A0A5K4F7Z2_SCHMA Loading...

Secreted protein

AlphaFold DB , UniProt , Accession A0A5K4F7Z2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 82 aa.

						>A0A5K4F7Z2_SCHMA|A0A5K4F7Z2
MTLQKMILLVQLFVMLHLILLITVYAELTQTETPLWKKLWDEFGNILWAIVLGQLRNRHKKKTQTVQNKNIVDKHTNSPCES
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.8	Low	85	Confident	172 Å²	172	117.1 Å²	117.1	85%	0.847	59%	0.593	S	S	*	*				0	107.5	0	-148.8	-179.2	-172.7	0	0	106.8	M6 L9	M1-M6 HydrophobicContact CB-CE 4.09Å; M1-M6 HydrophobicContact CG-CE 4.27Å; M1-M6 HydrophobicContact SD-CE 3.76Å; M1-M6 HydrophobicContact SD-CG 4.39Å; M1-L9 HydrophobicContact CE-CD1 4.04Å
2	T	81.2	Confident	85.4	Confident	83 Å²	83	116.3 Å²	116.3	51%	0.509	59%	0.59	S	S	.	*			trans	-68.8	139.5	-175.3	22.3	0	0	0	0	110.6	Q4 K5 M6	T2-Q4 PolarHBondContact O-N 3.48Å; T2-K5 WeakPolarHBondContact O-CB 3.07Å; T2-K5 PolarHBondContact O-N 3.26Å; T2-M6 PolarHBondContact O-N 3.05Å
3	L	84.6	Confident	85.8	Confident	133 Å²	133	117.3 Å²	117.3	70%	0.696	59%	0.589	S	S	*	*	H	α-helix	trans	-45.5	-39.4	179.2	-167.3	92	0	0	0	112.4	K5 M6 I7	L3-K5 VanDerWaalsContact C-N 3.34Å; L3-K5 PolarHBondContact O-N 3.33Å; L3-M6 PolarHBondContact O-N 3.29Å; L3-M6 VanDerWaalsContact O-N 3.16Å; L3-I7 HydrophobicContact CD2-CD1 4.04Å; L3-I7 HydrophobicContact CG-CD1 4.16Å; L3-I7 WeakPolarHBondContact O-CG1 3.45Å; L3-I7 PolarHBondContact O-N 3.25Å
4	Q	86.1	Confident	86.3	Confident	154 Å²	154	114.7 Å²	114.7	72%	0.72	58%	0.582	S	S	*	*	H	α-helix	trans	-57.2	-40.4	176	-69.7	178.8	-34	0	0	113.8	T2 M6 I7 L8	T2-Q4 PolarHBondContact O-N 3.48Å; Q4-M6 VanDerWaalsContact C-N 3.34Å; Q4-I7 PolarHBondContact O-N 3.42Å; Q4-L8 WeakPolarHBondContact O-CB 3.5Å; Q4-L8 PolarHBondContact O-N 3.36Å
5	K	83.7	Confident	86.4	Confident	136 Å²	136	113.7 Å²	113.7	59%	0.591	58%	0.576	S	S	*	*	H	α-helix	trans	-67.5	-36.7	177.9	-68.9	-176.2	175.3	-176.4	0	111.4	T2 L3 L8 L9	T2-K5 WeakPolarHBondContact O-CB 3.07Å; T2-K5 PolarHBondContact O-N 3.26Å; L3-K5 VanDerWaalsContact C-N 3.34Å; L3-K5 PolarHBondContact O-N 3.33Å; K5-L8 PolarHBondContact O-N 3.01Å; K5-L9 WeakPolarHBondContact O-CG 3.47Å; K5-L9 PolarHBondContact O-N 3.07Å
6	M	86.5	Confident	86.7	Confident	92 Å²	92	112.9 Å²	112.9	45%	0.453	57%	0.573	S	S	.	*	H	α-helix	trans	-66.4	-44.7	175.2	-66.6	-177.5	178.8	0	0	111.2	M1 T2 L3 Q4 L8 L9 V10	M1-M6 HydrophobicContact CB-CE 4.09Å; M1-M6 HydrophobicContact CG-CE 4.27Å; M1-M6 HydrophobicContact SD-CE 3.76Å; M1-M6 HydrophobicContact SD-CG 4.39Å; T2-M6 PolarHBondContact O-N 3.05Å; L3-M6 PolarHBondContact O-N 3.29Å; L3-M6 VanDerWaalsContact O-N 3.16Å; Q4-M6 VanDerWaalsContact C-N 3.34Å; M6-L8 VanDerWaalsContact C-N 3.32Å; M6-L8 PolarHBondContact O-N 3.4Å; M6-L9 PolarHBondContact O-N 2.84Å; M6-V10 WeakPolarHBondContact O-CG2 3.39Å; M6-V10 PolarHBondContact O-N 3.21Å
7	I	90.4	Very high	86.8	Confident	97 Å²	97	111.4 Å²	111.4	50%	0.497	56%	0.563	S	S	.	*	H	α-helix	trans	-59.9	-44.2	176.7	-66	166.6	0	0	0	110.6	L3 Q4 L9 V10 Q11	L3-I7 HydrophobicContact CD2-CD1 4.04Å; L3-I7 HydrophobicContact CG-CD1 4.16Å; L3-I7 WeakPolarHBondContact O-CG1 3.45Å; L3-I7 PolarHBondContact O-N 3.25Å; Q4-I7 PolarHBondContact O-N 3.42Å; I7-L9 PolarHBondContact O-N 3.46Å; I7-V10 PolarHBondContact O-N 2.93Å; I7-Q11 WeakPolarHBondContact O-CB 3.25Å; I7-Q11 PolarHBondContact O-N 3.48Å
8	L	89.5	Confident	86.9	Confident	106 Å²	106	110.3 Å²	110.3	56%	0.555	56%	0.558	S	S	*	*	H	α-helix	trans	-64.9	-39.3	179.7	-167.5	145.9	0	0	0	112.1	Q4 K5 M6 Q11 L12	Q4-L8 WeakPolarHBondContact O-CB 3.5Å; Q4-L8 PolarHBondContact O-N 3.36Å; K5-L8 PolarHBondContact O-N 3.01Å; M6-L8 VanDerWaalsContact C-N 3.32Å; M6-L8 PolarHBondContact O-N 3.4Å; L8-Q11 PolarHBondContact O-N 3.21Å; L8-L12 HydrophobicContact CD2-CD1 3.87Å; L8-L12 WeakPolarHBondContact O-CB 3.38Å; L8-L12 PolarHBondContact O-N 3.1Å
