A0A5K4F7X3_SCHMA Loading...

Ribonuclease T(2)

AlphaFold DB , UniProt , Accession A0A5K4F7X3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 66 aa.

						>A0A5K4F7X3_SCHMA|A0A5K4F7X3
MFSTLSTFRKHEFEKHGLCAVEDPQVFNQYGYFKFGIQLMQKLNLLKTLMKYRSHHMIPDNMIQSI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.3	Low	87.1	Confident	243 Å²	243	116.8 Å²	116.8	100%	1.197	59%	0.591	S	S	*	*				0	113.6	0	-174.2	173.5	-172.6	0	0	107.4	S3	M1-S3 PolarHBondContact O-N 3.1Å
2	F	67	Low	87.9	Confident	211 Å²	211	111 Å²	111	93%	0.925	56%	0.56	S	S	*	*	P	Polyproline II helix	trans	-77.8	118.3	177.4	-66.5	-74	0	0	0	108.7
3	S	79.9	Confident	88.7	Confident	77 Å²	77	104.2 Å²	104.2	54%	0.538	53%	0.525	S	S	.	.	P	Polyproline II helix	trans	-70.7	130.2	168.3	-174	0	0	0	0	108	M1 T7 F8	M1-S3 PolarHBondContact O-N 3.1Å; S3-T7 PolarHBondContact OG-OG1 3.35Å; S3-F8 PolarHBondContact OG-N 3.24Å
4	T	93.2	Very high	89.3	Confident	74 Å²	74	104.4 Å²	104.4	45%	0.454	52%	0.523	S	S	.	.	P	Polyproline II helix	trans	-70.9	158.9	167.9	70.3	0	0	0	0	108.9	S6 T7 F8	T4-S6 PolarHBondContact O-N 3.42Å; T4-S6 PolarHBondContact OG1-OG 2.74Å; T4-T7 PolarHBondContact N-OG1 3.28Å; T4-T7 PolarHBondContact O-N 3.48Å; T4-T7 PolarHBondContact O-OG1 3.19Å; T4-T7 WeakPolarHBondContact OG1-CG2 3.35Å; T4-T7 PolarHBondContact OG1-N 3.26Å; T4-T7 VanDerWaalsContact OG1-N 3.09Å; T4-T7 PolarHBondContact OG1-OG1 3.47Å; T4-T7 VanDerWaalsContact OG1-OG1 3.08Å; T4-F8 WeakPolarHBondContact O-CB 3.49Å; T4-F8 PolarHBondContact O-N 2.94Å
5	L	93.1	Very high	89.8	Confident	115 Å²	115	105.3 Å²	105.3	60%	0.602	52%	0.523	S	S	*	.	H	α-helix	trans	-56.6	-36	175.2	-177.4	64.4	0	0	0	111.7	R9	L5-R9 HydrophobicContact CD1-CG 4.38Å; L5-R9 WeakPolarHBondContact O-CB 3.2Å; L5-R9 WeakPolarHBondContact O-CG 3.46Å; L5-R9 PolarHBondContact O-N 3.35Å
6	S	94.1	Very high	90.3	Very high	86 Å²	86	103.9 Å²	103.9	60%	0.601	51%	0.514	S	S	*	.	H	α-helix	trans	-70.1	-43.3	178.6	57.2	0	0	0	0	112.2	T4 F8 R9 K10	T4-S6 PolarHBondContact O-N 3.42Å; T4-S6 PolarHBondContact OG1-OG 2.74Å; S6-F8 VanDerWaalsContact C-N 3.33Å; S6-F8 PolarHBondContact O-N 3.03Å; S6-R9 PolarHBondContact O-N 3.46Å; S6-K10 VanDerWaalsContact O-CB 3.29Å; S6-K10 WeakPolarHBondContact O-CB 3.41Å; S6-K10 PolarHBondContact O-N 2.86Å
7	T	95.7	Very high	90.7	Very high	72 Å²	72	97.8 Å²	97.8	44%	0.442	48%	0.483	S	S	.	.	H	α-helix	trans	-65.7	-39	176.4	52.6	0	0	0	0	111.4	S3 T4 H11	S3-T7 PolarHBondContact OG-OG1 3.35Å; T4-T7 PolarHBondContact N-OG1 3.28Å; T4-T7 PolarHBondContact O-N 3.48Å; T4-T7 PolarHBondContact O-OG1 3.19Å; T4-T7 WeakPolarHBondContact OG1-CG2 3.35Å; T4-T7 PolarHBondContact OG1-N 3.26Å; T4-T7 VanDerWaalsContact OG1-N 3.09Å; T4-T7 PolarHBondContact OG1-OG1 3.47Å; T4-T7 VanDerWaalsContact OG1-OG1 3.08Å; T7-H11 WeakPolarHBondContact O-CB 3.13Å; T7-H11 PolarHBondContact O-N 3.37Å
8	F	95.7	Very high	91	Very high	100 Å²	100	97.6 Å²	97.6	44%	0.439	48%	0.484	S	S	.	.	H	α-helix	trans	-61.8	-52.9	174.8	175.9	-104.6	0	0	0	111.9	S3 T4 S6 K10 H11 E12	S3-F8 PolarHBondContact OG-N 3.24Å; T4-F8 WeakPolarHBondContact O-CB 3.49Å; T4-F8 PolarHBondContact O-N 2.94Å; S6-F8 VanDerWaalsContact C-N 3.33Å; S6-F8 PolarHBondContact O-N 3.03Å; F8-K10 VanDerWaalsContact C-N 3.3Å; F8-K10 PolarHBondContact O-N 3.35Å; F8-H11 WeakPolarHBondContact O-CB 3.48Å; F8-H11 PolarHBondContact O-N 2.79Å; F8-E12 HydrophobicContact CD1-CG 4.35Å; F8-E12 HydrophobicContact CD2-CG 4.2Å; F8-E12 HydrophobicContact CE1-CG 3.88Å; F8-E12 HydrophobicContact CE2-CG 3.7Å; F8-E12 HydrophobicContact CZ-CG 3.53Å; F8-E12 WeakPolarHBondContact O-CG 3.23Å; F8-E12 PolarHBondContact O-N 2.83Å
9	R	95.4	Very high	91.3	Very high	95 Å²	95	98.4 Å²	98.4	36%	0.358	50%	0.499	S	S	.	.	H	α-helix	trans	-62.4	-38.2	180	-73.9	180	-177.1	-105.2	3.4	112.2	L5 S6 F13 F33	L5-R9 HydrophobicContact CD1-CG 4.38Å; L5-R9 WeakPolarHBondContact O-CB 3.2Å; L5-R9 WeakPolarHBondContact O-CG 3.46Å; L5-R9 PolarHBondContact O-N 3.35Å; S6-R9 PolarHBondContact O-N 3.46Å; R9-F13 PolarHBondContact O-N 3.28Å; R9-F13 VanDerWaalsContact O-N 3.09Å; R9-F33 HydrophobicContact CB-CE1 4.27Å; R9-F33 HydrophobicContact CB-CE2 4.04Å; R9-F33 HydrophobicContact CB-CZ 3.65Å; R9-F33 HydrophobicContact CG-CE1 4Å; R9-F33 HydrophobicContact CG-CE2 4.45Å; R9-F33 HydrophobicContact CG-CZ 3.9Å; R9-F33 VanDerWaalsContact O-CZ 3.23Å; R9-F33 WeakPolarHBondContact O-CZ 3.26Å
