE2 2.82Å; D21-E24 PolarHBondContact O-N 2.87Å; F22-E24 VanDerWaalsContact C-N 3.26Å; F22-E24 PolarHBondContact O-N 2.94Å; E24-H28 PolarHBondContact O-N 3.21Å
25	I	96.3	Very high	96	Very high	41 Å²	41	86.3 Å²	86.3	21%	0.21	41%	0.407	C	S	.	.	H	α-helix	trans	-63.7	-49.8	179.6	-63	170.6	0	0	0	110.3	L16 D21 F22 K27 H28 F31	L16-I25 HydrophobicContact CD2-CG1 4.39Å; L16-I25 HydrophobicContact CG-CG1 4.08Å; D21-I25 PolarHBondContact O-N 3.1Å; F22-I25 PolarHBondContact O-N 3.15Å; I25-K27 VanDerWaalsContact C-N 3.27Å; I25-K27 PolarHBondContact O-N 3.27Å; I25-H28 WeakPolarHBondContact O-CB 3.35Å; I25-H28 PolarHBondContact O-N 3.02Å; I25-H28 VanDerWaalsContact O-N 3.08Å; I25-F31 HydrophobicContact CG2-CD2 4.17Å; I25-F31 HydrophobicContact CG2-CE2 3.69Å; I25-F31 HydrophobicContact CG2-CZ 4.27Å; I25-F31 VanDerWaalsContact O-CD2 3.23Å; I25-F31 WeakPolarHBondContact O-CD2 3.46Å
26	S	95.9	Very high	96	Very high	21 Å²	21	84.3 Å²	84.3	15%	0.147	40%	0.4	C	S	.	.	H	α-helix	trans	-62.9	-30	-176.5	56.8	0	0	0	0	113.9	F22 E23	F22-S26 VanDerWaalsContact O-CB 3.27Å; F22-S26 WeakPolarHBondContact O-CB 3.19Å; F22-S26 PolarHBondContact O-N 2.91Å; F22-S26 PolarHBondContact O-OG 2.99Å; E23-S26 WeakPolarHBondContact CA-OG 3.29Å; E23-S26 PolarHBondContact O-OG 3.25Å; E23-S26 VanDerWaalsContact O-OG 3.11Å
27	K	95.3	Very high	96.1	Very high	155 Å²	155	88.7 Å²	88.7	67%	0.674	42%	0.422	S	S	*	.	H	α-helix	trans	-82.8	-10.8	177.4	-68	168.7	-166.9	160.9	0	113	E23 I25	E23-K27 WeakPolarHBondContact O-CB 3.44Å; E23-K27 VanDerWaalsContact O-CD 3.23Å; E23-K27 WeakPolarHBondContact O-CD 3.13Å; E23-K27 WeakPolarHBondContact O-CG 3.39Å; E23-K27 PolarHBondContact O-N 2.98Å; E23-K27 IonicContact OE2-NZ 2.66Å; E23-K27 PolarHBondContact OE2-NZ 3.47Å; I25-K27 VanDerWaalsContact C-N 3.27Å; I25-K27 PolarHBondContact O-N 3.27Å
28	H	95.8	Very high	96.1	Very high	22 Å²	22	92.6 Å²	92.6	10%	0.102	43%	0.434	C	S	.	.	S	Bend	trans	-68.3	136.5	-179.6	-175.3	-93.7	0	0	0	111.6	M1 L16 E24 I25 F30 F31	M1-H28 PolarHBondContact O-NE2 3.03Å; L16-H28 HydrophobicContact CD1-CB 4.49Å; L16-H28 HydrophobicContact CD2-CB 4.21Å; E24-H28 PolarHBondContact O-N 3.21Å; I25-H28 WeakPolarHBondContact O-CB 3.35Å; I25-H28 PolarHBondContact O-N 3.02Å; I25-H28 VanDerWaalsContact O-N 3.08Å; H28-F30 WeakPolarHBondContact ND1-CB 3.31Å; H28-F30 PolarHBondContact ND1-N 2.93Å; H28-F30 PolarHBondContact O-N 3.08Å; H28-F31 HydrophobicContact CB-CD2 4.31Å; H28-F31 PolarHBondContact O-N 2.88Å
29	R	95.9	Very high	96.2	Very high	140 Å²	140	93.9 Å²	93.9	53%	0.528	44%	0.436	S	S	.	.	G	3₁₀ helix	trans	-56.2	-22.4	-172.1	73.3	-177.2	-174	-68.3	-14.3	116	M1 F31 R32	M1-R29 PolarHBondContact O-NH1 3.49Å; M1-R29 PolarHBondContact O-NH2 3.34Å; R29-F31 VanDerWaalsContact C-N 3.28Å; R29-R32 WeakPolarHBondContact O-CB 3.48Å; R29-R32 WeakPolarHBondContact O-CD 3.33Å; R29-R32 VanDerWaalsContact O-CG 3.29Å; R29-R32 WeakPolarHBondContact O-CG 3.47Å; R29-R32 PolarHBondContact O-N 3.25Å
30	F	95.7	Very high	96.2	Very high	131 Å²	131	93.3 Å²	93.3	58%	0.575	44%	0.438	S	S	*	.	G	3₁₀ helix	trans	-64.2	-34	174.7	178.1	-95.5	0	0	0	111.9	A3 H28	A3-F30 HydrophobicContact CB-CB 3.77Å; A3-F30 HydrophobicContact CB-CD1 4.22Å; A3-F30 HydrophobicContact CB-CD2 4.48Å; A3-F30 HydrophobicContact CB-CG 3.91Å; H28-F30 WeakPolarHBondContact ND1-CB 3.31Å; H28-F30 PolarHBondContact ND1-N 2.93Å; H28-F30 PolarHBondContact O-N 3.08Å
31	F	96.1	Very high	96.3	Very high	35 Å²	35	93.2 Å²	93.2	15%	0.154	43%	0.434	C	S	.	.	G	3₁₀ helix	trans	-100	10.6	-178.8	-54	-74.6	0	0	0	113.4	I25 H28 R29 D33 I34 W36	I25-F31 HydrophobicContact CG2-CD2 4.17Å; I25-F31 HydrophobicContact CG2-CE2 3.69Å; I25-F31 HydrophobicContact CG2-CZ 4.27Å; I25-F31 VanDerWaalsContact O-CD2 3.23Å; I25-F31 WeakPolarHBondContact O-CD2 3.46Å; H28-F31 HydrophobicContact CB-CD2 4.31Å; H28-F31 PolarHBondContact O-N 2.88Å; R29-F31 VanDerWaalsContact C-N 3.28Å; F31-D33 PolarHBondContact O-N 3.3Å; F31-I34 HydrophobicContact CB-CD1 4.16Å; F31-I34 HydrophobicContact CD1-CD1 3.71Å; F31-I34 HydrophobicContact CG-CD1 4.42Å; F31-I34 WeakPolarHBondContact O-CB 3.1Å; F31-I34 PolarHBondContact O-N 3.18Å; F31-W36 HydrophobicContact CB-CH2 4.21Å; F31-W36 HydrophobicContact CB-CZ2 3.57Å; F31-W36 HydrophobicContact CD1-CH2 4.09Å; F31-W36 HydrophobicContact CD1-CZ2 4.31Å; F31-W36 HydrophobicContact CG-CH2 4.17Å; F31-W36 AromaticContact CG-CZ2 3.96Å; F31-W36 HydrophobicContact CG-CZ2 3.96Å
