A0A5K4F7W8_SCHMA Loading...

Ovule protein

AlphaFold DB , UniProt , Accession A0A5K4F7W8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 89 aa.

						>A0A5K4F7W8_SCHMA|A0A5K4F7W8
MKSLVNLRKIFHMNEIVVKYVMLLVSTMLMIAEQALVNMKHKFSICSNLTIVLMVPIQTLFILTIHLLLINVRNMFQTSRILITFHMLL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67.5	Low	78	Confident	201 Å²	201	115.7 Å²	115.7	99%	0.99	56%	0.563	S	S	*	*				0	-52	0	-88.7	-175.9	148.3	0	0	114.3	S3 L4 V5	M1-S3 PolarHBondContact O-N 3.49Å; M1-L4 PolarHBondContact O-N 2.93Å; M1-V5 PolarHBondContact O-N 2.83Å
2	K	78.3	Confident	78.2	Confident	186 Å²	186	115.8 Å²	115.8	81%	0.809	56%	0.561	S	S	*	*	H	α-helix	trans	-57.5	-39.7	-177.6	-72	-179.4	179.7	175.9	0	114.4	V5 N6	K2-V5 PolarHBondContact O-N 3.16Å; K2-N6 PolarHBondContact O-N 3.41Å; K2-N6 VanDerWaalsContact O-N 3.14Å
3	S	79.5	Confident	78.3	Confident	85 Å²	85	115.8 Å²	115.8	59%	0.594	56%	0.561	S	S	*	*	H	α-helix	trans	-60.1	-46.8	178.4	54.9	0	0	0	0	112.9	M1 V5 N6 L7	M1-S3 PolarHBondContact O-N 3.49Å; S3-V5 VanDerWaalsContact C-N 3.34Å; S3-V5 PolarHBondContact O-N 3.06Å; S3-N6 PolarHBondContact O-N 2.75Å; S3-L7 PolarHBondContact O-N 3.49Å
4	L	77.6	Confident	78.4	Confident	91 Å²	91	111.7 Å²	111.7	48%	0.476	54%	0.544	S	S	.	.	H	α-helix	trans	-61.4	-39.4	178.9	-68.9	171.8	0	0	0	112.6	M1 L7 R8 M87	M1-L4 PolarHBondContact O-N 2.93Å; L4-L7 PolarHBondContact O-N 3.45Å; L4-R8 PolarHBondContact O-N 3.32Å; L4-M87 HydrophobicContact CD2-CE 4.03Å; L4-M87 HydrophobicContact CD2-SD 3.37Å; L4-M87 WeakPolarHBondContact CD2-SD 3.37Å
5	V	79.4	Confident	78.6	Confident	81 Å²	81	108.5 Å²	108.5	49%	0.491	53%	0.527	S	S	.	.	H	α-helix	trans	-66.1	-42.4	177.2	176.6	0	0	0	0	110.8	M1 K2 S3 L7 R8 K9	M1-V5 PolarHBondContact O-N 2.83Å; K2-V5 PolarHBondContact O-N 3.16Å; S3-V5 VanDerWaalsContact C-N 3.34Å; S3-V5 PolarHBondContact O-N 3.06Å; V5-L7 VanDerWaalsContact C-N 3.35Å; V5-R8 PolarHBondContact O-N 3.1Å; V5-K9 WeakPolarHBondContact O-CG 3.38Å; V5-K9 PolarHBondContact O-N 3.29Å; V5-K9 VanDerWaalsContact O-N 3.07Å
6	N	80.9	Confident	79	Confident	91 Å²	91	105.3 Å²	105.3	49%	0.487	51%	0.513	S	S	.	.	H	α-helix	trans	-63.7	-41.5	176.2	-74.1	-6.7	0	0	0	111.5	K2 S3 R8 K9 I10	K2-N6 PolarHBondContact O-N 3.41Å; K2-N6 VanDerWaalsContact O-N 3.14Å; S3-N6 PolarHBondContact O-N 2.75Å; N6-R8 PolarHBondContact O-N 2.8Å; N6-K9 PolarHBondContact O-N 3.36Å; N6-I10 VanDerWaalsContact O-CG1 3.31Å; N6-I10 WeakPolarHBondContact O-CG1 3.4Å; N6-I10 PolarHBondContact O-N 2.8Å
7	L	77.1	Confident	79.2	Confident	48 Å²	48	103.9 Å²	103.9	25%	0.251	51%	0.512	S	S	.	.	H	α-helix	trans	-60.8	-44.9	177.2	-140.4	92	0	0	0	111.9	S3 L4 V5 K9 I10 F11 I83 M87	S3-L7 PolarHBondContact O-N 3.49Å; L4-L7 PolarHBondContact O-N 3.45Å; V5-L7 VanDerWaalsContact C-N 3.35Å; L7-K9 VanDerWaalsContact C-N 3.35Å; L7-K9 PolarHBondContact O-N 3.48Å; L7-I10 PolarHBondContact O-N 3.4Å; L7-F11 PolarHBondContact O-N 3.3Å; L7-I83 HydrophobicContact CD2-CG1 4.48Å; L7-I83 HydrophobicContact CD2-CG2 3.39Å; L7-I83 HydrophobicContact CG-CG2 4.46Å; L7-M87 HydrophobicContact CD2-CG 4.47Å; L7-M87 HydrophobicContact CD2-SD 4.28Å
8	R	81.6	Confident	79.3	Confident	200 Å²	200	100 Å²	100	76%	0.755	50%	0.495	S	S	*	.	H	α-helix	trans	-63.2	-39.8	177.4	-170.1	-176.5	-69.5	-172.4	-2.4	112.1	L4 V5 N6 F11 H12	L4-R8 PolarHBondContact O-N 3.32Å; V5-R8 PolarHBondContact O-N 3.1Å; N6-R8 PolarHBondContact O-N 2.8Å; R8-F11 WeakPolarHBondContact O-CB 3.34Å; R8-F11 PolarHBondContact O-N 3.45Å; R8-H12 PolarHBondContact O-N 3.47Å
9	K	81.2	Confident	79.4	Confident	136 Å²	136	101.3 Å²	101.3	59%	0.591	50%	0.497	S	S	*	.	H	α-helix	trans	-62.6	-46.5	174.2	-75	-179.4	179.6	-177.6	0	111.5	V5 N6 L7 F11 H12 M13	V5-K9 WeakPolarHBondContact O-CG 3.38Å; V5-K9 PolarHBondContact O-N 3.29Å; V5-K9 VanDerWaalsContact O-N 3.07Å; N6-K9 PolarHBondContact O-N 3.36Å; L7-K9 VanDerWaalsContact C-N 3.35Å; L7-K9 PolarHBondContact O-N 3.48Å; K9-F11 VanDerWaalsContact C-N 3.27Å; K9-F11 PolarHBondContact O-N 2.93Å; K9-H12 PolarHBondContact O-N 2.9Å; K9-M13 VanDerWaalsContact O-CG 3.29Å; K9-M13 WeakPolarHBondContact O-CG 3.37Å; K9-M13 PolarHBondContact O-N 3.48Å
10	I	80.3	Confident	79.6	Confident	93 Å²	93	104 Å²	104	48%	0.477	50%	0.503	S	S	.	.	H	α-helix	trans	-58.9	-41.5	176.7	-67.3	164.3	0	0	0	110.3	N6 L7 M13 N14	N6-I10 VanDerWaalsContact O-CG1 3.31Å; N6-I10 WeakPolarHBondContact O-CG1 3.4Å; N6-I10 PolarHBondContact O-N 2.8Å; L7-I10 PolarHBondContact O-N 3.4Å; I10-M13 PolarHBondContact O-N 3.35Å; I10-N14 WeakPolarHBondContact O-CB 3.44Å; I10-N14 VanDerWaalsContact O-CG 3.25Å; I10-N14 PolarHBondContact O-N 3.18Å; I10-N14 PolarHBondContact O-OD1 3.39Å
11	F	74.2	Confident	79.8	Confident	61 Å²	61	101.4 Å²	101.4	27%	0.268	49%	0.493	S	S	.	.	H	α-helix	trans	-60.6	-49.6	176.3	-170	-82.8	0	0	0	112.5	L7 R8 K9 M13 N14 E15 F76 R80	L7-F11 PolarHBondContact O-N 3.3Å; R8-F11 WeakPolarHBondContact O-CB 3.34Å; R8-F11 PolarHBondContact O-N 3.45Å; K9-F11 VanDerWaalsContact C-N 3.27Å; K9-F11 PolarHBondContact O-N 2.93Å; F11-M13 VanDerWaalsContact C-N 3.27Å; F11-M13 PolarHBondContact O-N 3.04Å; F11-N14 PolarHBondContact O-N 2.79Å; F11-E15 HydrophobicContact CE1-CB 4.5Å; F11-E15 WeakPolarHBondContact O-CB 3.22Å; F11-E15 PolarHBondContact O-N 3.46Å; F11-F76 HydrophobicContact CZ-CZ 4.21Å; F11-R80 HydrophobicContact CE2-CG 3.82Å; F11-R80 HydrophobicContact CZ-CG 4.17Å
12	H	80.2	Confident	80.6	Confident	116 Å²	116	95.6 Å²	95.6	54%	0.537	46%	0.464	S	S	.	.	H	α-helix	trans	-61	-39.8	-180	-169.6	-93.3	0	0	0	111.2	R8 K9 I16	R8-H12 PolarHBondContact O-N 3.47Å; K9-H12 PolarHBondContact O-N 2.9Å; H12-I16 VanDerWaalsContact CE1-CD1 3.42Å; H12-I16 WeakPolarHBondContact CE1-CD1 3.48Å; H12-I16 WeakPolarHBondContact ND1-CD1 3.41Å; H12-I16 WeakPolarHBondContact O-CB 2.97Å; H12-I16 VanDerWaalsContact O-CG1 3.22Å; H12-I16 WeakPolarHBondContact O-CG1 3.42Å; H12-I16 PolarHBondContact O-N 3.06Å