9	L	89.6	Confident	86.8	Confident	98 Å²	98	109.7 Å²	109.7	51%	0.513	56%	0.556	S	S	.	*	H	α-helix	trans	-63.9	-43.6	173.9	-75.8	169.7	0	0	0	112.1	M1 K5 M6 I7 Q11 L12 F13	M1-L9 HydrophobicContact CE-CD1 4.04Å; K5-L9 WeakPolarHBondContact O-CG 3.47Å; K5-L9 PolarHBondContact O-N 3.07Å; M6-L9 PolarHBondContact O-N 2.84Å; I7-L9 PolarHBondContact O-N 3.46Å; L9-Q11 VanDerWaalsContact C-N 3.34Å; L9-L12 PolarHBondContact O-N 3.06Å; L9-F13 WeakPolarHBondContact O-CB 3.3Å; L9-F13 PolarHBondContact O-N 2.79Å
10	V	90.8	Very high	86.8	Confident	92 Å²	92	109.1 Å²	109.1	56%	0.558	55%	0.553	S	S	*	*	H	α-helix	trans	-63.6	-42.2	175.9	173	0	0	0	0	110.6	M6 I7 F13 V14	M6-V10 WeakPolarHBondContact O-CG2 3.39Å; M6-V10 PolarHBondContact O-N 3.21Å; I7-V10 PolarHBondContact O-N 2.93Å; V10-F13 WeakPolarHBondContact O-CB 3.43Å; V10-F13 PolarHBondContact O-N 2.72Å; V10-V14 HydrophobicContact CG1-CG2 4.38Å; V10-V14 VanDerWaalsContact O-CG2 3.3Å; V10-V14 WeakPolarHBondContact O-CG2 3.32Å; V10-V14 PolarHBondContact O-N 2.84Å
11	Q	89.6	Confident	86.6	Confident	125 Å²	125	109.7 Å²	109.7	58%	0.584	56%	0.557	S	S	*	*	H	α-helix	trans	-64	-43	178	-172.3	172.4	-11.8	0	0	111.8	I7 L8 L9 F13 V14 M15	I7-Q11 WeakPolarHBondContact O-CB 3.25Å; I7-Q11 PolarHBondContact O-N 3.48Å; L8-Q11 PolarHBondContact O-N 3.21Å; L9-Q11 VanDerWaalsContact C-N 3.34Å; Q11-F13 VanDerWaalsContact C-N 3.34Å; Q11-F13 PolarHBondContact O-N 2.85Å; Q11-V14 PolarHBondContact O-N 3.34Å; Q11-M15 WeakPolarHBondContact O-CB 3.45Å; Q11-M15 VanDerWaalsContact O-CG 3.28Å; Q11-M15 WeakPolarHBondContact O-CG 3.2Å; Q11-M15 PolarHBondContact O-N 3.42Å
12	L	89.8	Confident	87.6	Confident	107 Å²	107	106.1 Å²	106.1	56%	0.56	54%	0.541	S	S	*	.	H	α-helix	trans	-60	-44	173.3	-108.8	158.2	0	0	0	111.8	L8 L9 M15 L16	L8-L12 HydrophobicContact CD2-CD1 3.87Å; L8-L12 WeakPolarHBondContact O-CB 3.38Å; L8-L12 PolarHBondContact O-N 3.1Å; L9-L12 PolarHBondContact O-N 3.06Å; L12-M15 PolarHBondContact O-N 3.35Å; L12-L16 WeakPolarHBondContact O-CB 3.26Å; L12-L16 PolarHBondContact O-N 3.28Å
13	F	91.3	Very high	87.7	Confident	130 Å²	130	105.3 Å²	105.3	57%	0.57	54%	0.536	S	S	*	.	H	α-helix	trans	-60.7	-47.8	176.7	-176.4	-93.4	0	0	0	111.4	L9 V10 Q11 M15 L16 H17	L9-F13 WeakPolarHBondContact O-CB 3.3Å; L9-F13 PolarHBondContact O-N 2.79Å; V10-F13 WeakPolarHBondContact O-CB 3.43Å; V10-F13 PolarHBondContact O-N 2.72Å; Q11-F13 VanDerWaalsContact C-N 3.34Å; Q11-F13 PolarHBondContact O-N 2.85Å; F13-M15 PolarHBondContact O-N 2.9Å; F13-L16 PolarHBondContact O-N 3.49Å; F13-H17 AromaticContact CD1-CE1 3.82Å; F13-H17 AromaticContact CD1-ND1 3.74Å; F13-H17 AromaticContact CD2-CE1 3.59Å; F13-H17 AromaticContact CE1-CE1 3.39Å; F13-H17 WeakPolarHBondContact CE1-CE1 3.4Å; F13-H17 AromaticContact CE1-ND1 3.66Å; F13-H17 AromaticContact CE1-NE2 3.82Å; F13-H17 AromaticContact CE2-CE1 3.16Å; F13-H17 WeakPolarHBondContact CE2-CE1 3.21Å; F13-H17 AromaticContact CE2-ND1 3.99Å; F13-H17 AromaticContact CE2-NE2 3.89Å; F13-H17 AromaticContact CG-CE1 3.91Å; F13-H17 AromaticContact CG-ND1 3.93Å; F13-H17 AromaticContact CZ-CE1 3.04Å; F13-H17 WeakPolarHBondContact CZ-CE1 3.34Å; F13-H17 AromaticContact CZ-ND1 3.8Å; F13-H17 AromaticContact CZ-NE2 3.41Å; F13-H17 WeakPolarHBondContact CZ-NE2 3.33Å; F13-H17 PolarHBondContact O-N 2.81Å; F13-H17 PolarHBondContact O-ND1 3.44Å