32	R	95.2	Very high	96.4	Very high	192 Å²	192	98.7 Å²	98.7	73%	0.725	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57	-27.9	-173.8	73.2	-176.2	-177.5	179	-2.9	114.1	R29 I34	R29-R32 WeakPolarHBondContact O-CB 3.48Å; R29-R32 WeakPolarHBondContact O-CD 3.33Å; R29-R32 VanDerWaalsContact O-CG 3.29Å; R29-R32 WeakPolarHBondContact O-CG 3.47Å; R29-R32 PolarHBondContact O-N 3.25Å; R32-I34 VanDerWaalsContact C-N 3.33Å
33	D	95.5	Very high	96.4	Very high	133 Å²	133	100.4 Å²	100.4	71%	0.711	45%	0.453	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.3	2.6	-175.5	-59.9	-46.8	0	0	0	112	F31	F31-D33 PolarHBondContact O-N 3.3Å
34	I	96.7	Very high	96.4	Very high	57 Å²	57	98.8 Å²	98.8	29%	0.292	45%	0.448	S	S	.	.			trans	-92.8	117.7	178	-57.2	-175.3	0	0	0	110	F31 R32 W36 L39	F31-I34 HydrophobicContact CB-CD1 4.16Å; F31-I34 HydrophobicContact CD1-CD1 3.71Å; F31-I34 HydrophobicContact CG-CD1 4.42Å; F31-I34 WeakPolarHBondContact O-CB 3.1Å; F31-I34 PolarHBondContact O-N 3.18Å; R32-I34 VanDerWaalsContact C-N 3.33Å; I34-W36 HydrophobicContact CB-CD2 4.48Å; I34-W36 HydrophobicContact CB-CZ2 4.33Å; I34-W36 HydrophobicContact CD1-CH2 4.11Å; I34-W36 HydrophobicContact CD1-CZ2 4.39Å; I34-W36 HydrophobicContact CG2-CD2 3.81Å; I34-W36 HydrophobicContact CG2-CE3 3.84Å; I34-W36 HydrophobicContact CG2-CG 4.36Å; I34-W36 HydrophobicContact CG2-CH2 4.33Å; I34-W36 HydrophobicContact CG2-CZ2 4.31Å; I34-W36 HydrophobicContact CG2-CZ3 4.09Å; I34-W36 PolarHBondContact O-N 3.36Å; I34-L39 HydrophobicContact CG2-CB 4.4Å; I34-L39 HydrophobicContact CG2-CD2 3.95Å
35	D	97.3	Very high	96.4	Very high	62 Å²	62	102.7 Å²	102.7	33%	0.332	48%	0.475	S	S	.	.			trans	-79.9	99.8	162.4	-177	-29.8	0	0	0	108.8	I37 K38 L39	D35-I37 VanDerWaalsContact C-N 3.27Å; D35-I37 PolarHBondContact O-N 2.94Å; D35-I37 PolarHBondContact OD1-N 3.34Å; D35-K38 HydrophobicContact CB-CB 4.05Å; D35-K38 HydrophobicContact CB-CD 4.11Å; D35-K38 HydrophobicContact CB-CG 4.27Å; D35-K38 PolarHBondContact O-N 2.89Å; D35-K38 PolarHBondContact OD1-N 3.26Å; D35-K38 WeakPolarHBondContact OD2-CD 3.19Å; D35-K38 WeakPolarHBondContact OD2-CE 3.32Å; D35-K38 WeakPolarHBondContact OD2-CG 3.35Å; D35-K38 IonicContact OD2-NZ 3.3Å; D35-K38 PolarHBondContact OD2-NZ 3.39Å; D35-L39 WeakPolarHBondContact O-CB 3.14Å; D35-L39 PolarHBondContact O-N 3.28Å
36	W	97.1	Very high	96.4	Very high	61 Å²	61	103.4 Å²	103.4	23%	0.231	49%	0.487	C	S	.	.	H	α-helix	trans	-63	-31.7	-175.1	-63.4	105.1	0	0	0	113.4	F22 F31 I34 L39 L40	F22-W36 HydrophobicContact CE2-CD2 4.1Å; F22-W36 AromaticContact CE2-CE3 3.86Å; F22-W36 HydrophobicContact CE2-CE3 3.86Å; F22-W36 HydrophobicContact CE2-CH2 4.24Å; F22-W36 HydrophobicContact CE2-CZ2 4.45Å; F22-W36 AromaticContact CE2-CZ3 3.95Å; F22-W36 HydrophobicContact CE2-CZ3 3.95Å; F22-W36 HydrophobicContact CZ-CB 4.33Å; F22-W36 AromaticContact CZ-CD2 3.66Å; F22-W36 HydrophobicContact CZ-CD2 3.66Å; F22-W36 AromaticContact CZ-CE3 3.77Å; F22-W36 HydrophobicContact CZ-CE3 3.77Å; F22-W36 AromaticContact CZ-CG 3.91Å; F22-W36 HydrophobicContact CZ-CG 3.91Å; F22-W36 HydrophobicContact CZ-CZ3 4.33Å; F31-W36 HydrophobicContact CB-CH2 4.21Å; F31-W36 HydrophobicContact CB-CZ2 3.57Å; F31-W36 HydrophobicContact CD1-CH2 4.09Å; F31-W36 HydrophobicContact CD1-CZ2 4.31Å; F31-W36 HydrophobicContact CG-CH2 4.17Å; F31-W36 AromaticContact CG-CZ2 3.96Å; F31-W36 HydrophobicContact CG-CZ2 3.96Å; I34-W36 HydrophobicContact CB-CD2 4.48Å; I34-W36 HydrophobicContact CB-CZ2 4.33Å; I34-W36 HydrophobicContact CD1-CH2 4.11Å; I34-W36 HydrophobicContact CD1-CZ2 4.39Å; I34-W36 HydrophobicContact CG2-CD2 3.81Å; I34-W36 HydrophobicContact CG2-CE3 3.84Å; I34-W36 HydrophobicContact CG2-CG 4.36Å; I34-W36 HydrophobicContact CG2-CH2 4.33Å; I34-W36 HydrophobicContact CG2-CZ2 4.31Å; I34-W36 HydrophobicContact CG2-CZ3 4.09Å; I34-W36 PolarHBondContact O-N 3.36Å; W36-L39 HydrophobicContact CE3-CD2 3.86Å; W36-L39 HydrophobicContact CZ3-CD2 3.9Å; W36-L39 PolarHBondContact O-N 3.34Å; W36-L40 WeakPolarHBondContact O-CB 3.31Å; W36-L40 VanDerWaalsContact O-CG 3.31Å; W36-L40 WeakPolarHBondContact O-CG 3.22Å; W36-L40 PolarHBondContact O-N 2.96Å