13	M	80.4	Confident	81	Confident	116 Å²	116	91.8 Å²	91.8	57%	0.571	45%	0.452	S	S	*	.	H	α-helix	trans	-65.5	-44.6	174.3	-65.5	-63.8	-76.4	0	0	111.8	K9 I10 F11 E15 I16 V17	K9-M13 VanDerWaalsContact O-CG 3.29Å; K9-M13 WeakPolarHBondContact O-CG 3.37Å; K9-M13 PolarHBondContact O-N 3.48Å; I10-M13 PolarHBondContact O-N 3.35Å; F11-M13 VanDerWaalsContact C-N 3.27Å; F11-M13 PolarHBondContact O-N 3.04Å; M13-E15 PolarHBondContact O-N 3.04Å; M13-I16 PolarHBondContact O-N 3.19Å; M13-V17 VanDerWaalsContact O-CG2 3.26Å; M13-V17 WeakPolarHBondContact O-CG2 3.48Å; M13-V17 PolarHBondContact O-N 3.04Å
14	N	79.9	Confident	81.2	Confident	59 Å²	59	92.4 Å²	92.4	32%	0.316	45%	0.448	S	S	.	.	H	α-helix	trans	-63	-41	177.5	-74.2	-4.2	0	0	0	111.9	I10 F11 V17 V18 F76	I10-N14 WeakPolarHBondContact O-CB 3.44Å; I10-N14 VanDerWaalsContact O-CG 3.25Å; I10-N14 PolarHBondContact O-N 3.18Å; I10-N14 PolarHBondContact O-OD1 3.39Å; F11-N14 PolarHBondContact O-N 2.79Å; N14-V17 PolarHBondContact O-N 3.15Å; N14-V18 WeakPolarHBondContact O-CB 2.97Å; N14-V18 WeakPolarHBondContact O-CG2 3.09Å; N14-V18 PolarHBondContact O-N 2.87Å; N14-F76 HydrophobicContact CB-CE2 4.31Å
15	E	81.6	Confident	81.5	Confident	64 Å²	64	88.6 Å²	88.6	30%	0.299	43%	0.429	S	S	.	.	H	α-helix	trans	-63	-43.7	176	-171.1	-173.9	155.2	0	0	111.1	F11 M13 V18 K19 F76	F11-E15 HydrophobicContact CE1-CB 4.5Å; F11-E15 WeakPolarHBondContact O-CB 3.22Å; F11-E15 PolarHBondContact O-N 3.46Å; M13-E15 PolarHBondContact O-N 3.04Å; E15-V18 PolarHBondContact O-N 3.24Å; E15-K19 WeakPolarHBondContact O-CG 3.32Å; E15-K19 PolarHBondContact O-N 2.99Å; E15-K19 VanDerWaalsContact OE1-CE 3.24Å; E15-K19 WeakPolarHBondContact OE1-CE 3.39Å; E15-K19 IonicContact OE1-NZ 2.7Å; E15-K19 PolarHBondContact OE1-NZ 3.35Å; E15-F76 HydrophobicContact CB-CE2 4.34Å; E15-F76 HydrophobicContact CB-CZ 4.06Å; E15-F76 HydrophobicContact CG-CZ 4.2Å
16	I	84.1	Confident	81.6	Confident	57 Å²	57	87.7 Å²	87.7	29%	0.292	43%	0.426	S	S	.	.	H	α-helix	trans	-60.1	-48.8	174.3	-73.2	169.2	0	0	0	110.6	H12 M13 V18 K19 Y20	H12-I16 VanDerWaalsContact CE1-CD1 3.42Å; H12-I16 WeakPolarHBondContact CE1-CD1 3.48Å; H12-I16 WeakPolarHBondContact ND1-CD1 3.41Å; H12-I16 WeakPolarHBondContact O-CB 2.97Å; H12-I16 VanDerWaalsContact O-CG1 3.22Å; H12-I16 WeakPolarHBondContact O-CG1 3.42Å; H12-I16 PolarHBondContact O-N 3.06Å; M13-I16 PolarHBondContact O-N 3.19Å; I16-V18 VanDerWaalsContact C-N 3.34Å; I16-V18 PolarHBondContact O-N 3.3Å; I16-K19 PolarHBondContact O-N 3.25Å; I16-Y20 HydrophobicContact CG2-CD2 3.47Å; I16-Y20 VanDerWaalsContact CG2-CD2 3.47Å; I16-Y20 HydrophobicContact CG2-CE2 3.32Å; I16-Y20 WeakPolarHBondContact O-CD2 3.47Å; I16-Y20 PolarHBondContact O-N 3.13Å
17	V	82.5	Confident	81.7	Confident	82 Å²	82	86.5 Å²	86.5	50%	0.497	42%	0.422	S	S	.	.	H	α-helix	trans	-59.1	-45.8	179.1	170.1	0	0	0	0	110.6	M13 N14 K19 Y20 V21	M13-V17 VanDerWaalsContact O-CG2 3.26Å; M13-V17 WeakPolarHBondContact O-CG2 3.48Å; M13-V17 PolarHBondContact O-N 3.04Å; N14-V17 PolarHBondContact O-N 3.15Å; V17-K19 PolarHBondContact O-N 2.88Å; V17-Y20 PolarHBondContact O-N 3.3Å; V17-V21 HydrophobicContact CG1-CG2 4.31Å; V17-V21 VanDerWaalsContact O-CG2 3.31Å; V17-V21 WeakPolarHBondContact O-CG2 3.48Å; V17-V21 PolarHBondContact O-N 3.35Å
18	V	80.7	Confident	82	Confident	33 Å²	33	89 Å²	89	20%	0.2	43%	0.434	C	S	.	.	H	α-helix	trans	-62.7	-42.6	177.1	169.2	0	0	0	0	111.4	N14 E15 I16 Y20 V21 M22 V72 F76	N14-V18 WeakPolarHBondContact O-CB 2.97Å; N14-V18 WeakPolarHBondContact O-CG2 3.09Å; N14-V18 PolarHBondContact O-N 2.87Å; E15-V18 PolarHBondContact O-N 3.24Å; I16-V18 VanDerWaalsContact C-N 3.34Å; I16-V18 PolarHBondContact O-N 3.3Å; V18-Y20 VanDerWaalsContact C-N 3.32Å; V18-Y20 PolarHBondContact O-N 3.46Å; V18-V21 PolarHBondContact O-N 2.86Å; V18-M22 HydrophobicContact CG1-CG 4.15Å; V18-M22 WeakPolarHBondContact O-CB 3.31Å; V18-M22 WeakPolarHBondContact O-CG 3.26Å; V18-M22 PolarHBondContact O-N 2.98Å; V18-V72 HydrophobicContact CG1-CG1 4.21Å; V18-V72 HydrophobicContact CG2-CG1 4.44Å; V18-F76 HydrophobicContact CB-CD2 4.22Å; V18-F76 HydrophobicContact CB-CE2 4.48Å; V18-F76 HydrophobicContact CG2-CB 4.22Å; V18-F76 HydrophobicContact CG2-CD2 3.51Å; V18-F76 HydrophobicContact CG2-CE2 4.12Å; V18-F76 HydrophobicContact CG2-CG 4.08Å
19	K	82.1	Confident	82.1	Confident	125 Å²	125	81.4 Å²	81.4	54%	0.543	41%	0.408	S	S	.	.	H	α-helix	trans	-59.1	-43.4	174.7	-76	176.4	-175.9	168.2	0	111.7	E15 I16 V17 M22 L23	E15-K19 WeakPolarHBondContact O-CG 3.32Å; E15-K19 PolarHBondContact O-N 2.99Å; E15-K19 VanDerWaalsContact OE1-CE 3.24Å; E15-K19 WeakPolarHBondContact OE1-CE 3.39Å; E15-K19 IonicContact OE1-NZ 2.7Å; E15-K19 PolarHBondContact OE1-NZ 3.35Å; I16-K19 PolarHBondContact O-N 3.25Å; V17-K19 PolarHBondContact O-N 2.88Å; K19-M22 PolarHBondContact O-N 3.02Å; K19-L23 WeakPolarHBondContact O-CB 3.5Å; K19-L23 PolarHBondContact O-N 3.47Å
20	Y	83.7	Confident	82.1	Confident	155 Å²	155	80.5 Å²	80.5	61%	0.608	41%	0.407	S	S	*	.	H	α-helix	trans	-66	-41.6	176.5	-80.9	-64.6	0	0	0	112.8	I16 V17 V18 L23 L24	I16-Y20 HydrophobicContact CG2-CD2 3.47Å; I16-Y20 VanDerWaalsContact CG2-CD2 3.47Å; I16-Y20 HydrophobicContact CG2-CE2 3.32Å; I16-Y20 WeakPolarHBondContact O-CD2 3.47Å; I16-Y20 PolarHBondContact O-N 3.13Å; V17-Y20 PolarHBondContact O-N 3.3Å; V18-Y20 VanDerWaalsContact C-N 3.32Å; V18-Y20 PolarHBondContact O-N 3.46Å; Y20-L23 PolarHBondContact O-N 3.21Å; Y20-L24 VanDerWaalsContact O-CB 3.29Å; Y20-L24 WeakPolarHBondContact O-CB 3.46Å; Y20-L24 PolarHBondContact O-N 2.92Å
21	V	84	Confident	82.3	Confident	49 Å²	49	80.8 Å²	80.8	30%	0.297	41%	0.409	S	S	.	.	H	α-helix	trans	-63.2	-44.9	175.6	172.4	0	0	0	0	110.3	V17 V18 L23 L24 V25 V72	V17-V21 HydrophobicContact CG1-CG2 4.31Å; V17-V21 VanDerWaalsContact O-CG2 3.31Å; V17-V21 WeakPolarHBondContact O-CG2 3.48Å; V17-V21 PolarHBondContact O-N 3.35Å; V18-V21 PolarHBondContact O-N 2.86Å; V21-L23 VanDerWaalsContact C-N 3.34Å; V21-L23 PolarHBondContact O-N 2.99Å; V21-L24 PolarHBondContact O-N 2.72Å; V21-V25 HydrophobicContact CG1-CG2 4.26Å; V21-V25 WeakPolarHBondContact O-CB 3.39Å; V21-V25 WeakPolarHBondContact O-CG2 3.41Å; V21-V25 PolarHBondContact O-N 3.38Å; V21-V72 HydrophobicContact CG1-CG1 4.09Å; V21-V72 HydrophobicContact CG1-CG2 3.94Å