10	K	96.2	Very high	91.6	Very high	118 Å²	118	95.2 Å²	95.2	51%	0.513	49%	0.488	S	S	.	.	H	α-helix	trans	-60.7	-49.9	174.4	-177.6	176.9	177.3	-177.2	0	110.8	S6 F8 E12 F13 E14	S6-K10 VanDerWaalsContact O-CB 3.29Å; S6-K10 WeakPolarHBondContact O-CB 3.41Å; S6-K10 PolarHBondContact O-N 2.86Å; F8-K10 VanDerWaalsContact C-N 3.3Å; F8-K10 PolarHBondContact O-N 3.35Å; K10-E12 PolarHBondContact O-N 3.35Å; K10-F13 PolarHBondContact O-N 3.2Å; K10-E14 WeakPolarHBondContact CE-OE1 3.31Å; K10-E14 WeakPolarHBondContact CE-OE2 3.4Å; K10-E14 HydrophobicContact CG-CG 4.33Å; K10-E14 IonicContact NZ-OE1 3.71Å; K10-E14 WeakPolarHBondContact O-CB 3.32Å; K10-E14 WeakPolarHBondContact O-CG 3.48Å; K10-E14 PolarHBondContact O-N 3.17Å
11	H	96.5	Very high	91.7	Very high	94 Å²	94	93.4 Å²	93.4	44%	0.435	48%	0.482	S	S	.	.	H	α-helix	trans	-57.7	-48.7	178.3	-178.9	74.7	0	0	0	112.5	T7 F8 F13 E14 K15	T7-H11 WeakPolarHBondContact O-CB 3.13Å; T7-H11 PolarHBondContact O-N 3.37Å; F8-H11 WeakPolarHBondContact O-CB 3.48Å; F8-H11 PolarHBondContact O-N 2.79Å; H11-F13 VanDerWaalsContact C-N 3.33Å; H11-F13 PolarHBondContact O-N 3.02Å; H11-E14 PolarHBondContact O-N 3.18Å; H11-K15 VanDerWaalsContact NE2-CD 3.33Å; H11-K15 WeakPolarHBondContact NE2-CD 3.27Å; H11-K15 WeakPolarHBondContact O-CB 3.38Å; H11-K15 PolarHBondContact O-N 3.12Å
12	E	97.3	Very high	93.8	Very high	47 Å²	47	90.7 Å²	90.7	22%	0.22	47%	0.466	C	S	.	.	H	α-helix	trans	-60.2	-42.6	-179.7	-73.6	-60.5	121.9	0	0	112.1	F8 K10 H16 G17 Y32 F33	F8-E12 HydrophobicContact CD1-CG 4.35Å; F8-E12 HydrophobicContact CD2-CG 4.2Å; F8-E12 HydrophobicContact CE1-CG 3.88Å; F8-E12 HydrophobicContact CE2-CG 3.7Å; F8-E12 HydrophobicContact CZ-CG 3.53Å; F8-E12 WeakPolarHBondContact O-CG 3.23Å; F8-E12 PolarHBondContact O-N 2.83Å; K10-E12 PolarHBondContact O-N 3.35Å; E12-H16 WeakPolarHBondContact O-CB 3.46Å; E12-H16 PolarHBondContact O-N 3.35Å; E12-H16 IonicContact OE2-CD2 3.64Å; E12-G17 PolarHBondContact O-N 3.01Å; E12-Y32 HydrophobicContact CB-CE1 4.43Å; E12-F33 HydrophobicContact CB-CZ 4.3Å
13	F	97.8	Very high	95.1	Very high	22 Å²	22	83.6 Å²	83.6	10%	0.096	44%	0.437	C	S	.	.	H	α-helix	trans	-70.5	-46.6	178.9	-176.4	-110	0	0	0	112.3	R9 K10 H11 K15 G17 L18 Q29 Y32 F33	R9-F13 PolarHBondContact O-N 3.28Å; R9-F13 VanDerWaalsContact O-N 3.09Å; K10-F13 PolarHBondContact O-N 3.2Å; H11-F13 VanDerWaalsContact C-N 3.33Å; H11-F13 PolarHBondContact O-N 3.02Å; F13-K15 VanDerWaalsContact C-N 3.33Å; F13-K15 PolarHBondContact O-N 2.96Å; F13-G17 CarbonylContact O-C 3.54Å; F13-G17 VanDerWaalsContact O-CA 3.27Å; F13-G17 WeakPolarHBondContact O-CA 3.19Å; F13-G17 PolarHBondContact O-N 2.93Å; F13-L18 HydrophobicContact CE1-CD2 3.7Å; F13-L18 HydrophobicContact CE1-CG 4.3Å; F13-L18 HydrophobicContact CZ-CD2 3.78Å; F13-L18 HydrophobicContact CZ-CG 4.49Å; F13-L18 PolarHBondContact O-N 2.88Å; F13-Q29 HydrophobicContact CB-CG 4.07Å; F13-Q29 HydrophobicContact CD1-CB 3.75Å; F13-Q29 HydrophobicContact CD1-CG 3.83Å; F13-Q29 HydrophobicContact CD2-CB 3.93Å; F13-Q29 HydrophobicContact CD2-CG 4.01Å; F13-Q29 HydrophobicContact CE1-CB 3.7Å; F13-Q29 HydrophobicContact CE1-CG 4.32Å; F13-Q29 HydrophobicContact CE2-CB 3.92Å; F13-Q29 HydrophobicContact CE2-CG 4.5Å; F13-Q29 HydrophobicContact CG-CB 3.87Å; F13-Q29 HydrophobicContact CG-CG 3.66Å; F13-Q29 HydrophobicContact CZ-CB 3.79Å; F13-Q29 VanDerWaalsContact CZ-N 3.3Å; F13-Y32 AromaticContact CD2-CD1 3.95Å; F13-Y32 HydrophobicContact CD2-CD1 3.95Å; F13-Y32 AromaticContact CD2-CG 3.89Å; F13-Y32 HydrophobicContact CD2-CG 3.89Å; F13-Y32 HydrophobicContact CE2-CG 4.41Å; F13-F33 HydrophobicContact CB-CE2 4.09Å; F13-F33 HydrophobicContact CB-CZ 4.35Å
14	E	97.7	Very high	95.8	Very high	108 Å²	108	85.2 Å²	85.2	51%	0.505	45%	0.446	S	S	.	.	H	α-helix	trans	-64.3	-37.7	-179.4	-71.9	178.1	161.8	0	0	112.2	K10 H11	K10-E14 WeakPolarHBondContact CE-OE1 3.31Å; K10-E14 WeakPolarHBondContact CE-OE2 3.4Å; K10-E14 HydrophobicContact CG-CG 4.33Å; K10-E14 IonicContact NZ-OE1 3.71Å; K10-E14 WeakPolarHBondContact O-CB 3.32Å; K10-E14 WeakPolarHBondContact O-CG 3.48Å; K10-E14 PolarHBondContact O-N 3.17Å; H11-E14 PolarHBondContact O-N 3.18Å