37	I	97.2	Very high	96.4	Very high	108 Å²	108	109.4 Å²	109.4	55%	0.554	53%	0.526	S	S	*	.	H	α-helix	trans	-69	-49.4	176.8	-59.9	-59.7	0	0	0	109.4	D35 L39 L40 E41	D35-I37 VanDerWaalsContact C-N 3.27Å; D35-I37 PolarHBondContact O-N 2.94Å; D35-I37 PolarHBondContact OD1-N 3.34Å; I37-L39 VanDerWaalsContact C-N 3.27Å; I37-L39 PolarHBondContact O-N 2.98Å; I37-L40 PolarHBondContact O-N 3.44Å; I37-E41 HydrophobicContact CG2-CG 4.46Å; I37-E41 WeakPolarHBondContact O-CB 3.38Å; I37-E41 WeakPolarHBondContact O-CG 3.4Å; I37-E41 PolarHBondContact O-N 3.18Å
38	K	97.9	Very high	96.5	Very high	98 Å²	98	109.2 Å²	109.2	43%	0.426	53%	0.526	S	S	.	.	H	α-helix	trans	-62.6	-34.7	175.8	-72.6	-179.7	-169.5	155.3	0	112.7	D35 R42 K43 L44	D35-K38 HydrophobicContact CB-CB 4.05Å; D35-K38 HydrophobicContact CB-CD 4.11Å; D35-K38 HydrophobicContact CB-CG 4.27Å; D35-K38 PolarHBondContact O-N 2.89Å; D35-K38 PolarHBondContact OD1-N 3.26Å; D35-K38 WeakPolarHBondContact OD2-CD 3.19Å; D35-K38 WeakPolarHBondContact OD2-CE 3.32Å; D35-K38 WeakPolarHBondContact OD2-CG 3.35Å; D35-K38 IonicContact OD2-NZ 3.3Å; D35-K38 PolarHBondContact OD2-NZ 3.39Å; K38-R42 PolarHBondContact O-N 3.37Å; K38-R42 VanDerWaalsContact O-N 3.16Å; K38-K43 HydrophobicContact CB-CB 4.05Å; K38-K43 HydrophobicContact CG-CB 4.27Å; K38-K43 PolarHBondContact O-N 3.42Å; K38-L44 HydrophobicContact CB-CD2 3.72Å; K38-L44 HydrophobicContact CB-CG 3.92Å; K38-L44 HydrophobicContact CD-CD2 4.16Å
39	L	97.5	Very high	96.4	Very high	80 Å²	80	115 Å²	115	42%	0.419	56%	0.557	S	S	.	*	H	α-helix	trans	-62.5	-50.2	175.5	-178.4	63.2	0	0	0	110.9	I34 D35 W36 I37 E41 R42 L44	I34-L39 HydrophobicContact CG2-CB 4.4Å; I34-L39 HydrophobicContact CG2-CD2 3.95Å; D35-L39 WeakPolarHBondContact O-CB 3.14Å; D35-L39 PolarHBondContact O-N 3.28Å; W36-L39 HydrophobicContact CE3-CD2 3.86Å; W36-L39 HydrophobicContact CZ3-CD2 3.9Å; W36-L39 PolarHBondContact O-N 3.34Å; I37-L39 VanDerWaalsContact C-N 3.27Å; I37-L39 PolarHBondContact O-N 2.98Å; L39-E41 VanDerWaalsContact C-N 3.32Å; L39-E41 PolarHBondContact O-N 2.66Å; L39-R42 WeakPolarHBondContact O-CA 3.34Å; L39-R42 PolarHBondContact O-N 3.3Å; L39-L44 HydrophobicContact CB-CD1 3.79Å; L39-L44 HydrophobicContact CB-CG 4.48Å; L39-L44 HydrophobicContact CD1-CD1 4.1Å
40	L	96.6	Very high	96.4	Very high	141 Å²	141	111.5 Å²	111.5	74%	0.738	55%	0.552	S	S	*	*	H	α-helix	trans	-62.1	-39.2	178.7	-74.9	170	0	0	0	112.3	W36 I37 R42	W36-L40 WeakPolarHBondContact O-CB 3.31Å; W36-L40 VanDerWaalsContact O-CG 3.31Å; W36-L40 WeakPolarHBondContact O-CG 3.22Å; W36-L40 PolarHBondContact O-N 2.96Å; I37-L40 PolarHBondContact O-N 3.44Å; L40-R42 PolarHBondContact O-N 3.49Å
41	E	97.7	Very high	96.4	Very high	102 Å²	102	109 Å²	109	48%	0.477	55%	0.551	S	S	.	*	T	Hydrogen-bonded Turn	trans	-76.6	2.8	175.1	-65.3	-179	132.1	0	0	113.5	I37 L39 K43	I37-E41 HydrophobicContact CG2-CG 4.46Å; I37-E41 WeakPolarHBondContact O-CB 3.38Å; I37-E41 WeakPolarHBondContact O-CG 3.4Å; I37-E41 PolarHBondContact O-N 3.18Å; L39-E41 VanDerWaalsContact C-N 3.32Å; L39-E41 PolarHBondContact O-N 2.66Å; E41-K43 HydrophobicContact CB-CD 3.98Å; E41-K43 HydrophobicContact CB-CG 3.94Å; E41-K43 PolarHBondContact O-N 3.34Å; E41-K43 IonicContact OE1-NZ 3.26Å; E41-K43 PolarHBondContact OE1-NZ 3.02Å; E41-K43 WeakPolarHBondContact OE2-CD 3.33Å; E41-K43 WeakPolarHBondContact OE2-CE 3.38Å; E41-K43 IonicContact OE2-NZ 2.94Å; E41-K43 PolarHBondContact OE2-NZ 3.38Å
42	R	96.2	Very high	96.4	Very high	231 Å²	231	111.8 Å²	111.8	87%	0.872	57%	0.57	S	S	*	*	T	Hydrogen-bonded Turn	trans	57.6	32.3	-179.1	-51	174.2	75.7	173.6	4.2	113.3	K38 L39 L40	K38-R42 PolarHBondContact O-N 3.37Å; K38-R42 VanDerWaalsContact O-N 3.16Å; L39-R42 WeakPolarHBondContact O-CA 3.34Å; L39-R42 PolarHBondContact O-N 3.3Å; L40-R42 PolarHBondContact O-N 3.49Å