22	M	83.8	Confident	82.5	Confident	80 Å²	80	79.1 Å²	79.1	39%	0.394	41%	0.406	S	S	.	.	H	α-helix	trans	-60.8	-43.1	176.4	-70.1	-68.3	-63.6	0	0	111.8	V18 K19 V25 S26 L69	V18-M22 HydrophobicContact CG1-CG 4.15Å; V18-M22 WeakPolarHBondContact O-CB 3.31Å; V18-M22 WeakPolarHBondContact O-CG 3.26Å; V18-M22 PolarHBondContact O-N 2.98Å; K19-M22 PolarHBondContact O-N 3.02Å; M22-V25 PolarHBondContact O-N 2.92Å; M22-S26 WeakPolarHBondContact O-CB 3.15Å; M22-S26 PolarHBondContact O-N 3.23Å; M22-L69 HydrophobicContact CE-CD2 3.68Å; M22-L69 HydrophobicContact SD-CD2 3.42Å; M22-L69 WeakPolarHBondContact SD-CD2 3.31Å
23	L	85.3	Confident	82.6	Confident	105 Å²	105	77.6 Å²	77.6	55%	0.55	40%	0.4	S	S	.	.	H	α-helix	trans	-64.4	-45.1	176.6	-178	64.6	0	0	0	111.6	K19 Y20 V21 V25 S26 T27	K19-L23 WeakPolarHBondContact O-CB 3.5Å; K19-L23 PolarHBondContact O-N 3.47Å; Y20-L23 PolarHBondContact O-N 3.21Å; V21-L23 VanDerWaalsContact C-N 3.34Å; V21-L23 PolarHBondContact O-N 2.99Å; L23-V25 PolarHBondContact O-N 2.99Å; L23-S26 PolarHBondContact O-N 3.47Å; L23-T27 WeakPolarHBondContact O-CB 3.28Å; L23-T27 PolarHBondContact O-N 2.91Å; L23-T27 PolarHBondContact O-OG1 3.41Å
24	L	84.7	Confident	82.6	Confident	98 Å²	98	77.5 Å²	77.5	51%	0.513	40%	0.397	S	S	.	.	H	α-helix	trans	-59.5	-47.4	177	179.9	65.1	0	0	0	110.8	Y20 V21 T27 M28	Y20-L24 VanDerWaalsContact O-CB 3.29Å; Y20-L24 WeakPolarHBondContact O-CB 3.46Å; Y20-L24 PolarHBondContact O-N 2.92Å; V21-L24 PolarHBondContact O-N 2.72Å; L24-T27 PolarHBondContact O-N 3.48Å; L24-M28 HydrophobicContact CD1-CE 3.92Å; L24-M28 VanDerWaalsContact O-CG 3.28Å; L24-M28 WeakPolarHBondContact O-CG 3.34Å; L24-M28 PolarHBondContact O-N 2.84Å
25	V	82.8	Confident	82.6	Confident	12 Å²	12	77 Å²	77	7%	0.073	40%	0.402	C	S	.	.	H	α-helix	trans	-64.5	-42.5	179.3	175.7	0	0	0	0	111.3	V21 M22 L23 T27 M28 L29 I65 L68 L69	V21-V25 HydrophobicContact CG1-CG2 4.26Å; V21-V25 WeakPolarHBondContact O-CB 3.39Å; V21-V25 WeakPolarHBondContact O-CG2 3.41Å; V21-V25 PolarHBondContact O-N 3.38Å; M22-V25 PolarHBondContact O-N 2.92Å; L23-V25 PolarHBondContact O-N 2.99Å; V25-T27 VanDerWaalsContact C-N 3.33Å; V25-T27 PolarHBondContact O-N 2.95Å; V25-M28 PolarHBondContact O-N 3.49Å; V25-L29 WeakPolarHBondContact O-CB 3.4Å; V25-L29 PolarHBondContact O-N 2.94Å; V25-I65 HydrophobicContact CG1-CG2 3.56Å; V25-L68 HydrophobicContact CG2-CD2 3.97Å; V25-L69 HydrophobicContact CB-CD2 3.91Å; V25-L69 HydrophobicContact CG1-CD1 4.06Å; V25-L69 HydrophobicContact CG1-CD2 3.53Å; V25-L69 HydrophobicContact CG1-CG 3.64Å
26	S	82.5	Confident	82.1	Confident	62 Å²	62	75.5 Å²	75.5	43%	0.434	40%	0.396	S	S	.	.	H	α-helix	trans	-61.6	-41.5	174.8	-173.1	0	0	0	0	112	M22 L23 L29 M30	M22-S26 WeakPolarHBondContact O-CB 3.15Å; M22-S26 PolarHBondContact O-N 3.23Å; L23-S26 PolarHBondContact O-N 3.47Å; S26-L29 WeakPolarHBondContact O-CB 3.41Å; S26-L29 PolarHBondContact O-N 2.97Å; S26-M30 WeakPolarHBondContact O-CG 3.33Å; S26-M30 PolarHBondContact O-N 3.41Å
27	T	83.8	Confident	81.8	Confident	66 Å²	66	76.8 Å²	76.8	41%	0.405	41%	0.406	S	S	.	.	H	α-helix	trans	-64.5	-43.3	176.9	-54.7	0	0	0	0	111.2	L23 L24 V25 L29 M30 I31	L23-T27 WeakPolarHBondContact O-CB 3.28Å; L23-T27 PolarHBondContact O-N 2.91Å; L23-T27 PolarHBondContact O-OG1 3.41Å; L24-T27 PolarHBondContact O-N 3.48Å; V25-T27 VanDerWaalsContact C-N 3.33Å; V25-T27 PolarHBondContact O-N 2.95Å; T27-L29 VanDerWaalsContact C-N 3.32Å; T27-L29 PolarHBondContact O-N 3.43Å; T27-M30 PolarHBondContact O-N 3.49Å; T27-I31 HydrophobicContact CG2-CD1 3.95Å; T27-I31 VanDerWaalsContact O-CG1 3.25Å; T27-I31 WeakPolarHBondContact O-CG1 3.14Å; T27-I31 PolarHBondContact O-N 3.28Å
28	M	82.5	Confident	81.4	Confident	100 Å²	100	77 Å²	77	49%	0.493	41%	0.405	S	S	.	.	H	α-helix	trans	-64.2	-37.9	176	-68.9	-65.3	174	0	0	111.9	L24 V25 I31 A32	L24-M28 HydrophobicContact CD1-CE 3.92Å; L24-M28 VanDerWaalsContact O-CG 3.28Å; L24-M28 WeakPolarHBondContact O-CG 3.34Å; L24-M28 PolarHBondContact O-N 2.84Å; V25-M28 PolarHBondContact O-N 3.49Å; M28-I31 PolarHBondContact O-N 3.16Å; M28-A32 WeakPolarHBondContact O-CB 3.48Å; M28-A32 PolarHBondContact O-N 3.41Å
29	L	83	Confident	81	Confident	40 Å²	40	79.7 Å²	79.7	21%	0.209	42%	0.416	C	S	.	.	H	α-helix	trans	-62.3	-49.3	174.3	-177.6	64.2	0	0	0	111	V25 S26 T27 I31 A32 E33 I62 I65	V25-L29 WeakPolarHBondContact O-CB 3.4Å; V25-L29 PolarHBondContact O-N 2.94Å; S26-L29 WeakPolarHBondContact O-CB 3.41Å; S26-L29 PolarHBondContact O-N 2.97Å; T27-L29 VanDerWaalsContact C-N 3.32Å; T27-L29 PolarHBondContact O-N 3.43Å; L29-I31 VanDerWaalsContact C-N 3.34Å; L29-I31 PolarHBondContact O-N 2.89Å; L29-A32 PolarHBondContact O-N 3.31Å; L29-A32 VanDerWaalsContact O-N 3.16Å; L29-E33 HydrophobicContact CD1-CG 4.47Å; L29-E33 WeakPolarHBondContact O-CG 3.43Å; L29-E33 PolarHBondContact O-N 2.89Å; L29-I62 HydrophobicContact CD1-CG1 4.46Å; L29-I65 HydrophobicContact CB-CD1 4.15Å; L29-I65 HydrophobicContact CB-CG2 4.42Å; L29-I65 HydrophobicContact CD1-CD1 3.96Å; L29-I65 HydrophobicContact CD1-CG2 4.28Å
30	M	82.9	Confident	80.5	Confident	117 Å²	117	79 Å²	79	58%	0.576	41%	0.413	S	S	*	.	H	α-helix	trans	-59.2	-43.3	177.4	-72.3	-69.3	-64	0	0	112.2	S26 T27 A32 E33 Q34	S26-M30 WeakPolarHBondContact O-CG 3.33Å; S26-M30 PolarHBondContact O-N 3.41Å; T27-M30 PolarHBondContact O-N 3.49Å; M30-A32 VanDerWaalsContact C-N 3.33Å; M30-A32 PolarHBondContact O-N 3.41Å; M30-E33 PolarHBondContact O-N 3.47Å; M30-Q34 WeakPolarHBondContact O-CB 3.25Å; M30-Q34 PolarHBondContact O-N 2.87Å
31	I	83.5	Confident	79.8	Confident	99 Å²	99	78.1 Å²	78.1	51%	0.508	41%	0.414	S	S	.	.	H	α-helix	trans	-62.7	-43.3	176.8	-69.4	166.4	0	0	0	110.4	T27 M28 L29 Q34 A35	T27-I31 HydrophobicContact CG2-CD1 3.95Å; T27-I31 VanDerWaalsContact O-CG1 3.25Å; T27-I31 WeakPolarHBondContact O-CG1 3.14Å; T27-I31 PolarHBondContact O-N 3.28Å; M28-I31 PolarHBondContact O-N 3.16Å; L29-I31 VanDerWaalsContact C-N 3.34Å; L29-I31 PolarHBondContact O-N 2.89Å; I31-Q34 PolarHBondContact O-N 3.5Å; I31-A35 VanDerWaalsContact O-CB 3.26Å; I31-A35 WeakPolarHBondContact O-CB 3.31Å; I31-A35 PolarHBondContact O-N 3.28Å