14	V	91.8	Very high	87.5	Confident	81 Å²	81	102.8 Å²	102.8	49%	0.491	53%	0.525	S	S	.	.	H	α-helix	trans	-61.3	-44.3	177.7	172.3	0	0	0	0	111.4	V10 Q11 L16 H17 L18	V10-V14 HydrophobicContact CG1-CG2 4.38Å; V10-V14 VanDerWaalsContact O-CG2 3.3Å; V10-V14 WeakPolarHBondContact O-CG2 3.32Å; V10-V14 PolarHBondContact O-N 2.84Å; Q11-V14 PolarHBondContact O-N 3.34Å; V14-L16 PolarHBondContact O-N 3.26Å; V14-H17 PolarHBondContact O-N 3.33Å; V14-L18 WeakPolarHBondContact O-CB 3.49Å; V14-L18 PolarHBondContact O-N 2.85Å
15	M	88.5	Confident	86.9	Confident	100 Å²	100	99.4 Å²	99.4	49%	0.493	51%	0.507	S	S	.	.	H	α-helix	trans	-63.2	-41.2	178	-71.4	-64.4	-68.7	0	0	112.3	Q11 L12 F13 H17 L18 I19	Q11-M15 WeakPolarHBondContact O-CB 3.45Å; Q11-M15 VanDerWaalsContact O-CG 3.28Å; Q11-M15 WeakPolarHBondContact O-CG 3.2Å; Q11-M15 PolarHBondContact O-N 3.42Å; L12-M15 PolarHBondContact O-N 3.35Å; F13-M15 PolarHBondContact O-N 2.9Å; M15-H17 PolarHBondContact O-N 3.49Å; M15-L18 PolarHBondContact O-N 3.17Å; M15-I19 WeakPolarHBondContact O-CG1 3.19Å; M15-I19 PolarHBondContact O-N 3.36Å
16	L	90.5	Very high	86.4	Confident	101 Å²	101	95.1 Å²	95.1	53%	0.529	50%	0.497	S	S	.	.	H	α-helix	trans	-60.5	-45.7	176	-169.4	92.7	0	0	0	111.2	L12 F13 V14 L18 I19 L20	L12-L16 WeakPolarHBondContact O-CB 3.26Å; L12-L16 PolarHBondContact O-N 3.28Å; F13-L16 PolarHBondContact O-N 3.49Å; V14-L16 PolarHBondContact O-N 3.26Å; L16-L18 VanDerWaalsContact C-N 3.32Å; L16-L18 PolarHBondContact O-N 3.48Å; L16-I19 PolarHBondContact O-N 2.91Å; L16-L20 HydrophobicContact CD2-CD1 4.34Å; L16-L20 HydrophobicContact CG-CD1 4.37Å; L16-L20 WeakPolarHBondContact O-CG 3.46Å; L16-L20 PolarHBondContact O-N 3.38Å
17	H	88.8	Confident	85.8	Confident	86 Å²	86	96.8 Å²	96.8	40%	0.398	50%	0.503	S	S	.	.	H	α-helix	trans	-66.2	-37.3	178.3	-73.3	68	0	0	0	111.6	F13 V14 M15 L20 L21	F13-H17 AromaticContact CD1-CE1 3.82Å; F13-H17 AromaticContact CD1-ND1 3.74Å; F13-H17 AromaticContact CD2-CE1 3.59Å; F13-H17 AromaticContact CE1-CE1 3.39Å; F13-H17 WeakPolarHBondContact CE1-CE1 3.4Å; F13-H17 AromaticContact CE1-ND1 3.66Å; F13-H17 AromaticContact CE1-NE2 3.82Å; F13-H17 AromaticContact CE2-CE1 3.16Å; F13-H17 WeakPolarHBondContact CE2-CE1 3.21Å; F13-H17 AromaticContact CE2-ND1 3.99Å; F13-H17 AromaticContact CE2-NE2 3.89Å; F13-H17 AromaticContact CG-CE1 3.91Å; F13-H17 AromaticContact CG-ND1 3.93Å; F13-H17 AromaticContact CZ-CE1 3.04Å; F13-H17 WeakPolarHBondContact CZ-CE1 3.34Å; F13-H17 AromaticContact CZ-ND1 3.8Å; F13-H17 AromaticContact CZ-NE2 3.41Å; F13-H17 WeakPolarHBondContact CZ-NE2 3.33Å; F13-H17 PolarHBondContact O-N 2.81Å; F13-H17 PolarHBondContact O-ND1 3.44Å; V14-H17 PolarHBondContact O-N 3.33Å; M15-H17 PolarHBondContact O-N 3.49Å; H17-L20 PolarHBondContact O-N 3.44Å; H17-L21 WeakPolarHBondContact O-CB 3.31Å; H17-L21 PolarHBondContact O-N 3.44Å
18	L	88.2	Confident	84.8	Confident	93 Å²	93	95.2 Å²	95.2	49%	0.487	50%	0.496	S	S	.	.	H	α-helix	trans	-63.4	-43.7	176.6	-161.4	115.7	0	0	0	111.2	V14 M15 L16 L21 I22	V14-L18 WeakPolarHBondContact O-CB 3.49Å; V14-L18 PolarHBondContact O-N 2.85Å; M15-L18 PolarHBondContact O-N 3.17Å; L16-L18 VanDerWaalsContact C-N 3.32Å; L16-L18 PolarHBondContact O-N 3.48Å; L18-L21 PolarHBondContact O-N 2.77Å; L18-I22 HydrophobicContact CD2-CD1 3.75Å; L18-I22 HydrophobicContact CG-CD1 4.2Å; L18-I22 WeakPolarHBondContact O-CB 3.35Å; L18-I22 WeakPolarHBondContact O-CD1 3.42Å; L18-I22 WeakPolarHBondContact O-CG1 3.08Å; L18-I22 PolarHBondContact O-N 2.86Å
19	I	86.1	Confident	83.6	Confident	99 Å²	99	92 Å²	92	51%	0.508	48%	0.48	S	S	.	.	H	α-helix	trans	-63.8	-49.5	175.9	-66.5	166.5	0	0	0	110.3	M15 L16 L21 I22 T23	M15-I19 WeakPolarHBondContact O-CG1 3.19Å; M15-I19 PolarHBondContact O-N 3.36Å; L16-I19 PolarHBondContact O-N 2.91Å; I19-L21 VanDerWaalsContact C-N 3.29Å; I19-L21 PolarHBondContact O-N 2.97Å; I19-I22 PolarHBondContact O-N 2.95Å; I19-I22 VanDerWaalsContact O-N 3.17Å; I19-T23 PolarHBondContact O-N 2.84Å; I19-T23 PolarHBondContact O-OG1 2.95Å; I19-T23 VanDerWaalsContact O-OG1 3.06Å