43	K	97.6	Very high	96.3	Very high	132 Å²	132	107.8 Å²	107.8	57%	0.574	57%	0.567	S	S	*	*			trans	-92.3	-10.8	179.6	-67.2	178.5	-177.8	164.5	0	113.9	K38 E41	K38-K43 HydrophobicContact CB-CB 4.05Å; K38-K43 HydrophobicContact CG-CB 4.27Å; K38-K43 PolarHBondContact O-N 3.42Å; E41-K43 HydrophobicContact CB-CD 3.98Å; E41-K43 HydrophobicContact CB-CG 3.94Å; E41-K43 PolarHBondContact O-N 3.34Å; E41-K43 IonicContact OE1-NZ 3.26Å; E41-K43 PolarHBondContact OE1-NZ 3.02Å; E41-K43 WeakPolarHBondContact OE2-CD 3.33Å; E41-K43 WeakPolarHBondContact OE2-CE 3.38Å; E41-K43 IonicContact OE2-NZ 2.94Å; E41-K43 PolarHBondContact OE2-NZ 3.38Å
44	L	96.2	Very high	96.3	Very high	76 Å²	76	104 Å²	104	40%	0.398	55%	0.551	S	S	.	*	S	Bend	trans	-82.2	131.5	172.8	-60.6	-176.5	0	0	0	110.1	K38 L39 A46	K38-L44 HydrophobicContact CB-CD2 3.72Å; K38-L44 HydrophobicContact CB-CG 3.92Å; K38-L44 HydrophobicContact CD-CD2 4.16Å; L39-L44 HydrophobicContact CB-CD1 3.79Å; L39-L44 HydrophobicContact CB-CG 4.48Å; L39-L44 HydrophobicContact CD1-CD1 4.1Å; L44-A46 PolarHBondContact O-N 3.32Å
45	T	95.3	Very high	96.3	Very high	138 Å²	138	107.5 Å²	107.5	85%	0.847	58%	0.581	S	S	*	*	P	Polyproline II helix	trans	-66.2	125.7	173.4	-54.2	0	0	0	0	109.6
46	A	95.4	Very high	96.1	Very high	56 Å²	56	109.8 Å²	109.8	46%	0.463	60%	0.597	S	S	.	*	P	Polyproline II helix	trans	-63.8	137.6	174.8	0	0	0	0	0	110.3	L44 F48	L44-A46 PolarHBondContact O-N 3.32Å; A46-F48 PolarHBondContact O-N 3.39Å
47	P	96	Very high	96	Very high	147 Å²	147	108.8 Å²	108.8	96%	0.955	60%	0.596	S	S	*	*	S	Bend	trans	-69.1	-18.3	179.5	28.3	-35.5	0	0	0	113
48	F	96.8	Very high	95.9	Very high	152 Å²	152	107 Å²	107	67%	0.667	59%	0.59	S	S	*	*			trans	-130.7	128.9	175.8	171.8	-102.7	0	0	0	109.2	A46 P50	A46-F48 PolarHBondContact O-N 3.39Å; F48-P50 HydrophobicContact CE1-CB 3.94Å; F48-P50 HydrophobicContact CZ-CB 4.43Å
49	L	94.2	Very high	95.7	Very high	144 Å²	144	108.2 Å²	108.2	75%	0.754	59%	0.592	S	S	*	*			trans	-110.6	111.3	176.5	-149.9	76.2	0	0	0	108.3
50	P	95.7	Very high	95.6	Very high	66 Å²	66	108.9 Å²	108.9	43%	0.429	60%	0.596	S	S	.	*			trans	-64.8	139.9	-179.4	26.8	-33.5	0	0	0	110.2	F48 V52	F48-P50 HydrophobicContact CE1-CB 3.94Å; F48-P50 HydrophobicContact CZ-CB 4.43Å; P50-V52 PolarHBondContact O-N 3.11Å
51	S	95.2	Very high	95.5	Very high	79 Å²	79	106.7 Å²	106.7	55%	0.552	58%	0.584	S	S	*	*			trans	-73.6	128.8	173.7	-63	0	0	0	0	110	R59 N60	S51-R59 WeakPolarHBondContact O-CD 3.5Å; S51-N60 PolarHBondContact O-ND2 3.21Å
52	V	96	Very high	95.3	Very high	93 Å²	93	104.5 Å²	104.5	56%	0.564	58%	0.58	S	S	*	*			trans	-140.3	129.8	176.2	-179.6	0	0	0	0	107.9	P50 S54 D57	P50-V52 PolarHBondContact O-N 3.11Å; V52-S54 WeakPolarHBondContact CG1-O 3.43Å; V52-D57 VanDerWaalsContact CA-OD2 3.28Å; V52-D57 WeakPolarHBondContact CA-OD2 3.47Å; V52-D57 HydrophobicContact CG1-CB 4.04Å
53	T	95.1	Very high	95.2	Very high	107 Å²	107	97.8 Å²	97.8	66%	0.656	57%	0.567	S	S	*	*			trans	-110.2	-16.1	-178.4	56.5	0	0	0	0	114.5	D57 R59	T53-D57 PolarHBondContact N-OD2 3Å; T53-D57 PolarHBondContact OG1-OD2 3.44Å; T53-R59 PolarHBondContact OG1-NH2 2.59Å
54	S	95.6	Very high	94.9	Very high	54 Å²	54	98.5 Å²	98.5	38%	0.378	57%	0.572	S	S	.	*	S	Bend	trans	-155.4	167.2	179.7	66.3	0	0	0	0	111.5	V52 T56 D57	V52-S54 WeakPolarHBondContact CG1-O 3.43Å; S54-T56 PolarHBondContact O-N 3.44Å; S54-T56 PolarHBondContact OG-OG1 2.68Å; S54-D57 WeakPolarHBondContact O-CB 3.29Å; S54-D57 PolarHBondContact O-N 3.48Å; S54-D57 PolarHBondContact OG-N 3.06Å
55	S	94.8	Very high	94.7	Very high	130 Å²	130	101.2 Å²	101.2	91%	0.909	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.9	-15.4	174.7	52.6	0	0	0	0	114.1
56	T	93.5	Very high	94.5	Very high	111 Å²	111	97.6 Å²	97.6	68%	0.681	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.7	11.3	-179.7	55.2	0	0	0	0	112.8	S54 T58	S54-T56 PolarHBondContact O-N 3.44Å; S54-T56 PolarHBondContact OG-OG1 2.68Å; T56-T58 PolarHBondContact O-N 2.79Å