32	A	79.2	Confident	79.1	Confident	26 Å²	26	82.7 Å²	82.7	22%	0.215	43%	0.43	C	S	.	.	H	α-helix	trans	-67	-40.3	178.7	0	0	0	0	0	112.5	M28 L29 M30 L36 F61	M28-A32 WeakPolarHBondContact O-CB 3.48Å; M28-A32 PolarHBondContact O-N 3.41Å; L29-A32 PolarHBondContact O-N 3.31Å; L29-A32 VanDerWaalsContact O-N 3.16Å; M30-A32 VanDerWaalsContact C-N 3.33Å; M30-A32 PolarHBondContact O-N 3.41Å; A32-L36 WeakPolarHBondContact O-CB 3.45Å; A32-L36 PolarHBondContact O-N 3.47Å; A32-F61 HydrophobicContact CB-CD1 3.85Å; A32-F61 HydrophobicContact CB-CE1 3.15Å; A32-F61 HydrophobicContact CB-CZ 3.86Å
33	E	81	Confident	78.2	Confident	85 Å²	85	81.2 Å²	81.2	40%	0.397	42%	0.421	S	S	.	.	H	α-helix	trans	-63.1	-42.6	173.8	-74.5	-177.1	171.5	0	0	111.7	L29 M30 L36 V37	L29-E33 HydrophobicContact CD1-CG 4.47Å; L29-E33 WeakPolarHBondContact O-CG 3.43Å; L29-E33 PolarHBondContact O-N 2.89Å; M30-E33 PolarHBondContact O-N 3.47Å; E33-L36 VanDerWaalsContact O-CB 3.31Å; E33-L36 WeakPolarHBondContact O-CB 3.37Å; E33-L36 PolarHBondContact O-N 3.32Å; E33-V37 WeakPolarHBondContact O-CG2 3.46Å; E33-V37 PolarHBondContact O-N 3.34Å
34	Q	81.9	Confident	77.2	Confident	113 Å²	113	80.6 Å²	80.6	53%	0.528	43%	0.426	S	S	.	.	H	α-helix	trans	-68.3	-44.7	177.6	-169.3	65.8	23	0	0	112	M30 I31 L36 V37 N38	M30-Q34 WeakPolarHBondContact O-CB 3.25Å; M30-Q34 PolarHBondContact O-N 2.87Å; I31-Q34 PolarHBondContact O-N 3.5Å; Q34-L36 PolarHBondContact O-N 2.91Å; Q34-V37 PolarHBondContact O-N 3.27Å; Q34-N38 WeakPolarHBondContact O-CB 3.45Å; Q34-N38 PolarHBondContact O-N 2.77Å
35	A	78.3	Confident	76.3	Confident	49 Å²	49	82.6 Å²	82.6	41%	0.405	44%	0.436	S	S	.	.	H	α-helix	trans	-57.9	-37.2	173.2	0	0	0	0	0	110.5	I31 N38 M39	I31-A35 VanDerWaalsContact O-CB 3.26Å; I31-A35 WeakPolarHBondContact O-CB 3.31Å; I31-A35 PolarHBondContact O-N 3.28Å; A35-N38 PolarHBondContact O-N 2.9Å; A35-M39 WeakPolarHBondContact O-CB 3.32Å; A35-M39 VanDerWaalsContact O-CG 3.22Å; A35-M39 WeakPolarHBondContact O-CG 3.29Å; A35-M39 PolarHBondContact O-N 3.22Å
36	L	72.5	Confident	75.2	Confident	33 Å²	33	85.5 Å²	85.5	17%	0.173	46%	0.455	C	S	.	.	H	α-helix	trans	-66.3	-48.3	175.5	172.1	58.6	0	0	0	113	A32 E33 Q34 N38 M39 K40 Q58	A32-L36 WeakPolarHBondContact O-CB 3.45Å; A32-L36 PolarHBondContact O-N 3.47Å; E33-L36 VanDerWaalsContact O-CB 3.31Å; E33-L36 WeakPolarHBondContact O-CB 3.37Å; E33-L36 PolarHBondContact O-N 3.32Å; Q34-L36 PolarHBondContact O-N 2.91Å; L36-N38 PolarHBondContact O-N 2.92Å; L36-M39 PolarHBondContact O-N 3.47Å; L36-M39 VanDerWaalsContact O-N 3.15Å; L36-K40 HydrophobicContact CD1-CD 4.25Å; L36-K40 HydrophobicContact CD1-CG 3.97Å; L36-K40 HydrophobicContact CG-CD 4.37Å; L36-K40 HydrophobicContact CG-CG 4.5Å; L36-K40 WeakPolarHBondContact O-CB 3.46Å; L36-K40 PolarHBondContact O-N 3.33Å; L36-Q58 HydrophobicContact CD1-CG 3.58Å; L36-Q58 HydrophobicContact CD2-CB 4.3Å; L36-Q58 HydrophobicContact CD2-CG 3.76Å; L36-Q58 HydrophobicContact CG-CG 4.27Å
37	V	76.5	Confident	74.2	Confident	84 Å²	84	86.7 Å²	86.7	51%	0.509	46%	0.464	S	S	.	.	H	α-helix	trans	-56.9	-43.1	175.8	171.6	0	0	0	0	110.2	E33 Q34 M39 K40 H41	E33-V37 WeakPolarHBondContact O-CG2 3.46Å; E33-V37 PolarHBondContact O-N 3.34Å; Q34-V37 PolarHBondContact O-N 3.27Å; V37-M39 PolarHBondContact O-N 2.92Å; V37-K40 PolarHBondContact O-N 2.93Å; V37-H41 WeakPolarHBondContact O-CB 3.4Å; V37-H41 PolarHBondContact O-N 2.91Å
38	N	75.5	Confident	73.3	Confident	87 Å²	87	89.8 Å²	89.8	47%	0.465	48%	0.478	S	S	.	.	H	α-helix	trans	-62.4	-42.3	176.5	-72.2	-8.8	0	0	0	112.5	Q34 A35 L36 H41 K42	Q34-N38 WeakPolarHBondContact O-CB 3.45Å; Q34-N38 PolarHBondContact O-N 2.77Å; A35-N38 PolarHBondContact O-N 2.9Å; L36-N38 PolarHBondContact O-N 2.92Å; N38-H41 PolarHBondContact O-N 2.91Å; N38-K42 WeakPolarHBondContact O-CG 3.36Å; N38-K42 PolarHBondContact O-N 2.87Å
39	M	72.6	Confident	72.3	Confident	88 Å²	88	91.3 Å²	91.3	43%	0.433	49%	0.487	S	S	.	.	H	α-helix	trans	-67.1	-47	176.3	-73.8	-65.7	-121.4	0	0	111.3	A35 L36 V37 H41 K42 F43	A35-M39 WeakPolarHBondContact O-CB 3.32Å; A35-M39 VanDerWaalsContact O-CG 3.22Å; A35-M39 WeakPolarHBondContact O-CG 3.29Å; A35-M39 PolarHBondContact O-N 3.22Å; L36-M39 PolarHBondContact O-N 3.47Å; L36-M39 VanDerWaalsContact O-N 3.15Å; V37-M39 PolarHBondContact O-N 2.92Å; M39-H41 PolarHBondContact O-N 3.39Å; M39-K42 PolarHBondContact O-N 3.48Å; M39-K42 VanDerWaalsContact O-N 3.1Å; M39-F43 HydrophobicContact CB-CD2 3.96Å; M39-F43 HydrophobicContact CB-CE2 3.85Å; M39-F43 HydrophobicContact CE-CE2 4.08Å; M39-F43 HydrophobicContact CE-CZ 4.36Å; M39-F43 HydrophobicContact CG-CE2 4.29Å; M39-F43 WeakPolarHBondContact O-CB 3.28Å; M39-F43 WeakPolarHBondContact O-CD2 3.4Å; M39-F43 WeakPolarHBondContact O-CG 3.42Å; M39-F43 PolarHBondContact O-N 3Å; M39-F43 HydrophobicContact SD-CE2 3.77Å; M39-F43 HydrophobicContact SD-CZ 4.31Å
40	K	71	Confident	71.3	Confident	110 Å²	110	91.3 Å²	91.3	48%	0.478	49%	0.489	S	S	.	.	H	α-helix	trans	-55.4	-41.1	174.7	-78.9	-176.9	176.5	177.7	0	111.4	L36 V37 F43 S44	L36-K40 HydrophobicContact CD1-CD 4.25Å; L36-K40 HydrophobicContact CD1-CG 3.97Å; L36-K40 HydrophobicContact CG-CD 4.37Å; L36-K40 HydrophobicContact CG-CG 4.5Å; L36-K40 WeakPolarHBondContact O-CB 3.46Å; L36-K40 PolarHBondContact O-N 3.33Å; V37-K40 PolarHBondContact O-N 2.93Å; K40-F43 PolarHBondContact O-N 2.84Å; K40-S44 WeakPolarHBondContact O-CB 3.41Å; K40-S44 PolarHBondContact O-N 3.31Å
41	H	68.2	Low	70.3	Confident	138 Å²	138	89.3 Å²	89.3	64%	0.639	48%	0.48	S	S	*	.	H	α-helix	trans	-63.6	-46.7	175.3	-173.5	-85.1	0	0	0	112.2	V37 N38 M39 F43	V37-H41 WeakPolarHBondContact O-CB 3.4Å; V37-H41 PolarHBondContact O-N 2.91Å; N38-H41 PolarHBondContact O-N 2.91Å; M39-H41 PolarHBondContact O-N 3.39Å; H41-F43 VanDerWaalsContact C-N 3.33Å; H41-F43 PolarHBondContact O-N 3.44Å
42	K	70.4	Confident	69.5	Low	144 Å²	144	89.3 Å²	89.3	63%	0.626	49%	0.485	S	S	*	.	H	α-helix	trans	-62.6	-38.2	175.5	-72.3	-179.1	178.9	-176.8	0	112.4	N38 M39	N38-K42 WeakPolarHBondContact O-CG 3.36Å; N38-K42 PolarHBondContact O-N 2.87Å; M39-K42 PolarHBondContact O-N 3.48Å; M39-K42 VanDerWaalsContact O-N 3.1Å