15	K	97	Very high	95.9	Very high	118 Å²	118	86.9 Å²	86.9	51%	0.513	45%	0.449	S	S	.	.	H	α-helix	trans	-83.8	-36.3	-177.4	-171.7	179.6	171.6	-167.9	0	113.6	H11 F13	H11-K15 VanDerWaalsContact NE2-CD 3.33Å; H11-K15 WeakPolarHBondContact NE2-CD 3.27Å; H11-K15 WeakPolarHBondContact O-CB 3.38Å; H11-K15 PolarHBondContact O-N 3.12Å; F13-K15 VanDerWaalsContact C-N 3.33Å; F13-K15 PolarHBondContact O-N 2.96Å
16	H	97	Very high	96	Very high	82 Å²	82	81.7 Å²	81.7	38%	0.38	42%	0.422	S	S	.	.	T	Hydrogen-bonded Turn	trans	-122.8	-41.6	-170.5	-60	-54	0	0	0	112.9	E12 L18 C19	E12-H16 WeakPolarHBondContact O-CB 3.46Å; E12-H16 PolarHBondContact O-N 3.35Å; E12-H16 IonicContact OE2-CD2 3.64Å; H16-L18 PolarHBondContact O-N 3.27Å; H16-C19 PolarHBondContact O-N 3.36Å
17	G	96.7	Very high	96	Very high	0 Å²	0	83.7 Å²	83.7	0%	0	42%	0.42	C	S	.	.	G	3₁₀ helix	trans	-64.6	-36.5	-177.7	0	0	0	0	0	114.4	E12 F13 C19 A20 Y32	E12-G17 PolarHBondContact O-N 3.01Å; F13-G17 CarbonylContact O-C 3.54Å; F13-G17 VanDerWaalsContact O-CA 3.27Å; F13-G17 WeakPolarHBondContact O-CA 3.19Å; F13-G17 PolarHBondContact O-N 2.93Å; G17-C19 PolarHBondContact O-N 2.84Å; G17-A20 PolarHBondContact O-N 2.79Å; G17-Y32 VanDerWaalsContact CA-CD2 3.4Å; G17-Y32 VanDerWaalsContact CA-CE2 3.41Å
18	L	97.4	Very high	96	Very high	95 Å²	95	82.9 Å²	82.9	50%	0.497	41%	0.413	S	S	.	.	G	3₁₀ helix	trans	-62.4	-25.9	177.7	-69.1	179.6	0	0	0	113.5	F13 H16 A20 V21	F13-L18 HydrophobicContact CE1-CD2 3.7Å; F13-L18 HydrophobicContact CE1-CG 4.3Å; F13-L18 HydrophobicContact CZ-CD2 3.78Å; F13-L18 HydrophobicContact CZ-CG 4.49Å; F13-L18 PolarHBondContact O-N 2.88Å; H16-L18 PolarHBondContact O-N 3.27Å; L18-A20 VanDerWaalsContact C-N 3.25Å; L18-A20 PolarHBondContact O-N 3.06Å; L18-V21 WeakPolarHBondContact O-CG2 3.22Å
19	C	96.9	Very high	96.1	Very high	112 Å²	112	82.7 Å²	82.7	76%	0.757	41%	0.414	S	S	*	.	G	3₁₀ helix	trans	-76	-13.6	175.6	-59.9	0	0	0	0	113.2	H16 G17	H16-C19 PolarHBondContact O-N 3.36Å; G17-C19 PolarHBondContact O-N 2.84Å
20	A	95.5	Very high	96.2	Very high	35 Å²	35	86 Å²	86	29%	0.289	43%	0.427	S	S	.	.	G	3₁₀ helix	trans	-107.7	5	-173.9	0	0	0	0	0	113.2	G17 L18 E22 D23 V26	G17-A20 PolarHBondContact O-N 2.79Å; L18-A20 VanDerWaalsContact C-N 3.25Å; L18-A20 PolarHBondContact O-N 3.06Å; A20-E22 PolarHBondContact O-N 2.99Å; A20-E22 VanDerWaalsContact O-N 3.14Å; A20-D23 PolarHBondContact O-N 3Å; A20-V26 HydrophobicContact CB-CB 4.36Å; A20-V26 HydrophobicContact CB-CG1 3.55Å
21	V	94.2	Very high	96.2	Very high	58 Å²	58	80.5 Å²	80.5	35%	0.352	40%	0.404	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.6	-12.4	-173.5	-61	0	0	0	0	114.4	L18 D23 F27	L18-V21 WeakPolarHBondContact O-CG2 3.22Å; V21-D23 VanDerWaalsContact C-N 3.27Å; V21-F27 WeakPolarHBondContact O-CA 3.4Å
22	E	94.8	Very high	96.3	Very high	186 Å²	186	78.5 Å²	78.5	87%	0.869	39%	0.393	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71	-22.8	172	-63.4	-178.3	177.2	0	0	112.2	A20 P24	A20-E22 PolarHBondContact O-N 2.99Å; A20-E22 VanDerWaalsContact O-N 3.14Å; E22-P24 WeakPolarHBondContact O-CD 3.34Å
23	D	95.4	Very high	96.3	Very high	61 Å²	61	78 Å²	78	33%	0.326	39%	0.391	S	S	.	.	S	Bend	trans	-75.4	123.2	172.9	-172	-42.5	0	0	0	109.6	A20 V21 Q25 V26 F27	A20-D23 PolarHBondContact O-N 3Å; V21-D23 VanDerWaalsContact C-N 3.27Å; D23-Q25 PolarHBondContact O-N 3.44Å; D23-Q25 VanDerWaalsContact OD1-CB 3.27Å; D23-Q25 WeakPolarHBondContact OD1-CB 3.5Å; D23-Q25 PolarHBondContact OD1-N 3.14Å; D23-Q25 PolarHBondContact OD1-NE2 3.34Å; D23-V26 HydrophobicContact CB-CB 4.23Å; D23-V26 HydrophobicContact CB-CG2 4.42Å; D23-V26 CarbonylContact O-C 3.51Å; D23-V26 PolarHBondContact O-N 3.26Å; D23-F27 PolarHBondContact O-N 3.05Å
24	P	94.8	Very high	96.3	Very high	111 Å²	111	81.7 Å²	81.7	72%	0.721	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.5	-18.5	178.7	-25.6	34.8	0	0	0	114.9	E22 F27	E22-P24 WeakPolarHBondContact O-CD 3.34Å; P24-F27 WeakPolarHBondContact O-CD1 3.44Å
25	Q	93.9	Very high	96.3	Very high	110 Å²	110	79.5 Å²	79.5	51%	0.514	40%	0.396	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82.9	-18	175.3	-61.5	170.9	95.6	0	0	112.6	D23 G31 F35	D23-Q25 PolarHBondContact O-N 3.44Å; D23-Q25 VanDerWaalsContact OD1-CB 3.27Å; D23-Q25 WeakPolarHBondContact OD1-CB 3.5Å; D23-Q25 PolarHBondContact OD1-N 3.14Å; D23-Q25 PolarHBondContact OD1-NE2 3.34Å; Q25-G31 CarbonylContact O-C 3.34Å; Q25-G31 VanDerWaalsContact O-CA 3.26Å; Q25-G31 WeakPolarHBondContact O-CA 3.22Å; Q25-F35 HydrophobicContact CB-CD2 3.88Å; Q25-F35 HydrophobicContact CB-CE2 4.4Å