57	D	95.1	Very high	94.3	Very high	40 Å²	40	101.2 Å²	101.2	21%	0.214	57%	0.57	C	S	.	*			trans	-70.5	122.9	-177.4	-171.5	-7	0	0	0	111.9	V52 T53 S54 R59	V52-D57 VanDerWaalsContact CA-OD2 3.28Å; V52-D57 WeakPolarHBondContact CA-OD2 3.47Å; V52-D57 HydrophobicContact CG1-CB 4.04Å; T53-D57 PolarHBondContact N-OD2 3Å; T53-D57 PolarHBondContact OG1-OD2 3.44Å; S54-D57 WeakPolarHBondContact O-CB 3.29Å; S54-D57 PolarHBondContact O-N 3.48Å; S54-D57 PolarHBondContact OG-N 3.06Å; D57-R59 VanDerWaalsContact CG-NE 3.28Å; D57-R59 WeakPolarHBondContact OD1-CB 3.43Å; D57-R59 WeakPolarHBondContact OD1-CG 3.5Å; D57-R59 IonicContact OD1-CZ 3.68Å; D57-R59 PolarHBondContact OD1-N 3.38Å; D57-R59 IonicContact OD1-NE 2.95Å; D57-R59 PolarHBondContact OD1-NE 3Å; D57-R59 IonicContact OD1-NH2 3.58Å; D57-R59 IonicContact OD2-CZ 2.93Å; D57-R59 IonicContact OD2-NE 2.83Å; D57-R59 PolarHBondContact OD2-NE 3.26Å; D57-R59 IonicContact OD2-NH1 3.82Å; D57-R59 IonicContact OD2-NH2 2.85Å; D57-R59 PolarHBondContact OD2-NH2 3.27Å
58	T	94.8	Very high	93.9	Very high	69 Å²	69	97.1 Å²	97.1	42%	0.423	55%	0.545	S	S	.	.			trans	-111.8	11.1	-176.7	53.6	0	0	0	0	113.6	T56 N60 I61	T56-T58 PolarHBondContact O-N 2.79Å; T58-N60 PolarHBondContact O-N 3.16Å; T58-N60 VanDerWaalsContact O-N 3.1Å; T58-I61 VanDerWaalsContact O-CB 3.32Å; T58-I61 WeakPolarHBondContact O-CB 3.42Å; T58-I61 PolarHBondContact O-N 3.32Å
59	R	94.5	Very high	93.2	Very high	124 Å²	124	95 Å²	95	47%	0.468	55%	0.549	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.3	-25	-173.1	75.8	-176.3	65.4	172.5	-7.4	115.8	S51 T53 D57 I61	S51-R59 WeakPolarHBondContact O-CD 3.5Å; T53-R59 PolarHBondContact OG1-NH2 2.59Å; D57-R59 VanDerWaalsContact CG-NE 3.28Å; D57-R59 WeakPolarHBondContact OD1-CB 3.43Å; D57-R59 WeakPolarHBondContact OD1-CG 3.5Å; D57-R59 IonicContact OD1-CZ 3.68Å; D57-R59 PolarHBondContact OD1-N 3.38Å; D57-R59 IonicContact OD1-NE 2.95Å; D57-R59 PolarHBondContact OD1-NE 3Å; D57-R59 IonicContact OD1-NH2 3.58Å; D57-R59 IonicContact OD2-CZ 2.93Å; D57-R59 IonicContact OD2-NE 2.83Å; D57-R59 PolarHBondContact OD2-NE 3.26Å; D57-R59 IonicContact OD2-NH1 3.82Å; D57-R59 IonicContact OD2-NH2 2.85Å; D57-R59 PolarHBondContact OD2-NH2 3.27Å; R59-I61 VanDerWaalsContact C-N 3.26Å
60	N	95	Very high	92.4	Very high	95 Å²	95	94.2 Å²	94.2	51%	0.508	55%	0.55	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.1	3.1	179.4	-58.9	-62	0	0	0	111.9	S51 T58	S51-N60 PolarHBondContact O-ND2 3.21Å; T58-N60 PolarHBondContact O-N 3.16Å; T58-N60 VanDerWaalsContact O-N 3.1Å
61	I	94.4	Very high	91.3	Very high	95 Å²	95	94.6 Å²	94.6	49%	0.487	55%	0.552	S	S	.	*	S	Bend	trans	-101.2	141.6	173.4	-51.1	-57.7	0	0	0	108.1	T58 R59 F65 V66	T58-I61 VanDerWaalsContact O-CB 3.32Å; T58-I61 WeakPolarHBondContact O-CB 3.42Å; T58-I61 PolarHBondContact O-N 3.32Å; R59-I61 VanDerWaalsContact C-N 3.26Å; I61-F65 HydrophobicContact CG2-CB 4.17Å; I61-V66 HydrophobicContact CB-CG2 3.85Å; I61-V66 HydrophobicContact CG2-CG2 3.95Å
62	S	94.5	Very high	90.2	Very high	56 Å²	56	98.3 Å²	98.3	39%	0.392	57%	0.566	S	S	.	*			trans	-55.1	134	177.4	175.4	0	0	0	0	110.9	E64 F65 V66	S62-E64 PolarHBondContact O-N 3.44Å; S62-E64 VanDerWaalsContact O-N 3.09Å; S62-E64 PolarHBondContact OG-N 3.42Å; S62-F65 PolarHBondContact O-N 3.48Å; S62-V66 PolarHBondContact O-N 3.37Å
63	P	92.5	Very high	88.9	Confident	90 Å²	90	97.5 Å²	97.5	58%	0.584	56%	0.564	S	S	*	*	H	α-helix	trans	-55	-28.3	177.7	-27.2	34.9	0	0	0	114.1	F65 V66 N67	P63-F65 VanDerWaalsContact C-N 3.27Å; P63-F65 PolarHBondContact O-N 3.35Å; P63-V66 PolarHBondContact O-N 2.98Å; P63-N67 VanDerWaalsContact O-CB 3.27Å; P63-N67 WeakPolarHBondContact O-CB 3.48Å; P63-N67 VanDerWaalsContact O-CG 3.27Å; P63-N67 PolarHBondContact O-N 3.27Å; P63-N67 PolarHBondContact O-ND2 3.5Å
64	E	93	Very high	87.5	Confident	146 Å²	146	99 Å²	99	68%	0.682	57%	0.568	S	S	*	*	H	α-helix	trans	-56.2	-41.9	175.7	-176.7	-177.1	173	0	0	111.9	S62 S68	S62-E64 PolarHBondContact O-N 3.44Å; S62-E64 VanDerWaalsContact O-N 3.09Å; S62-E64 PolarHBondContact OG-N 3.42Å; E64-S68 PolarHBondContact O-N 2.95Å