43	F	64.6	Low	69	Low	49 Å²	49	93.6 Å²	93.6	22%	0.215	50%	0.503	C	S	.	.	H	α-helix	trans	-83.8	-20.9	-177.9	-68.1	-58.1	0	0	0	114.2	M39 K40 H41 I45 C46 T50 M54	M39-F43 HydrophobicContact CB-CD2 3.96Å; M39-F43 HydrophobicContact CB-CE2 3.85Å; M39-F43 HydrophobicContact CE-CE2 4.08Å; M39-F43 HydrophobicContact CE-CZ 4.36Å; M39-F43 HydrophobicContact CG-CE2 4.29Å; M39-F43 WeakPolarHBondContact O-CB 3.28Å; M39-F43 WeakPolarHBondContact O-CD2 3.4Å; M39-F43 WeakPolarHBondContact O-CG 3.42Å; M39-F43 PolarHBondContact O-N 3Å; M39-F43 HydrophobicContact SD-CE2 3.77Å; M39-F43 HydrophobicContact SD-CZ 4.31Å; K40-F43 PolarHBondContact O-N 2.84Å; H41-F43 VanDerWaalsContact C-N 3.33Å; H41-F43 PolarHBondContact O-N 3.44Å; F43-I45 PolarHBondContact O-N 3.44Å; F43-I45 VanDerWaalsContact O-N 3.16Å; F43-C46 HydrophobicContact CD1-CB 4.42Å; F43-C46 CarbonylContact O-C 3.12Å; F43-C46 WeakPolarHBondContact O-CA 3.31Å; F43-C46 PolarHBondContact O-N 3.36Å; F43-T50 HydrophobicContact CD1-CG2 3.27Å; F43-T50 HydrophobicContact CD2-CG2 4.46Å; F43-T50 HydrophobicContact CE1-CG2 3.4Å; F43-T50 HydrophobicContact CG-CG2 3.86Å; F43-T50 HydrophobicContact CZ-CG2 4.09Å; F43-M54 HydrophobicContact CE2-CG 4.38Å
44	S	63.3	Low	68.3	Low	93 Å²	93	92.4 Å²	92.4	65%	0.65	50%	0.498	S	S	*	.	H	α-helix	trans	-54.5	-31.9	168.9	-171.6	0	0	0	0	111.1	K40	K40-S44 WeakPolarHBondContact O-CB 3.41Å; K40-S44 PolarHBondContact O-N 3.31Å
45	I	66.8	Low	67.8	Low	140 Å²	140	90.2 Å²	90.2	72%	0.718	49%	0.492	S	S	*	.	S	Bend	trans	-74.4	-30.3	173.8	-54.2	173.5	0	0	0	111.6	F43	F43-I45 PolarHBondContact O-N 3.44Å; F43-I45 VanDerWaalsContact O-N 3.16Å
46	C	60	Low	67.5	Low	72 Å²	72	91 Å²	91	49%	0.486	49%	0.493	S	S	.	.	S	Bend	trans	-105.9	82.8	-179.2	-79.6	0	0	0	0	111.8	F43 T50	F43-C46 HydrophobicContact CD1-CB 4.42Å; F43-C46 CarbonylContact O-C 3.12Å; F43-C46 WeakPolarHBondContact O-CA 3.31Å; F43-C46 PolarHBondContact O-N 3.36Å; C46-T50 PolarHBondContact O-OG1 3.43Å
47	S	61.3	Low	67.6	Low	87 Å²	87	94.3 Å²	94.3	61%	0.608	51%	0.51	S	S	*	.			trans	42.3	137.1	158.8	176.8	0	0	0	0	118.6	L49 T50	S47-L49 PolarHBondContact O-N 2.83Å; S47-T50 PolarHBondContact O-N 2.91Å
48	N	64.4	Low	67.2	Low	132 Å²	132	91.8 Å²	91.8	71%	0.706	49%	0.493	S	S	*	.	H	α-helix	trans	-42	-26.9	179.3	-74.3	-11.2	0	0	0	116.2	T50 I51	N48-T50 PolarHBondContact O-N 3.3Å; N48-I51 PolarHBondContact O-N 2.85Å
49	L	62.7	Low	67.3	Low	131 Å²	131	91.8 Å²	91.8	69%	0.686	50%	0.496	S	S	*	.	H	α-helix	trans	-64.3	-37.5	-179.5	-158.1	72.8	0	0	0	113.6	S47 I51 V52	S47-L49 PolarHBondContact O-N 2.83Å; L49-I51 VanDerWaalsContact C-N 3.32Å; L49-I51 PolarHBondContact O-N 3.35Å; L49-V52 PolarHBondContact O-N 2.84Å
50	T	61.1	Low	67.6	Low	40 Å²	40	92.8 Å²	92.8	25%	0.245	50%	0.503	C	S	.	.	H	α-helix	trans	-71.6	-30.9	-177.4	-32.2	0	0	0	0	112	F43 C46 S47 N48 V52 M54	F43-T50 HydrophobicContact CD1-CG2 3.27Å; F43-T50 HydrophobicContact CD2-CG2 4.46Å; F43-T50 HydrophobicContact CE1-CG2 3.4Å; F43-T50 HydrophobicContact CG-CG2 3.86Å; F43-T50 HydrophobicContact CZ-CG2 4.09Å; C46-T50 PolarHBondContact O-OG1 3.43Å; S47-T50 PolarHBondContact O-N 2.91Å; N48-T50 PolarHBondContact O-N 3.3Å; T50-V52 VanDerWaalsContact C-N 3.33Å; T50-V52 PolarHBondContact O-N 3.27Å; T50-M54 WeakPolarHBondContact O-CG 3.32Å; T50-M54 PolarHBondContact O-N 3.33Å
51	I	61.8	Low	68	Low	75 Å²	75	92.3 Å²	92.3	39%	0.385	50%	0.501	S	S	.	.	H	α-helix	trans	-62.7	-42.6	176.6	-60	174.6	0	0	0	110.1	N48 L49 L53 M54 V55	N48-I51 PolarHBondContact O-N 2.85Å; L49-I51 VanDerWaalsContact C-N 3.32Å; L49-I51 PolarHBondContact O-N 3.35Å; I51-L53 PolarHBondContact O-N 2.9Å; I51-M54 PolarHBondContact O-N 3.46Å; I51-V55 HydrophobicContact CG2-CG2 4.36Å; I51-V55 VanDerWaalsContact O-CG2 3.32Å; I51-V55 WeakPolarHBondContact O-CG2 3.36Å; I51-V55 PolarHBondContact O-N 3.1Å
52	V	66.4	Low	68.6	Low	100 Å²	100	89.1 Å²	89.1	61%	0.606	49%	0.488	S	S	*	.	H	α-helix	trans	-62.9	-39.8	-176.9	176.1	0	0	0	0	112.4	L49 T50 P56	L49-V52 PolarHBondContact O-N 2.84Å; T50-V52 VanDerWaalsContact C-N 3.33Å; T50-V52 PolarHBondContact O-N 3.27Å; V52-P56 WeakPolarHBondContact O-CD 3.39Å
53	L	68.3	Low	69.1	Low	115 Å²	115	86.9 Å²	86.9	60%	0.602	48%	0.482	S	S	*	.	H	α-helix	trans	-75.5	-30.3	179.9	-70.9	170.8	0	0	0	113	I51 P56	I51-L53 PolarHBondContact O-N 2.9Å; L53-P56 WeakPolarHBondContact O-CD 3.41Å; L53-P56 WeakPolarHBondContact O-CG 3.2Å
54	M	66.4	Low	69.9	Low	61 Å²	61	88.8 Å²	88.8	30%	0.3	50%	0.498	S	S	.	.	H	α-helix	trans	-79.1	-34.4	-176.6	-70.1	-69.4	120.7	0	0	112.4	F43 T50 I51 I57 Q58	F43-M54 HydrophobicContact CE2-CG 4.38Å; T50-M54 WeakPolarHBondContact O-CG 3.32Å; T50-M54 PolarHBondContact O-N 3.33Å; I51-M54 PolarHBondContact O-N 3.46Å; M54-I57 HydrophobicContact CE-CD1 3.94Å; M54-I57 PolarHBondContact O-N 3.27Å; M54-Q58 VanDerWaalsContact CB-NE2 3.3Å; M54-Q58 WeakPolarHBondContact O-CG 3.35Å; M54-Q58 PolarHBondContact O-N 3.22Å; M54-Q58 PolarHBondContact O-NE2 2.97Å
55	V	70.9	Confident	70.7	Confident	66 Å²	66	85.1 Å²	85.1	40%	0.4	47%	0.471	S	S	.	.	H	α-helix	trans	-53.4	-50	178	171.5	0	0	0	0	113.7	I51 I57 Q58 T59	I51-V55 HydrophobicContact CG2-CG2 4.36Å; I51-V55 VanDerWaalsContact O-CG2 3.32Å; I51-V55 WeakPolarHBondContact O-CG2 3.36Å; I51-V55 PolarHBondContact O-N 3.1Å; V55-I57 PolarHBondContact O-N 3.47Å; V55-Q58 WeakPolarHBondContact O-CB 3.21Å; V55-Q58 PolarHBondContact O-N 2.92Å; V55-T59 PolarHBondContact O-N 3.47Å; V55-T59 PolarHBondContact O-OG1 2.92Å; V55-T59 VanDerWaalsContact O-OG1 3.13Å
56	P	71.9	Confident	71.5	Confident	66 Å²	66	83.7 Å²	83.7	43%	0.429	46%	0.461	S	S	.	.	H	α-helix	trans	-67.1	-38	-179	22	-31.1	0	0	0	113	V52 L53 Q58 T59 L60	V52-P56 WeakPolarHBondContact O-CD 3.39Å; L53-P56 WeakPolarHBondContact O-CD 3.41Å; L53-P56 WeakPolarHBondContact O-CG 3.2Å; P56-Q58 PolarHBondContact O-N 3.46Å; P56-T59 PolarHBondContact O-N 3.42Å; P56-L60 WeakPolarHBondContact O-CB 3.36Å; P56-L60 WeakPolarHBondContact O-CD1 3.17Å; P56-L60 PolarHBondContact O-N 3.28Å