26	V	95.8	Very high	96.2	Very high	5 Å²	5	75.6 Å²	75.6	3%	0.03	39%	0.389	C	S	.	.	T	Hydrogen-bonded Turn	trans	-124.3	6.4	-168.8	-178.1	0	0	0	0	112.6	A20 D23 N28 Y32 F35	A20-V26 HydrophobicContact CB-CB 4.36Å; A20-V26 HydrophobicContact CB-CG1 3.55Å; D23-V26 HydrophobicContact CB-CB 4.23Å; D23-V26 HydrophobicContact CB-CG2 4.42Å; D23-V26 CarbonylContact O-C 3.51Å; D23-V26 PolarHBondContact O-N 3.26Å; V26-N28 PolarHBondContact O-N 2.96Å; V26-Y32 HydrophobicContact CG1-CD2 3.68Å; V26-Y32 HydrophobicContact CG1-CG 4.28Å; V26-F35 HydrophobicContact CG2-CB 3.92Å; V26-F35 HydrophobicContact CG2-CD1 3.89Å; V26-F35 HydrophobicContact CG2-CG 3.87Å
27	F	94.4	Very high	96.2	Very high	128 Å²	128	75.1 Å²	75.1	56%	0.561	39%	0.388	S	S	*	.	S	Bend	trans	-51.6	-11.5	-176	75	-80.6	0	0	0	117.4	V21 D23 P24	V21-F27 WeakPolarHBondContact O-CA 3.4Å; D23-F27 PolarHBondContact O-N 3.05Å; P24-F27 WeakPolarHBondContact O-CD1 3.44Å
28	N	96.5	Very high	96.1	Very high	55 Å²	55	79.7 Å²	79.7	29%	0.294	41%	0.409	S	S	.	.	S	Bend	trans	-149.5	176.8	171.3	64.6	40	0	0	0	111.5	V26 Y30 G31 Y32	V26-N28 PolarHBondContact O-N 2.96Å; N28-Y30 VanDerWaalsContact C-N 3.28Å; N28-Y30 PolarHBondContact O-N 3.41Å; N28-Y30 WeakPolarHBondContact OD1-CA 3.31Å; N28-Y30 WeakPolarHBondContact OD1-CB 3.48Å; N28-Y30 PolarHBondContact OD1-N 3.33Å; N28-G31 PolarHBondContact O-N 2.96Å; N28-G31 VanDerWaalsContact O-N 3.11Å; N28-G31 PolarHBondContact OD1-N 3.48Å; N28-Y32 PolarHBondContact O-N 3.22Å
29	Q	97	Very high	96	Very high	97 Å²	97	78.9 Å²	78.9	45%	0.453	41%	0.405	S	S	.	.	H	α-helix	trans	-56.1	-40.2	179.7	-174.1	176.2	-43.6	0	0	113.6	F13 Y32 F33	F13-Q29 HydrophobicContact CB-CG 4.07Å; F13-Q29 HydrophobicContact CD1-CB 3.75Å; F13-Q29 HydrophobicContact CD1-CG 3.83Å; F13-Q29 HydrophobicContact CD2-CB 3.93Å; F13-Q29 HydrophobicContact CD2-CG 4.01Å; F13-Q29 HydrophobicContact CE1-CB 3.7Å; F13-Q29 HydrophobicContact CE1-CG 4.32Å; F13-Q29 HydrophobicContact CE2-CB 3.92Å; F13-Q29 HydrophobicContact CE2-CG 4.5Å; F13-Q29 HydrophobicContact CG-CB 3.87Å; F13-Q29 HydrophobicContact CG-CG 3.66Å; F13-Q29 HydrophobicContact CZ-CB 3.79Å; F13-Q29 VanDerWaalsContact CZ-N 3.3Å; Q29-Y32 PolarHBondContact O-N 2.95Å; Q29-F33 HydrophobicContact CG-CD2 3.9Å; Q29-F33 HydrophobicContact CG-CE2 3.77Å; Q29-F33 VanDerWaalsContact O-CD2 3.26Å; Q29-F33 WeakPolarHBondContact O-CD2 3.21Å; Q29-F33 PolarHBondContact O-N 3.37Å
30	Y	96.9	Very high	95.9	Very high	163 Å²	163	79.4 Å²	79.4	64%	0.639	40%	0.398	S	S	*	.	H	α-helix	trans	-64.9	-45.8	177.8	172.6	-95	0	0	0	111	N28 F33 K34	N28-Y30 VanDerWaalsContact C-N 3.28Å; N28-Y30 PolarHBondContact O-N 3.41Å; N28-Y30 WeakPolarHBondContact OD1-CA 3.31Å; N28-Y30 WeakPolarHBondContact OD1-CB 3.48Å; N28-Y30 PolarHBondContact OD1-N 3.33Å; Y30-F33 PolarHBondContact O-N 3.01Å; Y30-K34 HydrophobicContact CE1-CB 4.46Å; Y30-K34 HydrophobicContact CE1-CD 3.75Å; Y30-K34 WeakPolarHBondContact O-CB 3.46Å; Y30-K34 PolarHBondContact O-N 3.36Å
31	G	97.1	Very high	95.8	Very high	4 Å²	4	83.8 Å²	83.8	4%	0.041	41%	0.412	C	S	.	.	H	α-helix	trans	-57.1	-48.9	174.9	0	0	0	0	0	112	Q25 N28 F33 K34 F35	Q25-G31 CarbonylContact O-C 3.34Å; Q25-G31 VanDerWaalsContact O-CA 3.26Å; Q25-G31 WeakPolarHBondContact O-CA 3.22Å; N28-G31 PolarHBondContact O-N 2.96Å; N28-G31 VanDerWaalsContact O-N 3.11Å; N28-G31 PolarHBondContact OD1-N 3.48Å; G31-F33 PolarHBondContact O-N 3.47Å; G31-K34 PolarHBondContact O-N 2.85Å; G31-F35 WeakPolarHBondContact O-CB 3.27Å; G31-F35 PolarHBondContact O-N 3.01Å
32	Y	98	Very high	95.7	Very high	52 Å²	52	89.8 Å²	89.8	20%	0.204	43%	0.434	C	S	.	.	H	α-helix	trans	-52.1	-53.6	176.9	-179.6	-104.5	0	0	0	112.8	E12 F13 G17 V26 N28 Q29 G36	E12-Y32 HydrophobicContact CB-CE1 4.43Å; F13-Y32 AromaticContact CD2-CD1 3.95Å; F13-Y32 HydrophobicContact CD2-CD1 3.95Å; F13-Y32 AromaticContact CD2-CG 3.89Å; F13-Y32 HydrophobicContact CD2-CG 3.89Å; F13-Y32 HydrophobicContact CE2-CG 4.41Å; G17-Y32 VanDerWaalsContact CA-CD2 3.4Å; G17-Y32 VanDerWaalsContact CA-CE2 3.41Å; V26-Y32 HydrophobicContact CG1-CD2 3.68Å; V26-Y32 HydrophobicContact CG1-CG 4.28Å; N28-Y32 PolarHBondContact O-N 3.22Å; Q29-Y32 PolarHBondContact O-N 2.95Å; Y32-G36 PolarHBondContact O-N 3.48Å