65	F	91.2	Very high	86	Confident	134 Å²	134	100 Å²	100	59%	0.588	57%	0.568	S	S	*	*	H	α-helix	trans	-82.2	-38.2	179.3	-60	-64.2	0	0	0	112	I61 S62 P63 N67 S68	I61-F65 HydrophobicContact CG2-CB 4.17Å; S62-F65 PolarHBondContact O-N 3.48Å; P63-F65 VanDerWaalsContact C-N 3.27Å; P63-F65 PolarHBondContact O-N 3.35Å; F65-N67 VanDerWaalsContact C-N 3.26Å; F65-N67 PolarHBondContact O-N 3.13Å; F65-S68 WeakPolarHBondContact O-CB 3.43Å; F65-S68 PolarHBondContact O-N 3.1Å; F65-S68 VanDerWaalsContact O-N 3.17Å; F65-S68 PolarHBondContact O-OG 3.26Å
66	V	91.6	Very high	84.4	Confident	62 Å²	62	98 Å²	98	38%	0.376	55%	0.553	S	S	.	*	H	α-helix	trans	-62.1	-38.1	178.5	179.9	0	0	0	0	111.4	I61 S62 P63 S68	I61-V66 HydrophobicContact CB-CG2 3.85Å; I61-V66 HydrophobicContact CG2-CG2 3.95Å; S62-V66 PolarHBondContact O-N 3.37Å; P63-V66 PolarHBondContact O-N 2.98Å; V66-S68 VanDerWaalsContact C-N 3.35Å
67	N	90.4	Very high	83	Confident	132 Å²	132	97 Å²	97	71%	0.706	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89	-2.7	179.8	-62.2	-36	0	0	0	113.2	P63 F65	P63-N67 VanDerWaalsContact O-CB 3.27Å; P63-N67 WeakPolarHBondContact O-CB 3.48Å; P63-N67 VanDerWaalsContact O-CG 3.27Å; P63-N67 PolarHBondContact O-N 3.27Å; P63-N67 PolarHBondContact O-ND2 3.5Å; F65-N67 VanDerWaalsContact C-N 3.26Å; F65-N67 PolarHBondContact O-N 3.13Å
68	S	87.7	Confident	81.5	Confident	60 Å²	60	99.3 Å²	99.3	42%	0.42	57%	0.566	S	S	.	*	S	Bend	trans	-65.1	138.4	176.1	71.4	0	0	0	0	109.7	E64 F65 V66 V70	E64-S68 PolarHBondContact O-N 2.95Å; F65-S68 WeakPolarHBondContact O-CB 3.43Å; F65-S68 PolarHBondContact O-N 3.1Å; F65-S68 VanDerWaalsContact O-N 3.17Å; F65-S68 PolarHBondContact O-OG 3.26Å; V66-S68 VanDerWaalsContact C-N 3.35Å; S68-V70 PolarHBondContact O-N 2.9Å
69	S	81.5	Confident	80.1	Confident	108 Å²	108	101.4 Å²	101.4	76%	0.755	57%	0.572	S	S	*	*			trans	-63.6	130.2	166	-172.7	0	0	0	0	107.3	P71	S69-P71 WeakPolarHBondContact O-CD 2.99Å
70	V	79.3	Confident	78.6	Confident	128 Å²	128	101 Å²	101	78%	0.776	57%	0.571	S	S	*	*			trans	-84	97.5	168.9	-177.9	0	0	0	0	106.3	S68 N72	S68-V70 PolarHBondContact O-N 2.9Å; V70-N72 PolarHBondContact O-N 2.82Å
71	P	72.6	Confident	77	Confident	74 Å²	74	99.9 Å²	99.9	48%	0.481	57%	0.574	S	S	.	*			trans	-65.5	139.9	178.8	29.8	-35.7	0	0	0	108.6	S69 L74	S69-P71 WeakPolarHBondContact O-CD 2.99Å; P71-L74 HydrophobicContact CB-CD2 3.92Å; P71-L74 HydrophobicContact CG-CD2 3.94Å; P71-L74 HydrophobicContact CG-CG 4.38Å
72	N	71	Confident	75.5	Confident	157 Å²	157	105 Å²	105	84%	0.84	59%	0.588	S	S	*	*	S	Bend	trans	-54.7	145.8	157.6	-72	-45.2	0	0	0	108.5	V70 L74	V70-N72 PolarHBondContact O-N 2.82Å; N72-L74 PolarHBondContact O-N 3.29Å; N72-L74 VanDerWaalsContact O-N 3.15Å
73	S	69.4	Low	73.8	Confident	75 Å²	75	106.3 Å²	106.3	52%	0.524	59%	0.59	S	S	.	*			trans	-28.7	116.8	-175.8	-179	0	0	0	0	112.7	I75 R80	S73-I75 PolarHBondContact O-N 3.26Å; S73-R80 PolarHBondContact OG-NH2 3.25Å
74	L	65.5	Low	72.1	Confident	139 Å²	139	107.5 Å²	107.5	73%	0.728	59%	0.588	S	S	*	*	S	Bend	trans	-59.7	-12.3	-177.1	-63.8	174	0	0	0	113.4	P71 N72 C76	P71-L74 HydrophobicContact CB-CD2 3.92Å; P71-L74 HydrophobicContact CG-CD2 3.94Å; P71-L74 HydrophobicContact CG-CG 4.38Å; N72-L74 PolarHBondContact O-N 3.29Å; N72-L74 VanDerWaalsContact O-N 3.15Å; L74-C76 PolarHBondContact O-N 3.21Å
75	I	63.9	Low	70.5	Confident	76 Å²	76	110.1 Å²	110.1	39%	0.39	60%	0.599	S	S	.	*			trans	-83	99.1	-179.7	-51.1	178.3	0	0	0	108.6	S73 M79 R80	S73-I75 PolarHBondContact O-N 3.26Å; I75-M79 HydrophobicContact CG2-CB 3.77Å; I75-R80 HydrophobicContact CB-CG 4.48Å; I75-R80 HydrophobicContact CG2-CB 4.41Å; I75-R80 HydrophobicContact CG2-CG 3.46Å; I75-R80 VanDerWaalsContact CG2-CG 3.46Å; I75-R80 PolarHBondContact O-NH1 3.38Å
76	C	61.4	Low	69.1	Low	88 Å²	88	106 Å²	106	60%	0.595	60%	0.595	S	S	*	*			trans	-62.5	152	164.1	-63.7	0	0	0	0	110.2	L74 V78 M79 R80	L74-C76 PolarHBondContact O-N 3.21Å; C76-V78 PolarHBondContact O-N 3.49Å; C76-M79 PolarHBondContact O-N 3.44Å; C76-R80 PolarHBondContact O-N 3.35Å
77	S	64.7	Low	67.8	Low	90 Å²	90	106.2 Å²	106.2	63%	0.629	59%	0.594	S	S	*	*	H	α-helix	trans	-47.5	-33.9	178.3	52.1	0	0	0	0	113.6	M79 R80 A81	S77-M79 PolarHBondContact O-N 2.93Å; S77-R80 WeakPolarHBondContact O-CB 3.4Å; S77-R80 PolarHBondContact O-N 3.15Å; S77-A81 PolarHBondContact O-N 3.17Å