57	I	75.7	Confident	72.4	Confident	102 Å²	102	84.5 Å²	84.5	52%	0.523	46%	0.46	S	S	.	.	H	α-helix	trans	-60.4	-38.2	174.7	-62.7	171.8	0	0	0	110	M54 V55 F61	M54-I57 HydrophobicContact CE-CD1 3.94Å; M54-I57 PolarHBondContact O-N 3.27Å; V55-I57 PolarHBondContact O-N 3.47Å; I57-F61 PolarHBondContact O-N 2.85Å
58	Q	68.1	Low	73.4	Confident	32 Å²	32	84.6 Å²	84.6	15%	0.15	45%	0.453	C	S	.	.	H	α-helix	trans	-66.6	-48	176.8	-65	153.7	29.1	0	0	112.2	L36 M54 V55 P56 L60 F61 I62	L36-Q58 HydrophobicContact CD1-CG 3.58Å; L36-Q58 HydrophobicContact CD2-CB 4.3Å; L36-Q58 HydrophobicContact CD2-CG 3.76Å; L36-Q58 HydrophobicContact CG-CG 4.27Å; M54-Q58 VanDerWaalsContact CB-NE2 3.3Å; M54-Q58 WeakPolarHBondContact O-CG 3.35Å; M54-Q58 PolarHBondContact O-N 3.22Å; M54-Q58 PolarHBondContact O-NE2 2.97Å; V55-Q58 WeakPolarHBondContact O-CB 3.21Å; V55-Q58 PolarHBondContact O-N 2.92Å; P56-Q58 PolarHBondContact O-N 3.46Å; Q58-L60 VanDerWaalsContact C-N 3.27Å; Q58-L60 PolarHBondContact O-N 3.43Å; Q58-F61 PolarHBondContact O-N 3.34Å; Q58-I62 WeakPolarHBondContact O-CG1 3.39Å; Q58-I62 PolarHBondContact O-N 3.28Å
59	T	76.9	Confident	74.2	Confident	87 Å²	87	80.1 Å²	80.1	53%	0.534	43%	0.429	S	S	.	.	H	α-helix	trans	-60	-40.5	178.5	-52.1	0	0	0	0	110.9	V55 P56 L63	V55-T59 PolarHBondContact O-N 3.47Å; V55-T59 PolarHBondContact O-OG1 2.92Å; V55-T59 VanDerWaalsContact O-OG1 3.13Å; P56-T59 PolarHBondContact O-N 3.42Å; T59-L63 WeakPolarHBondContact O-CB 3.26Å; T59-L63 PolarHBondContact O-N 3.2Å
60	L	78.9	Confident	75	Confident	109 Å²	109	77.2 Å²	77.2	57%	0.571	41%	0.413	S	S	*	.	H	α-helix	trans	-63.1	-43.8	175.5	-82.6	157.3	0	0	0	112.5	P56 Q58 L63 T64	P56-L60 WeakPolarHBondContact O-CB 3.36Å; P56-L60 WeakPolarHBondContact O-CD1 3.17Å; P56-L60 PolarHBondContact O-N 3.28Å; Q58-L60 VanDerWaalsContact C-N 3.27Å; Q58-L60 PolarHBondContact O-N 3.43Å; L60-L63 PolarHBondContact O-N 2.87Å; L60-T64 WeakPolarHBondContact O-CB 3.49Å; L60-T64 PolarHBondContact O-N 3.42Å; L60-T64 PolarHBondContact O-OG1 2.93Å
61	F	80	Confident	75.9	Confident	100 Å²	100	79.7 Å²	79.7	44%	0.439	43%	0.425	S	S	.	.	H	α-helix	trans	-65.5	-47.3	179.5	-174.5	-96.2	0	0	0	112.1	A32 I57 Q58 L63 T64 I65	A32-F61 HydrophobicContact CB-CD1 3.85Å; A32-F61 HydrophobicContact CB-CE1 3.15Å; A32-F61 HydrophobicContact CB-CZ 3.86Å; I57-F61 PolarHBondContact O-N 2.85Å; Q58-F61 PolarHBondContact O-N 3.34Å; F61-L63 VanDerWaalsContact C-N 3.35Å; F61-L63 PolarHBondContact O-N 3.05Å; F61-T64 PolarHBondContact O-N 2.87Å; F61-I65 HydrophobicContact CD1-CD1 3.89Å; F61-I65 HydrophobicContact CE1-CD1 3.18Å; F61-I65 HydrophobicContact CE1-CG1 4.13Å; F61-I65 HydrophobicContact CZ-CD1 3.59Å; F61-I65 HydrophobicContact CZ-CG1 4.33Å; F61-I65 PolarHBondContact O-N 3.14Å
62	I	80.8	Confident	76.7	Confident	71 Å²	71	77.5 Å²	77.5	36%	0.364	42%	0.415	S	S	.	.	H	α-helix	trans	-61.9	-44.5	177.1	-65.6	170.6	0	0	0	110.3	L29 Q58 T64 I65 H66	L29-I62 HydrophobicContact CD1-CG1 4.46Å; Q58-I62 WeakPolarHBondContact O-CG1 3.39Å; Q58-I62 PolarHBondContact O-N 3.28Å; I62-T64 VanDerWaalsContact C-N 3.31Å; I62-T64 PolarHBondContact O-N 3.46Å; I62-I65 PolarHBondContact O-N 3.29Å; I62-H66 WeakPolarHBondContact O-CB 3.38Å; I62-H66 PolarHBondContact O-N 3.29Å
63	L	81.7	Confident	77.3	Confident	96 Å²	96	80.6 Å²	80.6	50%	0.503	42%	0.416	S	S	.	.	H	α-helix	trans	-60.6	-40.9	177.1	-177.1	64	0	0	0	111.7	T59 L60 F61 H66 L67	T59-L63 WeakPolarHBondContact O-CB 3.26Å; T59-L63 PolarHBondContact O-N 3.2Å; L60-L63 PolarHBondContact O-N 2.87Å; F61-L63 VanDerWaalsContact C-N 3.35Å; F61-L63 PolarHBondContact O-N 3.05Å; L63-H66 PolarHBondContact O-N 2.97Å; L63-L67 HydrophobicContact CD1-CD1 4.48Å; L63-L67 HydrophobicContact CG-CD1 4.11Å; L63-L67 WeakPolarHBondContact O-CB 3.18Å; L63-L67 VanDerWaalsContact O-CG 3.31Å; L63-L67 WeakPolarHBondContact O-CG 3.37Å; L63-L67 PolarHBondContact O-N 3Å
64	T	81.5	Confident	77.7	Confident	89 Å²	89	78.5 Å²	78.5	55%	0.546	41%	0.405	S	S	.	.	H	α-helix	trans	-63.9	-45	178.1	-57.1	0	0	0	0	111.4	L60 F61 I62 H66 L67 L68	L60-T64 WeakPolarHBondContact O-CB 3.49Å; L60-T64 PolarHBondContact O-N 3.42Å; L60-T64 PolarHBondContact O-OG1 2.93Å; F61-T64 PolarHBondContact O-N 2.87Å; I62-T64 VanDerWaalsContact C-N 3.31Å; I62-T64 PolarHBondContact O-N 3.46Å; T64-H66 VanDerWaalsContact C-N 3.33Å; T64-H66 PolarHBondContact O-N 3.24Å; T64-L67 PolarHBondContact O-N 3.46Å; T64-L68 WeakPolarHBondContact O-CB 3.38Å; T64-L68 PolarHBondContact O-N 2.95Å
65	I	80.2	Confident	78.1	Confident	17 Å²	17	82.4 Å²	82.4	9%	0.087	43%	0.425	C	S	.	.	H	α-helix	trans	-61.2	-43.9	174.3	-74.3	-177.6	0	0	0	110.9	V25 L29 F61 I62 L67 L68 L69	V25-I65 HydrophobicContact CG1-CG2 3.56Å; L29-I65 HydrophobicContact CB-CD1 4.15Å; L29-I65 HydrophobicContact CB-CG2 4.42Å; L29-I65 HydrophobicContact CD1-CD1 3.96Å; L29-I65 HydrophobicContact CD1-CG2 4.28Å; F61-I65 HydrophobicContact CD1-CD1 3.89Å; F61-I65 HydrophobicContact CE1-CD1 3.18Å; F61-I65 HydrophobicContact CE1-CG1 4.13Å; F61-I65 HydrophobicContact CZ-CD1 3.59Å; F61-I65 HydrophobicContact CZ-CG1 4.33Å; F61-I65 PolarHBondContact O-N 3.14Å; I62-I65 PolarHBondContact O-N 3.29Å; I65-L67 PolarHBondContact O-N 2.84Å; I65-L68 WeakPolarHBondContact O-CB 3.36Å; I65-L68 PolarHBondContact O-N 2.98Å; I65-L69 HydrophobicContact CG2-CD1 4.03Å; I65-L69 HydrophobicContact CG2-CG 4.47Å; I65-L69 WeakPolarHBondContact O-CG 3.4Å; I65-L69 PolarHBondContact O-N 3.04Å
66	H	81.6	Confident	78	Confident	109 Å²	109	81.1 Å²	81.1	51%	0.505	41%	0.414	S	S	.	.	H	α-helix	trans	-63.8	-42.2	-178.9	-149.3	92.7	0	0	0	111.7	I62 L63 T64 L69 I70	I62-H66 WeakPolarHBondContact O-CB 3.38Å; I62-H66 PolarHBondContact O-N 3.29Å; L63-H66 PolarHBondContact O-N 2.97Å; T64-H66 VanDerWaalsContact C-N 3.33Å; T64-H66 PolarHBondContact O-N 3.24Å; H66-L69 PolarHBondContact O-N 3.46Å; H66-I70 WeakPolarHBondContact O-CG1 3.48Å; H66-I70 PolarHBondContact O-N 3.17Å