20	L	85.6	Confident	82.4	Confident	96 Å²	96	95 Å²	95	50%	0.503	49%	0.492	S	S	.	.	H	α-helix	trans	-57.5	-44	177.6	-75.2	171.1	0	0	0	111.7	L16 H17 I22 T23 V24	L16-L20 HydrophobicContact CD2-CD1 4.34Å; L16-L20 HydrophobicContact CG-CD1 4.37Å; L16-L20 WeakPolarHBondContact O-CG 3.46Å; L16-L20 PolarHBondContact O-N 3.38Å; H17-L20 PolarHBondContact O-N 3.44Å; L20-I22 VanDerWaalsContact C-N 3.35Å; L20-I22 PolarHBondContact O-N 2.84Å; L20-T23 PolarHBondContact O-N 3.36Å; L20-V24 WeakPolarHBondContact O-CB 3.5Å; L20-V24 WeakPolarHBondContact O-CG2 3.39Å; L20-V24 PolarHBondContact O-N 3.35Å
21	L	83.8	Confident	81.2	Confident	122 Å²	122	96 Å²	96	64%	0.639	50%	0.498	S	S	*	.	H	α-helix	trans	-65.7	-39	179.5	-164.4	147.4	0	0	0	111.3	H17 L18 I19 Y25	H17-L21 WeakPolarHBondContact O-CB 3.31Å; H17-L21 PolarHBondContact O-N 3.44Å; L18-L21 PolarHBondContact O-N 2.77Å; I19-L21 VanDerWaalsContact C-N 3.29Å; I19-L21 PolarHBondContact O-N 2.97Å; L21-Y25 WeakPolarHBondContact O-CB 3.45Å; L21-Y25 PolarHBondContact O-N 3.5Å
22	I	84.4	Confident	80	Confident	97 Å²	97	94.3 Å²	94.3	50%	0.497	49%	0.49	S	S	.	.	H	α-helix	trans	-66.9	-43.5	174.3	-67.8	163.7	0	0	0	111.2	L18 I19 L20 Y25 A26	L18-I22 HydrophobicContact CD2-CD1 3.75Å; L18-I22 HydrophobicContact CG-CD1 4.2Å; L18-I22 WeakPolarHBondContact O-CB 3.35Å; L18-I22 WeakPolarHBondContact O-CD1 3.42Å; L18-I22 WeakPolarHBondContact O-CG1 3.08Å; L18-I22 PolarHBondContact O-N 2.86Å; I19-I22 PolarHBondContact O-N 2.95Å; I19-I22 VanDerWaalsContact O-N 3.17Å; L20-I22 VanDerWaalsContact C-N 3.35Å; L20-I22 PolarHBondContact O-N 2.84Å; I22-Y25 PolarHBondContact O-N 3.32Å; I22-A26 VanDerWaalsContact O-CB 3.32Å; I22-A26 WeakPolarHBondContact O-CB 3.17Å; I22-A26 PolarHBondContact O-N 3.03Å
23	T	82.4	Confident	78.8	Confident	67 Å²	67	93.7 Å²	93.7	41%	0.411	49%	0.491	S	S	.	.	H	α-helix	trans	-64.5	-46.7	178.4	-56.1	0	0	0	0	111.1	I19 L20 Y25 A26 E27	I19-T23 PolarHBondContact O-N 2.84Å; I19-T23 PolarHBondContact O-OG1 2.95Å; I19-T23 VanDerWaalsContact O-OG1 3.06Å; L20-T23 PolarHBondContact O-N 3.36Å; T23-Y25 VanDerWaalsContact C-N 3.32Å; T23-Y25 PolarHBondContact O-N 3.11Å; T23-A26 WeakPolarHBondContact O-CB 3.47Å; T23-A26 PolarHBondContact O-N 2.98Å; T23-E27 PolarHBondContact O-N 3.48Å
24	V	79.9	Confident	77.8	Confident	79 Å²	79	92.1 Å²	92.1	48%	0.479	49%	0.494	S	S	.	.	H	α-helix	trans	-62.3	-41.6	175.1	172.1	0	0	0	0	110.6	L20 E27 L28	L20-V24 WeakPolarHBondContact O-CB 3.5Å; L20-V24 WeakPolarHBondContact O-CG2 3.39Å; L20-V24 PolarHBondContact O-N 3.35Å; V24-E27 PolarHBondContact O-N 2.9Å; V24-L28 HydrophobicContact CG1-CD1 3.89Å; V24-L28 WeakPolarHBondContact O-CB 3.31Å; V24-L28 PolarHBondContact O-N 3.32Å
25	Y	73.6	Confident	76.7	Confident	84 Å²	84	93 Å²	93	33%	0.329	50%	0.495	S	S	.	.	H	α-helix	trans	-63.5	-40.1	175.4	-176.4	-95.1	0	0	0	111.9	L21 I22 T23 L28 T29 W36	L21-Y25 WeakPolarHBondContact O-CB 3.45Å; L21-Y25 PolarHBondContact O-N 3.5Å; I22-Y25 PolarHBondContact O-N 3.32Å; T23-Y25 VanDerWaalsContact C-N 3.32Å; T23-Y25 PolarHBondContact O-N 3.11Å; Y25-L28 PolarHBondContact O-N 2.96Å; Y25-T29 HydrophobicContact CD1-CG2 3.92Å; Y25-T29 HydrophobicContact CD2-CG2 4.4Å; Y25-T29 HydrophobicContact CE1-CG2 3.58Å; Y25-T29 HydrophobicContact CE2-CG2 4.1Å; Y25-T29 HydrophobicContact CG-CG2 4.32Å; Y25-T29 VanDerWaalsContact O-CB 3.3Å; Y25-T29 WeakPolarHBondContact O-CB 3.39Å; Y25-T29 WeakPolarHBondContact O-CG2 3.2Å; Y25-T29 PolarHBondContact O-N 3.32Å; Y25-T29 PolarHBondContact O-OG1 3.46Å; Y25-W36 HydrophobicContact CD2-CE3 4.12Å; Y25-W36 HydrophobicContact CD2-CH2 4.3Å; Y25-W36 AromaticContact CD2-CZ3 3.87Å; Y25-W36 HydrophobicContact CD2-CZ3 3.87Å; Y25-W36 HydrophobicContact CE2-CD2 4.4Å; Y25-W36 AromaticContact CE2-CE3 3.59Å; Y25-W36 HydrophobicContact CE2-CE3 3.59Å; Y25-W36 HydrophobicContact CE2-CH2 4.5Å; Y25-W36 AromaticContact CE2-CZ3 3.64Å; Y25-W36 HydrophobicContact CE2-CZ3 3.64Å