78	V	63.7	Low	66.7	Low	87 Å²	87	106.1 Å²	106.1	53%	0.527	59%	0.593	S	S	.	*	H	α-helix	trans	-63.2	-39.7	177.4	-177.8	0	0	0	0	112.9	C76 R82	C76-V78 PolarHBondContact O-N 3.49Å; V78-R82 PolarHBondContact O-N 3.31Å
79	M	64.8	Low	66.3	Low	114 Å²	114	111.5 Å²	111.5	56%	0.562	61%	0.612	S	S	*	*	H	α-helix	trans	-73.9	-35	175.4	-74.3	-169.7	179.7	0	0	111.6	I75 C76 S77 A81 R82 N83	I75-M79 HydrophobicContact CG2-CB 3.77Å; C76-M79 PolarHBondContact O-N 3.44Å; S77-M79 PolarHBondContact O-N 2.93Å; M79-A81 VanDerWaalsContact C-N 3.33Å; M79-A81 PolarHBondContact O-N 3.38Å; M79-R82 PolarHBondContact O-N 3.02Å; M79-N83 WeakPolarHBondContact O-CB 3.32Å; M79-N83 PolarHBondContact O-N 3.48Å; M79-N83 VanDerWaalsContact O-N 3.13Å; M79-N83 PolarHBondContact O-ND2 2.93Å
80	R	62.1	Low	66.4	Low	115 Å²	115	111.2 Å²	111.2	43%	0.434	61%	0.605	S	S	.	*	H	α-helix	trans	-57.9	-47.4	171.2	-69.2	-166.6	174.9	84.2	7.4	110.9	S73 I75 C76 S77 R82 N83 H84	S73-R80 PolarHBondContact OG-NH2 3.25Å; I75-R80 HydrophobicContact CB-CG 4.48Å; I75-R80 HydrophobicContact CG2-CB 4.41Å; I75-R80 HydrophobicContact CG2-CG 3.46Å; I75-R80 VanDerWaalsContact CG2-CG 3.46Å; I75-R80 PolarHBondContact O-NH1 3.38Å; C76-R80 PolarHBondContact O-N 3.35Å; S77-R80 WeakPolarHBondContact O-CB 3.4Å; S77-R80 PolarHBondContact O-N 3.15Å; R80-R82 PolarHBondContact O-N 3.36Å; R80-N83 PolarHBondContact O-N 3.09Å; R80-H84 PolarHBondContact O-CD2 2.68Å; R80-H84 PolarHBondContact O-N 3.1Å; R80-H84 VanDerWaalsContact O-N 3.11Å
81	A	62.8	Low	66.6	Low	71 Å²	71	111.3 Å²	111.3	59%	0.587	60%	0.595	S	S	*	*	H	α-helix	trans	-63.5	-38.7	-178.7	0	0	0	0	0	113.4	S77 M79	S77-A81 PolarHBondContact O-N 3.17Å; M79-A81 VanDerWaalsContact C-N 3.33Å; M79-A81 PolarHBondContact O-N 3.38Å
82	R	61	Low	67.3	Low	204 Å²	204	112.8 Å²	112.8	77%	0.77	61%	0.608	S	S	*	*	H	α-helix	trans	-71.7	-32.7	178.3	-79.2	-179.7	162.9	153.4	-3.1	113.6	V78 M79 R80	V78-R82 PolarHBondContact O-N 3.31Å; M79-R82 PolarHBondContact O-N 3.02Å; R80-R82 PolarHBondContact O-N 3.36Å
83	N	59.5	Low	68.3	Low	83 Å²	83	109 Å²	109	44%	0.444	61%	0.606	S	S	.	*	H	α-helix	trans	-91.1	-11.1	-175.3	-67	-18.8	0	0	0	113.2	M79 R80 H85 G86 I87	M79-N83 WeakPolarHBondContact O-CB 3.32Å; M79-N83 PolarHBondContact O-N 3.48Å; M79-N83 VanDerWaalsContact O-N 3.13Å; M79-N83 PolarHBondContact O-ND2 2.93Å; R80-N83 PolarHBondContact O-N 3.09Å; N83-H85 PolarHBondContact O-N 3.19Å; N83-G86 PolarHBondContact O-N 3.07Å; N83-I87 HydrophobicContact CB-CD1 3.85Å; N83-I87 HydrophobicContact CB-CG2 3.83Å; N83-I87 VanDerWaalsContact O-CG1 3.22Å; N83-I87 WeakPolarHBondContact O-CG1 3.42Å; N83-I87 WeakPolarHBondContact O-CG2 3.33Å; N83-I87 PolarHBondContact O-N 2.83Å
84	H	58	Low	69.3	Low	114 Å²	114	113.3 Å²	113.3	53%	0.528	62%	0.615	S	S	.	*	T	Hydrogen-bonded Turn	trans	-60.4	-17.3	-175.5	-105.1	-55.7	0	0	0	115.2	R80 G86	R80-H84 PolarHBondContact O-CD2 2.68Å; R80-H84 PolarHBondContact O-N 3.1Å; R80-H84 VanDerWaalsContact O-N 3.11Å; H84-G86 VanDerWaalsContact C-N 3.32Å; H84-G86 PolarHBondContact O-N 3.41Å
85	H	58.5	Low	70.5	Confident	201 Å²	201	112.3 Å²	112.3	93%	0.931	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86	11.3	-177.1	-121	65.9	0	0	0	115.3	N83	N83-H85 PolarHBondContact O-N 3.19Å
86	G	61.3	Low	71.8	Confident	49 Å²	49	117.2 Å²	117.2	51%	0.505	64%	0.635	S	S	.	*	T	Hydrogen-bonded Turn	trans	-167.5	-11.5	175.8	0	0	0	0	0	116.8	N83 H84 T90	N83-G86 PolarHBondContact O-N 3.07Å; H84-G86 VanDerWaalsContact C-N 3.32Å; H84-G86 PolarHBondContact O-N 3.41Å; G86-T90 PolarHBondContact O-OG1 2.85Å
87	I	64.6	Low	73.2	Confident	66 Å²	66	118.9 Å²	118.9	34%	0.338	64%	0.642	S	S	.	*	H	α-helix	trans	-74.8	-26.6	179.7	63.8	-178.4	0	0	0	113.9	N83 E89 T90 F91	N83-I87 HydrophobicContact CB-CD1 3.85Å; N83-I87 HydrophobicContact CB-CG2 3.83Å; N83-I87 VanDerWaalsContact O-CG1 3.22Å; N83-I87 WeakPolarHBondContact O-CG1 3.42Å; N83-I87 WeakPolarHBondContact O-CG2 3.33Å; N83-I87 PolarHBondContact O-N 2.83Å; I87-E89 PolarHBondContact O-N 3.33Å; I87-T90 WeakPolarHBondContact O-CB 3.42Å; I87-T90 PolarHBondContact O-N 2.8Å; I87-F91 WeakPolarHBondContact O-CD2 3.28Å