33	F	97.8	Very high	95.4	Very high	37 Å²	37	84.9 Å²	84.9	16%	0.162	41%	0.413	C	S	.	.	H	α-helix	trans	-72.4	-36.8	-179	-74.2	-64	0	0	0	113	R9 E12 F13 Q29 Y30 G31 G36 I37	R9-F33 HydrophobicContact CB-CE1 4.27Å; R9-F33 HydrophobicContact CB-CE2 4.04Å; R9-F33 HydrophobicContact CB-CZ 3.65Å; R9-F33 HydrophobicContact CG-CE1 4Å; R9-F33 HydrophobicContact CG-CE2 4.45Å; R9-F33 HydrophobicContact CG-CZ 3.9Å; R9-F33 VanDerWaalsContact O-CZ 3.23Å; R9-F33 WeakPolarHBondContact O-CZ 3.26Å; E12-F33 HydrophobicContact CB-CZ 4.3Å; F13-F33 HydrophobicContact CB-CE2 4.09Å; F13-F33 HydrophobicContact CB-CZ 4.35Å; Q29-F33 HydrophobicContact CG-CD2 3.9Å; Q29-F33 HydrophobicContact CG-CE2 3.77Å; Q29-F33 VanDerWaalsContact O-CD2 3.26Å; Q29-F33 WeakPolarHBondContact O-CD2 3.21Å; Q29-F33 PolarHBondContact O-N 3.37Å; Y30-F33 PolarHBondContact O-N 3.01Å; G31-F33 PolarHBondContact O-N 3.47Å; F33-G36 PolarHBondContact O-N 2.82Å; F33-I37 WeakPolarHBondContact O-CB 3.41Å; F33-I37 WeakPolarHBondContact O-CD1 3.45Å; F33-I37 VanDerWaalsContact O-CG1 3.25Å; F33-I37 WeakPolarHBondContact O-CG1 3.48Å; F33-I37 PolarHBondContact O-N 3.28Å
34	K	97.5	Very high	95	Very high	98 Å²	98	85.5 Å²	85.5	43%	0.426	42%	0.416	S	S	.	.	H	α-helix	trans	-60.9	-48.8	175.6	-179.7	-178.9	177.9	-178.2	0	110.5	Y30 G31 I37 Q38	Y30-K34 HydrophobicContact CE1-CB 4.46Å; Y30-K34 HydrophobicContact CE1-CD 3.75Å; Y30-K34 WeakPolarHBondContact O-CB 3.46Å; Y30-K34 PolarHBondContact O-N 3.36Å; G31-K34 PolarHBondContact O-N 2.85Å; K34-I37 PolarHBondContact O-N 3.39Å; K34-Q38 WeakPolarHBondContact O-CB 3.49Å; K34-Q38 VanDerWaalsContact O-CG 3.31Å; K34-Q38 WeakPolarHBondContact O-CG 3.24Å; K34-Q38 PolarHBondContact O-N 2.81Å
35	F	96.8	Very high	94.5	Very high	63 Å²	63	85.8 Å²	85.8	28%	0.276	41%	0.412	S	S	.	.	H	α-helix	trans	-60.8	-48.2	178.5	-179.2	-100	0	0	0	111.3	Q25 V26 G31 I37 Q38 L39	Q25-F35 HydrophobicContact CB-CD2 3.88Å; Q25-F35 HydrophobicContact CB-CE2 4.4Å; V26-F35 HydrophobicContact CG2-CB 3.92Å; V26-F35 HydrophobicContact CG2-CD1 3.89Å; V26-F35 HydrophobicContact CG2-CG 3.87Å; G31-F35 WeakPolarHBondContact O-CB 3.27Å; G31-F35 PolarHBondContact O-N 3.01Å; F35-I37 VanDerWaalsContact C-N 3.34Å; F35-I37 PolarHBondContact O-N 3.11Å; F35-Q38 PolarHBondContact O-N 2.9Å; F35-L39 HydrophobicContact CE1-CD2 4.38Å; F35-L39 WeakPolarHBondContact O-CB 3.47Å; F35-L39 PolarHBondContact O-N 3.27Å
36	G	95.5	Very high	93.8	Very high	36 Å²	36	84.3 Å²	84.3	37%	0.371	41%	0.406	S	S	.	.	H	α-helix	trans	-58.6	-42	177.4	0	0	0	0	0	113.4	Y32 F33 L39 M40	Y32-G36 PolarHBondContact O-N 3.48Å; F33-G36 PolarHBondContact O-N 2.82Å; G36-L39 PolarHBondContact O-N 2.75Å; G36-M40 WeakPolarHBondContact O-CB 3.25Å; G36-M40 PolarHBondContact O-N 3.27Å
37	I	96.5	Very high	93.3	Very high	71 Å²	71	90.9 Å²	90.9	36%	0.364	44%	0.435	S	S	.	.	H	α-helix	trans	-66.9	-43.9	176.7	-69.1	166.1	0	0	0	111.1	F33 K34 F35 L39 M40 Q41	F33-I37 WeakPolarHBondContact O-CB 3.41Å; F33-I37 WeakPolarHBondContact O-CD1 3.45Å; F33-I37 VanDerWaalsContact O-CG1 3.25Å; F33-I37 WeakPolarHBondContact O-CG1 3.48Å; F33-I37 PolarHBondContact O-N 3.28Å; K34-I37 PolarHBondContact O-N 3.39Å; F35-I37 VanDerWaalsContact C-N 3.34Å; F35-I37 PolarHBondContact O-N 3.11Å; I37-L39 VanDerWaalsContact C-N 3.33Å; I37-L39 PolarHBondContact O-N 3.24Å; I37-M40 WeakPolarHBondContact O-CB 3.47Å; I37-M40 PolarHBondContact O-N 3.43Å; I37-Q41 WeakPolarHBondContact O-CG 3.26Å; I37-Q41 PolarHBondContact O-N 2.99Å
38	Q	96.2	Very high	92.7	Very high	96 Å²	96	87.8 Å²	87.8	45%	0.449	43%	0.427	S	S	.	.	H	α-helix	trans	-62.4	-41.5	177.2	-74.3	177.6	-42.9	0	0	111.5	K34 F35 Q41 K42	K34-Q38 WeakPolarHBondContact O-CB 3.49Å; K34-Q38 VanDerWaalsContact O-CG 3.31Å; K34-Q38 WeakPolarHBondContact O-CG 3.24Å; K34-Q38 PolarHBondContact O-N 2.81Å; F35-Q38 PolarHBondContact O-N 2.9Å; Q38-Q41 PolarHBondContact O-N 3.5Å; Q38-K42 VanDerWaalsContact O-CB 3.31Å; Q38-K42 WeakPolarHBondContact O-CB 3.45Å; Q38-K42 PolarHBondContact O-N 3.5Å