67	L	79.9	Confident	78.2	Confident	89 Å²	89	82.3 Å²	82.3	47%	0.466	41%	0.414	S	S	.	.	H	α-helix	trans	-63.3	-40.5	173.9	-74.5	167.6	0	0	0	111.9	L63 T64 I65 I70 N71	L63-L67 HydrophobicContact CD1-CD1 4.48Å; L63-L67 HydrophobicContact CG-CD1 4.11Å; L63-L67 WeakPolarHBondContact O-CB 3.18Å; L63-L67 VanDerWaalsContact O-CG 3.31Å; L63-L67 WeakPolarHBondContact O-CG 3.37Å; L63-L67 PolarHBondContact O-N 3Å; T64-L67 PolarHBondContact O-N 3.46Å; I65-L67 PolarHBondContact O-N 2.84Å; L67-I70 PolarHBondContact O-N 3.36Å; L67-N71 WeakPolarHBondContact O-CB 3.22Å; L67-N71 VanDerWaalsContact O-CG 3.3Å; L67-N71 PolarHBondContact O-N 3.35Å
68	L	82	Confident	78	Confident	89 Å²	89	81.6 Å²	81.6	47%	0.466	41%	0.414	S	S	.	.	H	α-helix	trans	-62.1	-44.1	175.5	-172	69.9	0	0	0	111.2	V25 T64 I65 N71 V72	V25-L68 HydrophobicContact CG2-CD2 3.97Å; T64-L68 WeakPolarHBondContact O-CB 3.38Å; T64-L68 PolarHBondContact O-N 2.95Å; I65-L68 WeakPolarHBondContact O-CB 3.36Å; I65-L68 PolarHBondContact O-N 2.98Å; L68-N71 PolarHBondContact O-N 3.14Å; L68-V72 VanDerWaalsContact O-CG2 3.28Å; L68-V72 WeakPolarHBondContact O-CG2 3.46Å; L68-V72 PolarHBondContact O-N 3.02Å
69	L	80.5	Confident	78.1	Confident	39 Å²	39	81.9 Å²	81.9	20%	0.204	42%	0.419	C	S	.	.	H	α-helix	trans	-61.1	-45	176.6	-73.3	168.6	0	0	0	112.1	M22 V25 I65 H66 V72 R73	M22-L69 HydrophobicContact CE-CD2 3.68Å; M22-L69 HydrophobicContact SD-CD2 3.42Å; M22-L69 WeakPolarHBondContact SD-CD2 3.31Å; V25-L69 HydrophobicContact CB-CD2 3.91Å; V25-L69 HydrophobicContact CG1-CD1 4.06Å; V25-L69 HydrophobicContact CG1-CD2 3.53Å; V25-L69 HydrophobicContact CG1-CG 3.64Å; I65-L69 HydrophobicContact CG2-CD1 4.03Å; I65-L69 HydrophobicContact CG2-CG 4.47Å; I65-L69 WeakPolarHBondContact O-CG 3.4Å; I65-L69 PolarHBondContact O-N 3.04Å; H66-L69 PolarHBondContact O-N 3.46Å; L69-V72 PolarHBondContact O-N 3.34Å; L69-R73 WeakPolarHBondContact O-CB 3.45Å; L69-R73 PolarHBondContact O-N 3.29Å
70	I	81.2	Confident	77.6	Confident	70 Å²	70	84.1 Å²	84.1	36%	0.359	42%	0.418	S	S	.	.	H	α-helix	trans	-61.8	-45.3	176.5	-69.5	168.6	0	0	0	110.3	H66 L67 R73 N74	H66-I70 WeakPolarHBondContact O-CG1 3.48Å; H66-I70 PolarHBondContact O-N 3.17Å; L67-I70 PolarHBondContact O-N 3.36Å; I70-R73 PolarHBondContact O-N 3.25Å; I70-N74 WeakPolarHBondContact O-CB 3.24Å; I70-N74 PolarHBondContact O-N 2.83Å; I70-N74 PolarHBondContact O-OD1 2.7Å
71	N	79.4	Confident	77.2	Confident	91 Å²	91	83.4 Å²	83.4	49%	0.487	41%	0.414	S	S	.	.	H	α-helix	trans	-63.7	-43.7	179.7	-76.1	-14.3	0	0	0	112.2	L67 L68 R73 N74 M75	L67-N71 WeakPolarHBondContact O-CB 3.22Å; L67-N71 VanDerWaalsContact O-CG 3.3Å; L67-N71 PolarHBondContact O-N 3.35Å; L68-N71 PolarHBondContact O-N 3.14Å; N71-R73 VanDerWaalsContact C-N 3.32Å; N71-R73 PolarHBondContact O-N 2.9Å; N71-N74 PolarHBondContact O-N 2.75Å; N71-M75 WeakPolarHBondContact O-CB 3.29Å; N71-M75 WeakPolarHBondContact O-CG 3.35Å; N71-M75 PolarHBondContact O-N 3.47Å
72	V	77.6	Confident	76.5	Confident	29 Å²	29	84.7 Å²	84.7	18%	0.176	43%	0.425	C	S	.	.	H	α-helix	trans	-61.4	-42.8	175.5	171.3	0	0	0	0	110.8	V18 V21 L68 L69 F76	V18-V72 HydrophobicContact CG1-CG1 4.21Å; V18-V72 HydrophobicContact CG2-CG1 4.44Å; V21-V72 HydrophobicContact CG1-CG1 4.09Å; V21-V72 HydrophobicContact CG1-CG2 3.94Å; L68-V72 VanDerWaalsContact O-CG2 3.28Å; L68-V72 WeakPolarHBondContact O-CG2 3.46Å; L68-V72 PolarHBondContact O-N 3.02Å; L69-V72 PolarHBondContact O-N 3.34Å; V72-F76 PolarHBondContact O-N 2.92Å; V72-F76 VanDerWaalsContact O-N 3.1Å
73	R	79.2	Confident	75.5	Confident	165 Å²	165	83.1 Å²	83.1	62%	0.623	42%	0.416	S	S	*	.	H	α-helix	trans	-63.6	-44.5	176.5	-176.1	-179.9	176.6	-171.1	-0.8	112.2	L69 I70 N71 F76 Q77	L69-R73 WeakPolarHBondContact O-CB 3.45Å; L69-R73 PolarHBondContact O-N 3.29Å; I70-R73 PolarHBondContact O-N 3.25Å; N71-R73 VanDerWaalsContact C-N 3.32Å; N71-R73 PolarHBondContact O-N 2.9Å; R73-F76 PolarHBondContact O-N 3.03Å; R73-Q77 PolarHBondContact O-N 3.47Å
74	N	78.4	Confident	74.6	Confident	71 Å²	71	82.5 Å²	82.5	38%	0.38	42%	0.417	S	S	.	.	H	α-helix	trans	-64.6	-45.7	179.2	-72.1	-7.1	0	0	0	111.2	I70 N71 F76 Q77 T78	I70-N74 WeakPolarHBondContact O-CB 3.24Å; I70-N74 PolarHBondContact O-N 2.83Å; I70-N74 PolarHBondContact O-OD1 2.7Å; N71-N74 PolarHBondContact O-N 2.75Å; N74-F76 PolarHBondContact O-N 2.98Å; N74-Q77 PolarHBondContact O-N 3.43Å; N74-Q77 VanDerWaalsContact O-N 3.14Å; N74-T78 PolarHBondContact O-N 3.18Å; N74-T78 PolarHBondContact O-OG1 3.4Å; N74-T78 VanDerWaalsContact O-OG1 3.05Å
75	M	73.8	Confident	73.7	Confident	144 Å²	144	85.3 Å²	85.3	71%	0.709	42%	0.422	S	S	*	.	H	α-helix	trans	-55.7	-41.1	174.8	-74.4	-70.4	-72.4	0	0	111.6	N71 S79	N71-M75 WeakPolarHBondContact O-CB 3.29Å; N71-M75 WeakPolarHBondContact O-CG 3.35Å; N71-M75 PolarHBondContact O-N 3.47Å; M75-S79 WeakPolarHBondContact O-CB 3.3Å; M75-S79 PolarHBondContact O-N 2.94Å
76	F	69.8	Low	72.8	Confident	38 Å²	38	90.6 Å²	90.6	17%	0.167	45%	0.446	C	S	.	.	H	α-helix	trans	-67.8	-45.2	176.2	-166.7	-107.8	0	0	0	112.2	F11 N14 E15 V18 V72 R73 N74 T78 S79 R80	F11-F76 HydrophobicContact CZ-CZ 4.21Å; N14-F76 HydrophobicContact CB-CE2 4.31Å; E15-F76 HydrophobicContact CB-CE2 4.34Å; E15-F76 HydrophobicContact CB-CZ 4.06Å; E15-F76 HydrophobicContact CG-CZ 4.2Å; V18-F76 HydrophobicContact CB-CD2 4.22Å; V18-F76 HydrophobicContact CB-CE2 4.48Å; V18-F76 HydrophobicContact CG2-CB 4.22Å; V18-F76 HydrophobicContact CG2-CD2 3.51Å; V18-F76 HydrophobicContact CG2-CE2 4.12Å; V18-F76 HydrophobicContact CG2-CG 4.08Å; V72-F76 PolarHBondContact O-N 2.92Å; V72-F76 VanDerWaalsContact O-N 3.1Å; R73-F76 PolarHBondContact O-N 3.03Å; N74-F76 PolarHBondContact O-N 2.98Å; F76-T78 PolarHBondContact O-N 2.95Å; F76-S79 WeakPolarHBondContact O-CB 3.37Å; F76-S79 PolarHBondContact O-N 3.28Å; F76-R80 HydrophobicContact CD1-CG 4.22Å; F76-R80 HydrophobicContact CE1-CG 4.06Å; F76-R80 HydrophobicContact CZ-CG 4.47Å; F76-R80 WeakPolarHBondContact O-CG 3.42Å; F76-R80 PolarHBondContact O-N 3.41Å