88	D	67.6	Low	74.4	Confident	130 Å²	130	118 Å²	118	70%	0.695	63%	0.634	S	S	*	*	H	α-helix	trans	-69.4	-36.8	-168	-153.2	23.4	0	0	0	111.7
89	E	79	Confident	75.7	Confident	173 Å²	173	120.2 Å²	120.2	81%	0.808	65%	0.648	S	S	*	*	H	α-helix	trans	-79.3	-26.7	174.1	-63.7	-168.9	165.2	0	0	113.1	I87 F91 S92	I87-E89 PolarHBondContact O-N 3.33Å; E89-F91 PolarHBondContact O-N 2.95Å; E89-F91 VanDerWaalsContact O-N 3.15Å; E89-S92 WeakPolarHBondContact O-CB 3.32Å; E89-S92 PolarHBondContact O-N 3.27Å; E89-S92 VanDerWaalsContact O-N 3.1Å
90	T	83.8	Confident	76.7	Confident	101 Å²	101	122.6 Å²	122.6	62%	0.62	66%	0.655	S	S	*	*	H	α-helix	trans	-58.4	-31	-178.9	-59.6	0	0	0	0	112.1	G86 I87	G86-T90 PolarHBondContact O-OG1 2.85Å; I87-T90 WeakPolarHBondContact O-CB 3.42Å; I87-T90 PolarHBondContact O-N 2.8Å
91	F	84.5	Confident	77.3	Confident	130 Å²	130	124.1 Å²	124.1	57%	0.57	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111.1	16.9	-179.1	-57.9	-77.1	0	0	0	113.3	I87 E89 G93 F94	I87-F91 WeakPolarHBondContact O-CD2 3.28Å; E89-F91 PolarHBondContact O-N 2.95Å; E89-F91 VanDerWaalsContact O-N 3.15Å; F91-G93 PolarHBondContact O-N 3.35Å; F91-F94 HydrophobicContact CB-CB 4.18Å; F91-F94 WeakPolarHBondContact O-CB 3.27Å; F91-F94 PolarHBondContact O-N 3.33Å
92	S	87.3	Confident	77.4	Confident	106 Å²	106	127.7 Å²	127.7	74%	0.741	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.5	126.2	172.8	-172.1	0	0	0	0	110.2	E89	E89-S92 WeakPolarHBondContact O-CB 3.32Å; E89-S92 PolarHBondContact O-N 3.27Å; E89-S92 VanDerWaalsContact O-N 3.1Å
93	G	90.1	Very high	77.2	Confident	77 Å²	77	126.7 Å²	126.7	79%	0.794	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	87.5	4.7	-174.6	0	0	0	0	0	115.8	F91	F91-G93 PolarHBondContact O-N 3.35Å
94	F	91	Very high	76.3	Confident	166 Å²	166	131 Å²	131	73%	0.728	72%	0.721	S	S	*	*			trans	-71.1	-33.3	178.1	-173.4	-97.4	0	0	0	113.7	F91	F91-F94 HydrophobicContact CB-CB 4.18Å; F91-F94 WeakPolarHBondContact O-CB 3.27Å; F91-F94 PolarHBondContact O-N 3.33Å
95	S	90.6	Very high	77.2	Confident	118 Å²	118	131.9 Å²	131.9	83%	0.825	73%	0.73	S	S	*	*			trans	-68.9	133.4	-179.2	-59.1	0	0	0	0	111.8
96	Y	91.5	Very high	78.2	Confident	178 Å²	178	128.3 Å²	128.3	70%	0.698	72%	0.72	S	S	*	*			trans	-136.3	137.7	179.7	172.6	-105	0	0	0	111	P98	Y96-P98 HydrophobicContact CD1-CG 4.36Å; Y96-P98 HydrophobicContact CE1-CB 4.12Å; Y96-P98 HydrophobicContact CE1-CG 3.73Å
97	V	91.4	Very high	79.1	Confident	123 Å²	123	132.7 Å²	132.7	75%	0.745	73%	0.732	S	S	*	*			trans	-121.5	122	169.3	-179.9	0	0	0	0	107.5	T99	V97-T99 PolarHBondContact O-N 3.22Å
98	P	90	Very high	80	Confident	72 Å²	72	136.6 Å²	136.6	47%	0.468	76%	0.755	S	S	.	*			trans	-56.8	131.5	176.2	-21.3	29.8	0	0	0	111.9	Y96 K100	Y96-P98 HydrophobicContact CD1-CG 4.36Å; Y96-P98 HydrophobicContact CE1-CB 4.12Å; Y96-P98 HydrophobicContact CE1-CG 3.73Å; P98-K100 PolarHBondContact O-N 2.94Å
99	T	89.5	Confident	80.8	Confident	134 Å²	134	137 Å²	137	82%	0.822	76%	0.758	S	S	*	*	S	Bend	trans	-75.9	-12.4	178.1	58.1	0	0	0	0	113.3	V97	V97-T99 PolarHBondContact O-N 3.22Å
100	K	86.6	Confident	80.9	Confident	163 Å²	163	134.6 Å²	134.6	71%	0.709	76%	0.755	S	S	*	*	S	Bend	trans	-129.3	128.2	176.8	-63.5	-177.2	-179	-179.2	0	109.5	P98 I102	P98-K100 PolarHBondContact O-N 2.94Å; K100-I102 PolarHBondContact O-N 3.06Å
101	N	74.8	Confident	80.7	Confident	147 Å²	147	137 Å²	137	79%	0.786	77%	0.765	S	S	*	*			trans	-71.9	114	164.2	-91.1	-27.9	0	0	0	108.3	H103	N101-H103 PolarHBondContact O-N 2.74Å
102	I	64.3	Low	80.4	Confident	146 Å²	146	137.5 Å²	137.5	75%	0.749	78%	0.78	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.9	12.9	-178.6	-30.2	176.8	0	0	0	111.5	K100	K100-I102 PolarHBondContact O-N 3.06Å
103	H	57.4	Low	79.8	Confident	183 Å²	183	140.2 Å²	140.2	85%	0.847	78%	0.783	S	S	*	*	T	Hydrogen-bonded Turn	trans	-133.7	23.1	-172.8	-63.9	-53.7	0	0	0	114	N101	N101-H103 PolarHBondContact O-N 2.74Å
104	S	40.4	Very low	78.9	Confident	175 Å²	175	145.9 Å²	145.9	100%	1.224	78%	0.782	S	S	*	*			trans	-96.8	0	163.2	-79.9	0	0	0	0	111.4

Retrieved 104 of 104 residues in 41 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).