26	A	74.1	Confident	75.8	Confident	46 Å²	46	91.2 Å²	91.2	38%	0.38	48%	0.483	S	S	.	.	H	α-helix	trans	-65	-40.5	176.1	0	0	0	0	0	111.8	I22 T23 T29 Q30	I22-A26 VanDerWaalsContact O-CB 3.32Å; I22-A26 WeakPolarHBondContact O-CB 3.17Å; I22-A26 PolarHBondContact O-N 3.03Å; T23-A26 WeakPolarHBondContact O-CB 3.47Å; T23-A26 PolarHBondContact O-N 2.98Å; A26-T29 WeakPolarHBondContact CA-OG1 3.3Å; A26-T29 PolarHBondContact O-OG1 3.29Å; A26-Q30 WeakPolarHBondContact O-CG 3.39Å; A26-Q30 PolarHBondContact O-N 3.47Å
27	E	73.5	Confident	74.9	Confident	126 Å²	126	93.4 Å²	93.4	59%	0.589	49%	0.488	S	S	*	.	H	α-helix	trans	-68.9	-44.5	175.4	-73.5	-176.3	-179	0	0	111.9	T23 V24 T29 Q30 T31	T23-E27 PolarHBondContact O-N 3.48Å; V24-E27 PolarHBondContact O-N 2.9Å; E27-T29 PolarHBondContact O-N 3.5Å; E27-Q30 PolarHBondContact O-N 3.32Å; E27-T31 PolarHBondContact O-N 3.07Å; E27-T31 PolarHBondContact O-OG1 3.49Å
28	L	68.5	Low	74.3	Confident	65 Å²	65	95.7 Å²	95.7	34%	0.34	50%	0.497	S	S	.	.	H	α-helix	trans	-67.5	-34.8	178.7	-104.7	82.8	0	0	0	112.9	V24 Y25 Q30 T31 E32 W36	V24-L28 HydrophobicContact CG1-CD1 3.89Å; V24-L28 WeakPolarHBondContact O-CB 3.31Å; V24-L28 PolarHBondContact O-N 3.32Å; Y25-L28 PolarHBondContact O-N 2.96Å; L28-Q30 VanDerWaalsContact C-N 3.26Å; L28-Q30 PolarHBondContact O-N 3Å; L28-T31 PolarHBondContact O-N 2.87Å; L28-T31 PolarHBondContact O-OG1 2.85Å; L28-E32 PolarHBondContact O-N 3.3Å; L28-W36 HydrophobicContact CB-CZ2 4.24Å; L28-W36 HydrophobicContact CD2-CZ2 3.36Å; L28-W36 HydrophobicContact CG-CZ2 4.4Å
29	T	65.9	Low	73.8	Confident	37 Å²	37	94.9 Å²	94.9	23%	0.227	49%	0.493	C	S	.	.	H	α-helix	trans	-68.4	-26.9	176.5	47.2	0	0	0	0	112	Y25 A26 E27 T33 W36	Y25-T29 HydrophobicContact CD1-CG2 3.92Å; Y25-T29 HydrophobicContact CD2-CG2 4.4Å; Y25-T29 HydrophobicContact CE1-CG2 3.58Å; Y25-T29 HydrophobicContact CE2-CG2 4.1Å; Y25-T29 HydrophobicContact CG-CG2 4.32Å; Y25-T29 VanDerWaalsContact O-CB 3.3Å; Y25-T29 WeakPolarHBondContact O-CB 3.39Å; Y25-T29 WeakPolarHBondContact O-CG2 3.2Å; Y25-T29 PolarHBondContact O-N 3.32Å; Y25-T29 PolarHBondContact O-OG1 3.46Å; A26-T29 WeakPolarHBondContact CA-OG1 3.3Å; A26-T29 PolarHBondContact O-OG1 3.29Å; E27-T29 PolarHBondContact O-N 3.5Å; T29-T33 WeakPolarHBondContact O-CG2 3.41Å; T29-T33 PolarHBondContact O-N 2.74Å; T29-W36 HydrophobicContact CG2-CB 4.38Å; T29-W36 HydrophobicContact CG2-CG 4.39Å
30	Q	63.9	Low	73.4	Confident	163 Å²	163	97.8 Å²	97.8	76%	0.762	50%	0.498	S	S	*	.	H	α-helix	trans	-75.2	-36.2	175.1	-74.5	-173.6	7.4	0	0	113	A26 E27 L28	A26-Q30 WeakPolarHBondContact O-CG 3.39Å; A26-Q30 PolarHBondContact O-N 3.47Å; E27-Q30 PolarHBondContact O-N 3.32Å; L28-Q30 VanDerWaalsContact C-N 3.26Å; L28-Q30 PolarHBondContact O-N 3Å
31	T	64.9	Low	73.2	Confident	111 Å²	111	97.6 Å²	97.6	68%	0.681	50%	0.497	S	S	*	.	H	α-helix	trans	-83.4	-31.8	-177.8	44.2	0	0	0	0	113.4	E27 L28	E27-T31 PolarHBondContact O-N 3.07Å; E27-T31 PolarHBondContact O-OG1 3.49Å; L28-T31 PolarHBondContact O-N 2.87Å; L28-T31 PolarHBondContact O-OG1 2.85Å
32	E	64.8	Low	73.1	Confident	91 Å²	91	96.8 Å²	96.8	43%	0.425	49%	0.49	S	S	.	.			trans	-135.2	47.2	-173.5	-61.4	-165.5	156.4	0	0	113.4	L28 P34 L35 W36	L28-E32 PolarHBondContact O-N 3.3Å; E32-P34 VanDerWaalsContact C-N 3.28Å; E32-P34 VanDerWaalsContact O-N 3.1Å; E32-L35 HydrophobicContact CB-CB 4.34Å; E32-L35 HydrophobicContact CB-CD1 4.46Å; E32-L35 PolarHBondContact O-N 2.89Å; E32-L35 VanDerWaalsContact O-N 3.07Å; E32-L35 WeakPolarHBondContact OE2-CD1 3.16Å; E32-W36 PolarHBondContact O-N 3.5Å; E32-W36 VanDerWaalsContact O-N 3.1Å