39	L	94.8	Very high	92	Very high	78 Å²	78	87.9 Å²	87.9	41%	0.408	43%	0.427	S	S	.	.	H	α-helix	trans	-62.8	-46.2	176.2	-176.3	61.7	0	0	0	111.2	F35 G36 I37 Q41 K42 L43	F35-L39 HydrophobicContact CE1-CD2 4.38Å; F35-L39 WeakPolarHBondContact O-CB 3.47Å; F35-L39 PolarHBondContact O-N 3.27Å; G36-L39 PolarHBondContact O-N 2.75Å; I37-L39 VanDerWaalsContact C-N 3.33Å; I37-L39 PolarHBondContact O-N 3.24Å; L39-Q41 VanDerWaalsContact C-N 3.33Å; L39-Q41 PolarHBondContact O-N 2.92Å; L39-K42 PolarHBondContact O-N 3.31Å; L39-L43 HydrophobicContact CD1-CD1 3.9Å; L39-L43 HydrophobicContact CD1-CG 4.08Å; L39-L43 HydrophobicContact CG-CD1 3.97Å; L39-L43 HydrophobicContact CG-CG 4.48Å; L39-L43 WeakPolarHBondContact O-CB 3.37Å; L39-L43 WeakPolarHBondContact O-CG 3.44Å; L39-L43 PolarHBondContact O-N 3.14Å
40	M	94.1	Very high	91.1	Very high	124 Å²	124	86.1 Å²	86.1	61%	0.611	42%	0.419	S	S	*	.	H	α-helix	trans	-56.7	-46	175.3	179.9	-167.9	70.2	0	0	111.6	G36 I37 N44	G36-M40 WeakPolarHBondContact O-CB 3.25Å; G36-M40 PolarHBondContact O-N 3.27Å; I37-M40 WeakPolarHBondContact O-CB 3.47Å; I37-M40 PolarHBondContact O-N 3.43Å; M40-N44 PolarHBondContact O-N 3.29Å
41	Q	93	Very high	90.3	Very high	126 Å²	126	85.9 Å²	85.9	59%	0.589	42%	0.421	S	S	*	.	H	α-helix	trans	-66.3	-41.1	178.4	-73	174	-15.6	0	0	112.5	I37 Q38 L39	I37-Q41 WeakPolarHBondContact O-CG 3.26Å; I37-Q41 PolarHBondContact O-N 2.99Å; Q38-Q41 PolarHBondContact O-N 3.5Å; L39-Q41 VanDerWaalsContact C-N 3.33Å; L39-Q41 PolarHBondContact O-N 2.92Å
42	K	92.1	Very high	89.4	Confident	184 Å²	184	93.3 Å²	93.3	80%	0.8	45%	0.449	S	S	*	.	H	α-helix	trans	-66	-43.8	179.6	-177.4	177.5	179.1	-179.3	0	111.8	Q38 L39	Q38-K42 VanDerWaalsContact O-CB 3.31Å; Q38-K42 WeakPolarHBondContact O-CB 3.45Å; Q38-K42 PolarHBondContact O-N 3.5Å; L39-K42 PolarHBondContact O-N 3.31Å
43	L	90.3	Very high	87.9	Confident	84 Å²	84	99.9 Å²	99.9	44%	0.44	47%	0.474	S	S	.	.	H	α-helix	trans	-73.8	-35.2	-179.8	-67.9	176.4	0	0	0	112	L39 L45 T48	L39-L43 HydrophobicContact CD1-CD1 3.9Å; L39-L43 HydrophobicContact CD1-CG 4.08Å; L39-L43 HydrophobicContact CG-CD1 3.97Å; L39-L43 HydrophobicContact CG-CG 4.48Å; L39-L43 WeakPolarHBondContact O-CB 3.37Å; L39-L43 WeakPolarHBondContact O-CG 3.44Å; L39-L43 PolarHBondContact O-N 3.14Å; L43-L45 HydrophobicContact CB-CD2 4.3Å; L43-L45 HydrophobicContact CB-CG 4.21Å; L43-L45 PolarHBondContact O-N 3.06Å; L43-L45 VanDerWaalsContact O-N 3.12Å; L43-T48 PolarHBondContact O-OG1 3.32Å
44	N	86.8	Confident	86.3	Confident	73 Å²	73	100.1 Å²	100.1	39%	0.39	48%	0.48	S	S	.	.			trans	33.1	61.3	-176.8	-163.9	-19.8	0	0	0	111.6	M40 L46 K47 T48	M40-N44 PolarHBondContact O-N 3.29Å; N44-L46 PolarHBondContact O-N 3.24Å; N44-K47 HydrophobicContact CB-CB 4.11Å; N44-K47 WeakPolarHBondContact O-CB 3.23Å; N44-K47 PolarHBondContact O-N 2.82Å; N44-K47 VanDerWaalsContact OD1-CB 3.23Å; N44-K47 WeakPolarHBondContact OD1-CB 3.35Å; N44-K47 PolarHBondContact OD1-N 2.88Å; N44-T48 PolarHBondContact O-N 3.43Å; N44-T48 PolarHBondContact O-OG1 3.4Å
45	L	83	Confident	84.4	Confident	118 Å²	118	99.7 Å²	99.7	62%	0.618	48%	0.479	S	S	*	.	H	α-helix	trans	-55.8	-39.4	-168.3	-71.2	172.4	0	0	0	111.5	L43 T48 L49	L43-L45 HydrophobicContact CB-CD2 4.3Å; L43-L45 HydrophobicContact CB-CG 4.21Å; L43-L45 PolarHBondContact O-N 3.06Å; L43-L45 VanDerWaalsContact O-N 3.12Å; L45-T48 WeakPolarHBondContact O-CB 3.33Å; L45-T48 PolarHBondContact O-N 3.2Å; L45-L49 VanDerWaalsContact O-CG 3.32Å; L45-L49 WeakPolarHBondContact O-CG 3.15Å; L45-L49 PolarHBondContact O-N 3.19Å
46	L	80.3	Confident	82.9	Confident	78 Å²	78	106.1 Å²	106.1	41%	0.408	51%	0.51	S	S	.	.	H	α-helix	trans	-60.4	-49.8	176.8	-178.1	60.6	0	0	0	111.6	N44 T48 L49 M50 M62	N44-L46 PolarHBondContact O-N 3.24Å; L46-T48 PolarHBondContact O-N 3.09Å; L46-L49 PolarHBondContact O-N 2.96Å; L46-M50 HydrophobicContact CD1-CG 4.2Å; L46-M50 HydrophobicContact CD1-SD 4.22Å; L46-M50 HydrophobicContact CG-CG 4.37Å; L46-M50 HydrophobicContact CG-SD 3.89Å; L46-M50 WeakPolarHBondContact O-CB 3.35Å; L46-M50 VanDerWaalsContact O-CG 3.22Å; L46-M50 WeakPolarHBondContact O-CG 3.48Å; L46-M50 PolarHBondContact O-N 3Å; L46-M62 HydrophobicContact CD2-SD 4.43Å
47	K	84.1	Confident	81.7	Confident	144 Å²	144	110.5 Å²	110.5	63%	0.626	52%	0.522	S	S	*	.	H	α-helix	trans	-58.1	-39.2	176.1	-176.5	178.8	-177.5	177.6	0	111.7	N44 K51	N44-K47 HydrophobicContact CB-CB 4.11Å; N44-K47 WeakPolarHBondContact O-CB 3.23Å; N44-K47 PolarHBondContact O-N 2.82Å; N44-K47 VanDerWaalsContact OD1-CB 3.23Å; N44-K47 WeakPolarHBondContact OD1-CB 3.35Å; N44-K47 PolarHBondContact OD1-N 2.88Å; K47-K51 WeakPolarHBondContact O-CB 3.45Å; K47-K51 PolarHBondContact O-N 3.42Å