77	Q	74.3	Confident	71.8	Confident	92 Å²	92	90.8 Å²	90.8	43%	0.43	45%	0.448	S	S	.	.	H	α-helix	trans	-60.3	-44.2	176.4	-77.3	-172.4	-45.5	0	0	112.1	R73 N74 S79 R80 I81	R73-Q77 PolarHBondContact O-N 3.47Å; N74-Q77 PolarHBondContact O-N 3.43Å; N74-Q77 VanDerWaalsContact O-N 3.14Å; Q77-S79 VanDerWaalsContact C-N 3.33Å; Q77-S79 PolarHBondContact O-N 3.36Å; Q77-R80 WeakPolarHBondContact O-CB 3.48Å; Q77-R80 PolarHBondContact O-N 3.38Å; Q77-I81 VanDerWaalsContact O-CG1 3.3Å; Q77-I81 WeakPolarHBondContact O-CG1 3.47Å; Q77-I81 PolarHBondContact O-N 3.41Å
78	T	71.9	Confident	71.1	Confident	87 Å²	87	93.6 Å²	93.6	53%	0.534	46%	0.463	S	S	.	.	H	α-helix	trans	-62.5	-41.6	176.1	-52.9	0	0	0	0	111.3	N74 F76 R80 I81 L82	N74-T78 PolarHBondContact O-N 3.18Å; N74-T78 PolarHBondContact O-OG1 3.4Å; N74-T78 VanDerWaalsContact O-OG1 3.05Å; F76-T78 PolarHBondContact O-N 2.95Å; T78-R80 VanDerWaalsContact C-N 3.33Å; T78-R80 PolarHBondContact O-N 3.14Å; T78-I81 PolarHBondContact O-N 2.82Å; T78-L82 WeakPolarHBondContact O-CB 3.48Å; T78-L82 PolarHBondContact O-N 3.06Å
79	S	69.9	Low	69.9	Low	37 Å²	37	99 Å²	99	26%	0.259	49%	0.492	S	S	.	.	H	α-helix	trans	-60.3	-41.3	174.2	-172.8	0	0	0	0	112.2	M75 F76 Q77 I83	M75-S79 WeakPolarHBondContact O-CB 3.3Å; M75-S79 PolarHBondContact O-N 2.94Å; F76-S79 WeakPolarHBondContact O-CB 3.37Å; F76-S79 PolarHBondContact O-N 3.28Å; Q77-S79 VanDerWaalsContact C-N 3.33Å; Q77-S79 PolarHBondContact O-N 3.36Å; S79-I83 WeakPolarHBondContact O-CD1 3.4Å; S79-I83 WeakPolarHBondContact O-CG1 3.48Å; S79-I83 PolarHBondContact O-N 3.06Å
80	R	67.5	Low	69.4	Low	134 Å²	134	102.1 Å²	102.1	51%	0.506	51%	0.506	S	S	.	.	H	α-helix	trans	-64.8	-43.7	174.9	-67.1	-168.5	63.8	-169.6	-1.2	112.7	F11 F76 Q77 T78 T84	F11-R80 HydrophobicContact CE2-CG 3.82Å; F11-R80 HydrophobicContact CZ-CG 4.17Å; F76-R80 HydrophobicContact CD1-CG 4.22Å; F76-R80 HydrophobicContact CE1-CG 4.06Å; F76-R80 HydrophobicContact CZ-CG 4.47Å; F76-R80 WeakPolarHBondContact O-CG 3.42Å; F76-R80 PolarHBondContact O-N 3.41Å; Q77-R80 WeakPolarHBondContact O-CB 3.48Å; Q77-R80 PolarHBondContact O-N 3.38Å; T78-R80 VanDerWaalsContact C-N 3.33Å; T78-R80 PolarHBondContact O-N 3.14Å; R80-T84 PolarHBondContact O-N 3.07Å; R80-T84 PolarHBondContact O-OG1 3.36Å
81	I	71.1	Confident	68.8	Low	95 Å²	95	103.7 Å²	103.7	49%	0.487	51%	0.514	S	S	.	.	H	α-helix	trans	-65.9	-51.3	-178.9	-67.9	164	0	0	0	110.1	Q77 T78 I83 T84 F85	Q77-I81 VanDerWaalsContact O-CG1 3.3Å; Q77-I81 WeakPolarHBondContact O-CG1 3.47Å; Q77-I81 PolarHBondContact O-N 3.41Å; T78-I81 PolarHBondContact O-N 2.82Å; I81-I83 PolarHBondContact O-N 3.27Å; I81-I83 VanDerWaalsContact O-N 3.14Å; I81-T84 PolarHBondContact O-N 3.19Å; I81-F85 HydrophobicContact CG2-CD2 3.73Å; I81-F85 HydrophobicContact CG2-CE2 3.74Å; I81-F85 WeakPolarHBondContact O-CD2 3.31Å; I81-F85 PolarHBondContact O-N 2.97Å
82	L	64.7	Low	68.2	Low	126 Å²	126	104.4 Å²	104.4	66%	0.66	52%	0.515	S	S	*	.	H	α-helix	trans	-54.4	-37.8	-179.1	-166	77	0	0	0	112	T78 H86	T78-L82 WeakPolarHBondContact O-CB 3.48Å; T78-L82 PolarHBondContact O-N 3.06Å; L82-H86 PolarHBondContact O-N 3.4Å
83	I	59.1	Low	67.6	Low	38 Å²	38	108.9 Å²	108.9	20%	0.195	54%	0.535	C	S	.	.	H	α-helix	trans	-79.4	-36.2	178.6	-69.7	168.4	0	0	0	112.3	L7 S79 I81 F85 H86 M87	L7-I83 HydrophobicContact CD2-CG1 4.48Å; L7-I83 HydrophobicContact CD2-CG2 3.39Å; L7-I83 HydrophobicContact CG-CG2 4.46Å; S79-I83 WeakPolarHBondContact O-CD1 3.4Å; S79-I83 WeakPolarHBondContact O-CG1 3.48Å; S79-I83 PolarHBondContact O-N 3.06Å; I81-I83 PolarHBondContact O-N 3.27Å; I81-I83 VanDerWaalsContact O-N 3.14Å; I83-F85 PolarHBondContact O-N 3.19Å; I83-H86 CarbonylContact O-C 3.54Å; I83-H86 PolarHBondContact O-N 3.22Å; I83-M87 HydrophobicContact CG2-CG 4.16Å; I83-M87 WeakPolarHBondContact O-CB 3.39Å; I83-M87 VanDerWaalsContact O-CG 3.31Å; I83-M87 WeakPolarHBondContact O-CG 3.48Å; I83-M87 PolarHBondContact O-N 3.33Å
84	T	64.2	Low	66.9	Low	83 Å²	83	105.4 Å²	105.4	51%	0.509	53%	0.53	S	S	.	.	H	α-helix	trans	-59.2	-40.7	173.3	-53.9	0	0	0	0	109.9	R80 I81 M87 L88	R80-T84 PolarHBondContact O-N 3.07Å; R80-T84 PolarHBondContact O-OG1 3.36Å; I81-T84 PolarHBondContact O-N 3.19Å; T84-M87 PolarHBondContact O-N 3.38Å; T84-L88 HydrophobicContact CG2-CD1 4.42Å; T84-L88 WeakPolarHBondContact O-CB 3.47Å; T84-L88 PolarHBondContact O-N 3.38Å
85	F	62.4	Low	66.2	Low	149 Å²	149	107.7 Å²	107.7	65%	0.654	54%	0.54	S	S	*	.	H	α-helix	trans	-61.6	-45.7	170	-87.8	-82.4	0	0	0	112.5	I81 I83 M87 L88 L89	I81-F85 HydrophobicContact CG2-CD2 3.73Å; I81-F85 HydrophobicContact CG2-CE2 3.74Å; I81-F85 WeakPolarHBondContact O-CD2 3.31Å; I81-F85 PolarHBondContact O-N 2.97Å; I83-F85 PolarHBondContact O-N 3.19Å; F85-M87 VanDerWaalsContact C-N 3.28Å; F85-M87 PolarHBondContact O-N 3.37Å; F85-L88 PolarHBondContact O-N 3.03Å; F85-L89 PolarHBondContact O-N 3.33Å
86	H	61	Low	65.6	Low	127 Å²	127	105.1 Å²	105.1	59%	0.588	53%	0.528	S	S	*	.	H	α-helix	trans	-67	-25	178.5	-165.9	63	0	0	0	114.2	L82 I83	L82-H86 PolarHBondContact O-N 3.4Å; I83-H86 CarbonylContact O-C 3.54Å; I83-H86 PolarHBondContact O-N 3.22Å
87	M	60.7	Low	65.3	Low	114 Å²	114	110.2 Å²	110.2	56%	0.562	56%	0.555	S	S	*	*	H	α-helix	trans	-81.6	-21.3	174.7	-72.1	-80.6	-62.5	0	0	112.9	L4 L7 I83 T84 F85	L4-M87 HydrophobicContact CD2-CE 4.03Å; L4-M87 HydrophobicContact CD2-SD 3.37Å; L4-M87 WeakPolarHBondContact CD2-SD 3.37Å; L7-M87 HydrophobicContact CD2-CG 4.47Å; L7-M87 HydrophobicContact CD2-SD 4.28Å; I83-M87 HydrophobicContact CG2-CG 4.16Å; I83-M87 WeakPolarHBondContact O-CB 3.39Å; I83-M87 VanDerWaalsContact O-CG 3.31Å; I83-M87 WeakPolarHBondContact O-CG 3.48Å; I83-M87 PolarHBondContact O-N 3.33Å; T84-M87 PolarHBondContact O-N 3.38Å; F85-M87 VanDerWaalsContact C-N 3.28Å; F85-M87 PolarHBondContact O-N 3.37Å
88	L	64.4	Low	64.5	Low	148 Å²	148	111.8 Å²	111.8	78%	0.775	57%	0.566	S	S	*	*	H	α-helix	trans	-88.2	-18	-179.9	-121.2	134.2	0	0	0	112.9	T84 F85	T84-L88 HydrophobicContact CG2-CD1 4.42Å; T84-L88 WeakPolarHBondContact O-CB 3.47Å; T84-L88 PolarHBondContact O-N 3.38Å; F85-L88 PolarHBondContact O-N 3.03Å
89	L	57.8	Low	63.9	Low	203 Å²	203	114 Å²	114	100%	1.063	57%	0.569	S	S	*	*			trans	-99	0	-179.6	-157.5	128.5	0	0	0	110.8	F85	F85-L89 PolarHBondContact O-N 3.33Å

Retrieved 89 of 89 residues in 362.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).