33	T	65.1	Low	73	Confident	94 Å²	94	97.7 Å²	97.7	58%	0.577	49%	0.491	S	S	*	.	H	α-helix	trans	-40.3	-44.1	173.7	32.5	0	0	0	0	115.2	T29 K37	T29-T33 WeakPolarHBondContact O-CG2 3.41Å; T29-T33 PolarHBondContact O-N 2.74Å; T33-K37 VanDerWaalsContact O-CB 3.25Å; T33-K37 WeakPolarHBondContact O-CB 3.45Å; T33-K37 PolarHBondContact O-N 3.39Å
34	P	68.8	Low	72.9	Confident	96 Å²	96	96.1 Å²	96.1	62%	0.623	49%	0.487	S	S	*	.	H	α-helix	trans	-73.4	-34.5	-178.1	26.9	-34.4	0	0	0	113.9	E32 K38	E32-P34 VanDerWaalsContact C-N 3.28Å; E32-P34 VanDerWaalsContact O-N 3.1Å; P34-K38 PolarHBondContact O-N 2.93Å
35	L	69.8	Low	73	Confident	101 Å²	101	97.8 Å²	97.8	53%	0.529	49%	0.494	S	S	.	.	H	α-helix	trans	-76.2	-43.2	-178.1	-71.7	172.1	0	0	0	111.2	E32 K37 K38 L39	E32-L35 HydrophobicContact CB-CB 4.34Å; E32-L35 HydrophobicContact CB-CD1 4.46Å; E32-L35 PolarHBondContact O-N 2.89Å; E32-L35 VanDerWaalsContact O-N 3.07Å; E32-L35 WeakPolarHBondContact OE2-CD1 3.16Å; L35-K37 PolarHBondContact O-N 3.49Å; L35-K38 PolarHBondContact O-N 3.26Å; L35-L39 WeakPolarHBondContact O-CB 3.04Å; L35-L39 PolarHBondContact O-N 2.93Å
36	W	68.9	Low	73.4	Confident	62 Å²	62	98.5 Å²	98.5	24%	0.235	50%	0.502	C	S	.	.	H	α-helix	trans	-64.7	-39.7	176.7	-86.1	95.1	0	0	0	112.8	Y25 L28 T29 E32 K38 L39 W40	Y25-W36 HydrophobicContact CD2-CE3 4.12Å; Y25-W36 HydrophobicContact CD2-CH2 4.3Å; Y25-W36 AromaticContact CD2-CZ3 3.87Å; Y25-W36 HydrophobicContact CD2-CZ3 3.87Å; Y25-W36 HydrophobicContact CE2-CD2 4.4Å; Y25-W36 AromaticContact CE2-CE3 3.59Å; Y25-W36 HydrophobicContact CE2-CE3 3.59Å; Y25-W36 HydrophobicContact CE2-CH2 4.5Å; Y25-W36 AromaticContact CE2-CZ3 3.64Å; Y25-W36 HydrophobicContact CE2-CZ3 3.64Å; L28-W36 HydrophobicContact CB-CZ2 4.24Å; L28-W36 HydrophobicContact CD2-CZ2 3.36Å; L28-W36 HydrophobicContact CG-CZ2 4.4Å; T29-W36 HydrophobicContact CG2-CB 4.38Å; T29-W36 HydrophobicContact CG2-CG 4.39Å; E32-W36 PolarHBondContact O-N 3.5Å; E32-W36 VanDerWaalsContact O-N 3.1Å; W36-K38 VanDerWaalsContact C-N 3.33Å; W36-K38 PolarHBondContact O-N 3.36Å; W36-L39 HydrophobicContact CE3-CD2 4.25Å; W36-L39 HydrophobicContact CH2-CD2 4.42Å; W36-L39 HydrophobicContact CZ3-CD2 4.05Å; W36-L39 PolarHBondContact O-N 2.88Å; W36-W40 VanDerWaalsContact O-CB 3.26Å; W36-W40 WeakPolarHBondContact O-CB 3.39Å; W36-W40 PolarHBondContact O-N 3.39Å
37	K	72.5	Confident	73.7	Confident	146 Å²	146	101.5 Å²	101.5	64%	0.635	51%	0.511	S	S	*	.	H	α-helix	trans	-61.5	-43.9	175.6	-171.7	176	-177.8	178.8	0	111.2	T33 L35 W40 D41	T33-K37 VanDerWaalsContact O-CB 3.25Å; T33-K37 WeakPolarHBondContact O-CB 3.45Å; T33-K37 PolarHBondContact O-N 3.39Å; L35-K37 PolarHBondContact O-N 3.49Å; K37-W40 PolarHBondContact O-N 3.4Å; K37-D41 WeakPolarHBondContact O-CB 3.46Å; K37-D41 PolarHBondContact O-N 2.94Å
38	K	76.7	Confident	73.9	Confident	135 Å²	135	103.3 Å²	103.3	59%	0.587	51%	0.513	S	S	*	.	H	α-helix	trans	-64.3	-44.5	176.9	-170.8	177.6	179.3	-176.4	0	112	P34 L35 W36 W40 D41 E42	P34-K38 PolarHBondContact O-N 2.93Å; L35-K38 PolarHBondContact O-N 3.26Å; W36-K38 VanDerWaalsContact C-N 3.33Å; W36-K38 PolarHBondContact O-N 3.36Å; K38-W40 VanDerWaalsContact C-N 3.34Å; K38-W40 PolarHBondContact O-N 3.45Å; K38-D41 PolarHBondContact O-N 2.82Å; K38-E42 PolarHBondContact O-N 2.86Å