48	T	82.7	Confident	80.4	Confident	63 Å²	63	107.8 Å²	107.8	39%	0.387	51%	0.508	S	S	.	.	H	α-helix	trans	-64.7	-48.1	176.8	-60.4	0	0	0	0	111.2	L43 N44 L45 L46 M50 K51 Y52	L43-T48 PolarHBondContact O-OG1 3.32Å; N44-T48 PolarHBondContact O-N 3.43Å; N44-T48 PolarHBondContact O-OG1 3.4Å; L45-T48 WeakPolarHBondContact O-CB 3.33Å; L45-T48 PolarHBondContact O-N 3.2Å; L46-T48 PolarHBondContact O-N 3.09Å; T48-M50 PolarHBondContact O-N 2.89Å; T48-K51 WeakPolarHBondContact O-CB 3.42Å; T48-K51 PolarHBondContact O-N 3.42Å; T48-Y52 HydrophobicContact CG2-CD2 3.94Å; T48-Y52 HydrophobicContact CG2-CE2 3.87Å; T48-Y52 WeakPolarHBondContact O-CD2 2.79Å; T48-Y52 PolarHBondContact O-N 3.45Å
49	L	81.2	Confident	79.2	Confident	57 Å²	57	106.3 Å²	106.3	30%	0.298	51%	0.507	S	S	.	.	H	α-helix	trans	-60.6	-44.2	177	-70.4	170.4	0	0	0	111.8	L45 L46 K51 Y52 R53 M57 I58	L45-L49 VanDerWaalsContact O-CG 3.32Å; L45-L49 WeakPolarHBondContact O-CG 3.15Å; L45-L49 PolarHBondContact O-N 3.19Å; L46-L49 PolarHBondContact O-N 2.96Å; L49-K51 VanDerWaalsContact C-N 3.35Å; L49-K51 PolarHBondContact O-N 2.95Å; L49-Y52 PolarHBondContact O-N 3.47Å; L49-R53 PolarHBondContact O-N 2.94Å; L49-M57 HydrophobicContact CD2-CB 4.41Å; L49-M57 HydrophobicContact CD2-SD 4.15Å; L49-I58 HydrophobicContact CB-CG1 4.25Å
50	M	78.3	Confident	78.1	Confident	59 Å²	59	108.6 Å²	108.6	29%	0.291	52%	0.52	S	S	.	.	H	α-helix	trans	-59.8	-44.1	175.8	-69.2	173.9	86	0	0	111.7	L46 T48 Y52 R53 I58 I66	L46-M50 HydrophobicContact CD1-CG 4.2Å; L46-M50 HydrophobicContact CD1-SD 4.22Å; L46-M50 HydrophobicContact CG-CG 4.37Å; L46-M50 HydrophobicContact CG-SD 3.89Å; L46-M50 WeakPolarHBondContact O-CB 3.35Å; L46-M50 VanDerWaalsContact O-CG 3.22Å; L46-M50 WeakPolarHBondContact O-CG 3.48Å; L46-M50 PolarHBondContact O-N 3Å; T48-M50 PolarHBondContact O-N 2.89Å; M50-Y52 VanDerWaalsContact C-N 3.29Å; M50-Y52 PolarHBondContact O-N 3.17Å; M50-R53 PolarHBondContact O-N 3.2Å; M50-I58 HydrophobicContact CB-CD1 4.28Å; M50-I58 HydrophobicContact CG-CD1 3.89Å; M50-I66 HydrophobicContact CE-CD1 3.47Å; M50-I66 VanDerWaalsContact CE-CD1 3.47Å; M50-I66 HydrophobicContact CE-CG1 4.24Å
51	K	80.2	Confident	77.2	Confident	159 Å²	159	108.6 Å²	108.6	69%	0.691	52%	0.522	S	S	*	.	H	α-helix	trans	-59.5	-39.5	178.4	179.9	179.1	176.5	-175.2	0	112.3	K47 T48 L49 R53	K47-K51 WeakPolarHBondContact O-CB 3.45Å; K47-K51 PolarHBondContact O-N 3.42Å; T48-K51 WeakPolarHBondContact O-CB 3.42Å; T48-K51 PolarHBondContact O-N 3.42Å; L49-K51 VanDerWaalsContact C-N 3.35Å; L49-K51 PolarHBondContact O-N 2.95Å; K51-R53 VanDerWaalsContact C-N 3.31Å; K51-R53 PolarHBondContact O-N 2.93Å
52	Y	78.9	Confident	76	Confident	159 Å²	159	106.3 Å²	106.3	62%	0.624	51%	0.512	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.4	5.5	-176.5	-71.8	-68.6	0	0	0	114.4	T48 L49 M50 S54	T48-Y52 HydrophobicContact CG2-CD2 3.94Å; T48-Y52 HydrophobicContact CG2-CE2 3.87Å; T48-Y52 WeakPolarHBondContact O-CD2 2.79Å; T48-Y52 PolarHBondContact O-N 3.45Å; L49-Y52 PolarHBondContact O-N 3.47Å; M50-Y52 VanDerWaalsContact C-N 3.29Å; M50-Y52 PolarHBondContact O-N 3.17Å; Y52-S54 PolarHBondContact O-N 3.36Å; Y52-S54 VanDerWaalsContact O-N 3.1Å
53	R	65.5	Low	74.5	Confident	190 Å²	190	100.5 Å²	100.5	72%	0.717	49%	0.49	S	S	*	.	T	Hydrogen-bonded Turn	trans	46.6	41.2	-179.4	-71.8	-132.2	-136.3	148.1	0.8	112.7	L49 M50 K51 H55	L49-R53 PolarHBondContact O-N 2.94Å; M50-R53 PolarHBondContact O-N 3.2Å; K51-R53 VanDerWaalsContact C-N 3.31Å; K51-R53 PolarHBondContact O-N 2.93Å; R53-H55 WeakPolarHBondContact CD-NE2 3.45Å; R53-H55 PolarHBondContact O-CD2 3.26Å; R53-H55 PolarHBondContact O-N 2.98Å
54	S	65.1	Low	72.9	Confident	42 Å²	42	104.5 Å²	104.5	29%	0.294	51%	0.506	S	S	.	.			trans	-71.3	68.4	165.5	-64.8	0	0	0	0	108.3	Y52 H56 M57 I58	Y52-S54 PolarHBondContact O-N 3.36Å; Y52-S54 VanDerWaalsContact O-N 3.1Å; S54-H56 PolarHBondContact O-N 3.5Å; S54-M57 WeakPolarHBondContact O-CA 3.4Å; S54-M57 PolarHBondContact O-N 3.44Å; S54-I58 PolarHBondContact O-N 2.93Å
55	H	57.3	Low	71.2	Confident	89 Å²	89	105.7 Å²	105.7	41%	0.412	52%	0.52	S	S	.	.	T	Hydrogen-bonded Turn	trans	-53.7	-28.3	-175.5	-84.1	-83.9	0	0	0	112	R53 M57	R53-H55 WeakPolarHBondContact CD-NE2 3.45Å; R53-H55 PolarHBondContact O-CD2 3.26Å; R53-H55 PolarHBondContact O-N 2.98Å; H55-M57 VanDerWaalsContact C-N 3.33Å
56	H	65.8	Low	69.5	Low	199 Å²	199	109 Å²	109	92%	0.921	54%	0.536	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.8	-10.5	176.5	-56.6	96.1	0	0	0	114.5	S54	S54-H56 PolarHBondContact O-N 3.5Å
57	M	70.3	Confident	69	Low	128 Å²	128	110.6 Å²	110.6	63%	0.631	54%	0.543	S	S	*	.	T	Hydrogen-bonded Turn	trans	-108.1	-6.5	-179.4	-58	-177.5	102.8	0	0	112.8	L49 S54 H55	L49-M57 HydrophobicContact CD2-CB 4.41Å; L49-M57 HydrophobicContact CD2-SD 4.15Å; S54-M57 WeakPolarHBondContact O-CA 3.4Å; S54-M57 PolarHBondContact O-N 3.44Å; H55-M57 VanDerWaalsContact C-N 3.33Å
58	I	69	Low	68.2	Low	13 Å²	13	108.8 Å²	108.8	7%	0.067	54%	0.538	C	S	.	.	S	Bend	trans	-109.2	117.6	177.7	-55.3	168.3	0	0	0	106.8	L49 M50 S54 D60 M62 I63	L49-I58 HydrophobicContact CB-CG1 4.25Å; M50-I58 HydrophobicContact CB-CD1 4.28Å; M50-I58 HydrophobicContact CG-CD1 3.89Å; S54-I58 PolarHBondContact O-N 2.93Å; I58-D60 PolarHBondContact O-N 2.97Å; I58-M62 HydrophobicContact CG2-CB 4.1Å; I58-I63 HydrophobicContact CB-CG1 4.46Å; I58-I63 HydrophobicContact CG2-CG1 3.89Å
59	P	71.1	Confident	67.4	Low	65 Å²	65	111.4 Å²	111.4	42%	0.422	55%	0.547	S	S	.	.			trans	-52.5	132.8	172.9	-28	37	0	0	0	110.9	N61 M62	P59-N61 VanDerWaalsContact CB-OD1 3.24Å; P59-N61 WeakPolarHBondContact CB-OD1 3.46Å; P59-N61 PolarHBondContact O-N 2.87Å; P59-M62 HydrophobicContact CB-CE 4.28Å; P59-M62 HydrophobicContact CG-CE 3.75Å; P59-M62 WeakPolarHBondContact O-CA 3.44Å; P59-M62 WeakPolarHBondContact O-CB 3.38Å; P59-M62 PolarHBondContact O-N 3.08Å
60	D	71.2	Confident	66.6	Low	126 Å²	126	114.6 Å²	114.6	67%	0.674	56%	0.561	S	S	*	*	G	3₁₀ helix	trans	-55.5	-32.1	-172.8	-69	-33	0	0	0	113.2	I58 M62 I63	I58-D60 PolarHBondContact O-N 2.97Å; D60-M62 PolarHBondContact O-N 2.88Å; D60-I63 WeakPolarHBondContact O-CB 3.29Å; D60-I63 PolarHBondContact O-N 2.97Å; D60-I63 VanDerWaalsContact O-N 3.14Å
61	N	74.8	Confident	65.9	Low	124 Å²	124	118.1 Å²	118.1	66%	0.663	58%	0.578	S	S	*	*	G	3₁₀ helix	trans	-69.7	-15.4	176.8	71.2	-30.5	0	0	0	114.1	P59	P59-N61 VanDerWaalsContact CB-OD1 3.24Å; P59-N61 WeakPolarHBondContact CB-OD1 3.46Å; P59-N61 PolarHBondContact O-N 2.87Å
62	M	68.2	Low	64.9	Low	79 Å²	79	115.3 Å²	115.3	39%	0.389	57%	0.571	S	S	.	*	G	3₁₀ helix	trans	-93.4	-6.3	173.3	-69.2	-153.8	-110.7	0	0	113.1	L46 I58 P59 D60 S65	L46-M62 HydrophobicContact CD2-SD 4.43Å; I58-M62 HydrophobicContact CG2-CB 4.1Å; P59-M62 HydrophobicContact CB-CE 4.28Å; P59-M62 HydrophobicContact CG-CE 3.75Å; P59-M62 WeakPolarHBondContact O-CA 3.44Å; P59-M62 WeakPolarHBondContact O-CB 3.38Å; P59-M62 PolarHBondContact O-N 3.08Å; D60-M62 PolarHBondContact O-N 2.88Å; M62-S65 PolarHBondContact O-OG 3.09Å
63	I	61.3	Low	63.9	Low	62 Å²	62	112.2 Å²	112.2	32%	0.318	57%	0.567	S	S	.	*	T	Hydrogen-bonded Turn	trans	-77.5	-29	172.1	-60.3	-177.9	0	0	0	110.4	I58 D60 S65	I58-I63 HydrophobicContact CB-CG1 4.46Å; I58-I63 HydrophobicContact CG2-CG1 3.89Å; D60-I63 WeakPolarHBondContact O-CB 3.29Å; D60-I63 PolarHBondContact O-N 2.97Å; D60-I63 VanDerWaalsContact O-N 3.14Å; I63-S65 VanDerWaalsContact C-N 3.3Å; I63-S65 PolarHBondContact O-N 3.21Å
64	Q	55	Low	63.8	Low	168 Å²	168	106.2 Å²	106.2	79%	0.785	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81	5.3	-174.4	-65.1	-172.7	9.4	0	0	115.7	I66	Q64-I66 VanDerWaalsContact C-N 3.25Å; Q64-I66 PolarHBondContact O-N 2.92Å
65	S	51.6	Low	63.7	Low	97 Å²	97	111.6 Å²	111.6	68%	0.678	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.8	18.8	173.6	49.1	0	0	0	0	113.4	M62 I63	M62-S65 PolarHBondContact O-OG 3.09Å; I63-S65 VanDerWaalsContact C-N 3.3Å; I63-S65 PolarHBondContact O-N 3.21Å
66	I	48.2	Very low	64.2	Low	189 Å²	189	113.6 Å²	113.6	97%	0.969	59%	0.592	S	S	*	*			trans	-126.4	0	169.8	-61.5	174.5	0	0	0	107.9	M50 Q64	M50-I66 HydrophobicContact CE-CD1 3.47Å; M50-I66 VanDerWaalsContact CE-CD1 3.47Å; M50-I66 HydrophobicContact CE-CG1 4.24Å; Q64-I66 VanDerWaalsContact C-N 3.25Å; Q64-I66 PolarHBondContact O-N 2.92Å

Retrieved 66 of 66 residues in 311.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).