39	L	77.6	Confident	74.4	Confident	76 Å²	76	103.1 Å²	103.1	40%	0.398	52%	0.521	S	S	.	.	H	α-helix	trans	-61.1	-45.3	176.5	-163.2	75	0	0	0	110.6	L35 W36 E42 F43	L35-L39 WeakPolarHBondContact O-CB 3.04Å; L35-L39 PolarHBondContact O-N 2.93Å; W36-L39 HydrophobicContact CE3-CD2 4.25Å; W36-L39 HydrophobicContact CH2-CD2 4.42Å; W36-L39 HydrophobicContact CZ3-CD2 4.05Å; W36-L39 PolarHBondContact O-N 2.88Å; L39-E42 PolarHBondContact O-N 3.47Å; L39-F43 HydrophobicContact CD1-CD2 4.22Å; L39-F43 HydrophobicContact CD1-CE2 3.93Å; L39-F43 HydrophobicContact CD2-CE2 4.34Å; L39-F43 HydrophobicContact CG-CD2 3.85Å; L39-F43 HydrophobicContact CG-CE2 3.87Å; L39-F43 WeakPolarHBondContact O-CB 3.28Å; L39-F43 VanDerWaalsContact O-CD2 3.31Å; L39-F43 WeakPolarHBondContact O-CD2 3.3Å; L39-F43 PolarHBondContact O-N 2.93Å
40	W	77.6	Confident	75.1	Confident	159 Å²	159	106.1 Å²	106.1	60%	0.602	53%	0.534	S	S	*	.	H	α-helix	trans	-66.7	-39	-180	-163	-100.5	0	0	0	112.9	W36 K37 K38 G44	W36-W40 VanDerWaalsContact O-CB 3.26Å; W36-W40 WeakPolarHBondContact O-CB 3.39Å; W36-W40 PolarHBondContact O-N 3.39Å; K37-W40 PolarHBondContact O-N 3.4Å; K38-W40 VanDerWaalsContact C-N 3.34Å; K38-W40 PolarHBondContact O-N 3.45Å; W40-G44 WeakPolarHBondContact O-CA 3.32Å; W40-G44 PolarHBondContact O-N 3.25Å
41	D	81	Confident	75.8	Confident	92 Å²	92	101.6 Å²	101.6	49%	0.492	52%	0.517	S	S	.	.	H	α-helix	trans	-64.5	-40.4	174.3	-81.8	-10.2	0	0	0	111.4	K37 K38 N45	K37-D41 WeakPolarHBondContact O-CB 3.46Å; K37-D41 PolarHBondContact O-N 2.94Å; K38-D41 PolarHBondContact O-N 2.82Å; D41-N45 WeakPolarHBondContact O-CB 3.24Å; D41-N45 PolarHBondContact O-N 3.37Å; D41-N45 PolarHBondContact O-ND2 3.48Å; D41-N45 VanDerWaalsContact O-ND2 3.11Å
42	E	81.7	Confident	76.2	Confident	106 Å²	106	100.1 Å²	100.1	50%	0.495	51%	0.505	S	S	.	.	H	α-helix	trans	-66.9	-48.2	175.1	-76.4	-175.1	-163.4	0	0	111.9	K38 L39 G44 N45 I46	K38-E42 PolarHBondContact O-N 2.86Å; L39-E42 PolarHBondContact O-N 3.47Å; E42-G44 VanDerWaalsContact C-N 3.34Å; E42-G44 PolarHBondContact O-N 3.29Å; E42-N45 PolarHBondContact O-N 3.48Å; E42-I46 VanDerWaalsContact O-CG1 3.31Å; E42-I46 WeakPolarHBondContact O-CG1 3.29Å; E42-I46 PolarHBondContact O-N 2.86Å
43	F	81.4	Confident	76.6	Confident	116 Å²	116	97.2 Å²	97.2	51%	0.509	50%	0.5	S	S	.	.	H	α-helix	trans	-61.8	-42.5	176.3	-92.8	-87.2	0	0	0	111.8	L39 I46 L47	L39-F43 HydrophobicContact CD1-CD2 4.22Å; L39-F43 HydrophobicContact CD1-CE2 3.93Å; L39-F43 HydrophobicContact CD2-CE2 4.34Å; L39-F43 HydrophobicContact CG-CD2 3.85Å; L39-F43 HydrophobicContact CG-CE2 3.87Å; L39-F43 WeakPolarHBondContact O-CB 3.28Å; L39-F43 VanDerWaalsContact O-CD2 3.31Å; L39-F43 WeakPolarHBondContact O-CD2 3.3Å; L39-F43 PolarHBondContact O-N 2.93Å; F43-I46 PolarHBondContact O-N 3.28Å; F43-L47 WeakPolarHBondContact O-CB 3.39Å; F43-L47 PolarHBondContact O-N 3.43Å
44	G	81.9	Confident	76.9	Confident	33 Å²	33	98.3 Å²	98.3	34%	0.34	50%	0.498	S	S	.	.	H	α-helix	trans	-60.8	-43.9	176.7	0	0	0	0	0	112.1	W40 E42 L47 W48	W40-G44 WeakPolarHBondContact O-CA 3.32Å; W40-G44 PolarHBondContact O-N 3.25Å; E42-G44 VanDerWaalsContact C-N 3.34Å; E42-G44 PolarHBondContact O-N 3.29Å; G44-L47 PolarHBondContact O-N 2.85Å; G44-W48 WeakPolarHBondContact O-CB 3.42Å; G44-W48 PolarHBondContact O-N 3.47Å
45	N	81.4	Confident	76.7	Confident	114 Å²	114	99.2 Å²	99.2	61%	0.61	50%	0.497	S	S	*	.	H	α-helix	trans	-63.9	-41.4	175.4	-81.8	-36.3	0	0	0	112.5	D41 E42 W48 A49	D41-N45 WeakPolarHBondContact O-CB 3.24Å; D41-N45 PolarHBondContact O-N 3.37Å; D41-N45 PolarHBondContact O-ND2 3.48Å; D41-N45 VanDerWaalsContact O-ND2 3.11Å; E42-N45 PolarHBondContact O-N 3.48Å; N45-W48 PolarHBondContact O-N 2.84Å; N45-A49 VanDerWaalsContact O-CB 3.3Å; N45-A49 WeakPolarHBondContact O-CB 3.33Å; N45-A49 PolarHBondContact O-N 3.05Å
46	I	80.8	Confident	76.2	Confident	100 Å²	100	103 Å²	103	51%	0.513	50%	0.504	S	S	.	.	H	α-helix	trans	-65.9	-47.5	177.1	-66.7	165.9	0	0	0	110.6	E42 F43 W48 A49 I50	E42-I46 VanDerWaalsContact O-CG1 3.31Å; E42-I46 WeakPolarHBondContact O-CG1 3.29Å; E42-I46 PolarHBondContact O-N 2.86Å; F43-I46 PolarHBondContact O-N 3.28Å; I46-W48 VanDerWaalsContact C-N 3.33Å; I46-W48 PolarHBondContact O-N 3.28Å; I46-A49 PolarHBondContact O-N 3.5Å; I46-I50 HydrophobicContact CG2-CD1 3.86Å; I46-I50 VanDerWaalsContact O-CG1 3.32Å; I46-I50 WeakPolarHBondContact O-CG1 3.34Å; I46-I50 PolarHBondContact O-N 2.97Å
47	L	80.2	Confident	75.7	Confident	109 Å²	109	105 Å²	105	57%	0.571	52%	0.52	S	S	*	.	H	α-helix	trans	-59.5	-45.6	176.9	-107.5	135.6	0	0	0	111	F43 G44 A49 I50 V51	F43-L47 WeakPolarHBondContact O-CB 3.39Å; F43-L47 PolarHBondContact O-N 3.43Å; G44-L47 PolarHBondContact O-N 2.85Å; L47-A49 VanDerWaalsContact C-N 3.35Å; L47-A49 PolarHBondContact O-N 3.29Å; L47-I50 PolarHBondContact O-N 2.97Å; L47-V51 WeakPolarHBondContact O-CB 3.38Å; L47-V51 VanDerWaalsContact O-CG2 3.24Å; L47-V51 WeakPolarHBondContact O-CG2 3.38Å; L47-V51 PolarHBondContact O-N 2.82Å
48	W	79	Confident	75	Confident	163 Å²	163	107.1 Å²	107.1	62%	0.617	52%	0.524	S	S	*	.	H	α-helix	trans	-63	-41.1	177.6	-168.2	-114.9	0	0	0	111.9	G44 N45 I46 V51 L52	G44-W48 WeakPolarHBondContact O-CB 3.42Å; G44-W48 PolarHBondContact O-N 3.47Å; N45-W48 PolarHBondContact O-N 2.84Å; I46-W48 VanDerWaalsContact C-N 3.33Å; I46-W48 PolarHBondContact O-N 3.28Å; W48-V51 PolarHBondContact O-N 3.32Å; W48-L52 HydrophobicContact CD2-CD1 4.5Å; W48-L52 HydrophobicContact CD2-CG 4.38Å; W48-L52 HydrophobicContact CG-CD1 4.27Å; W48-L52 HydrophobicContact CG-CG 4.46Å; W48-L52 HydrophobicContact CZ2-CD2 4.26Å; W48-L52 HydrophobicContact CZ2-CG 4.45Å; W48-L52 VanDerWaalsContact NE1-CD1 3.26Å; W48-L52 VanDerWaalsContact O-CB 3.29Å; W48-L52 WeakPolarHBondContact O-CB 3.33Å; W48-L52 WeakPolarHBondContact O-CG 3.4Å; W48-L52 PolarHBondContact O-N 2.85Å
49	A	79.6	Confident	74.1	Confident	61 Å²	61	107.1 Å²	107.1	50%	0.504	53%	0.525	S	S	.	.	H	α-helix	trans	-63.4	-41.3	175.5	0	0	0	0	0	112.4	N45 I46 L47 G53	N45-A49 VanDerWaalsContact O-CB 3.3Å; N45-A49 WeakPolarHBondContact O-CB 3.33Å; N45-A49 PolarHBondContact O-N 3.05Å; I46-A49 PolarHBondContact O-N 3.5Å; L47-A49 VanDerWaalsContact C-N 3.35Å; L47-A49 PolarHBondContact O-N 3.29Å; A49-G53 PolarHBondContact O-N 3.28Å
50	I	80.5	Confident	73	Confident	101 Å²	101	109.8 Å²	109.8	52%	0.518	53%	0.534	S	S	.	.	H	α-helix	trans	-66.4	-45.8	176	-66.9	167.1	0	0	0	110.4	I46 L47 G53 Q54	I46-I50 HydrophobicContact CG2-CD1 3.86Å; I46-I50 VanDerWaalsContact O-CG1 3.32Å; I46-I50 WeakPolarHBondContact O-CG1 3.34Å; I46-I50 PolarHBondContact O-N 2.97Å; L47-I50 PolarHBondContact O-N 2.97Å; I50-G53 PolarHBondContact O-N 2.94Å; I50-Q54 HydrophobicContact CG2-CG 4.3Å; I50-Q54 WeakPolarHBondContact O-CB 3.27Å; I50-Q54 WeakPolarHBondContact O-CG 3.44Å; I50-Q54 PolarHBondContact O-N 3.36Å
51	V	77.4	Confident	72	Confident	67 Å²	67	109.6 Å²	109.6	41%	0.406	54%	0.537	S	S	.	.	H	α-helix	trans	-63.4	-46.9	179.4	170.9	0	0	0	0	110.7	L47 W48 G53 Q54 L55	L47-V51 WeakPolarHBondContact O-CB 3.38Å; L47-V51 VanDerWaalsContact O-CG2 3.24Å; L47-V51 WeakPolarHBondContact O-CG2 3.38Å; L47-V51 PolarHBondContact O-N 2.82Å; W48-V51 PolarHBondContact O-N 3.32Å; V51-G53 VanDerWaalsContact C-N 3.34Å; V51-G53 PolarHBondContact O-N 3.46Å; V51-Q54 PolarHBondContact O-N 2.9Å; V51-L55 WeakPolarHBondContact O-CB 3.19Å; V51-L55 PolarHBondContact O-N 3.46Å
52	L	74.2	Confident	70.8	Confident	81 Å²	81	112.4 Å²	112.4	42%	0.424	55%	0.545	S	S	.	.	H	α-helix	trans	-62.8	-39.3	174.8	-75.2	179.2	0	0	0	112.1	W48 L55 R56	W48-L52 HydrophobicContact CD2-CD1 4.5Å; W48-L52 HydrophobicContact CD2-CG 4.38Å; W48-L52 HydrophobicContact CG-CD1 4.27Å; W48-L52 HydrophobicContact CG-CG 4.46Å; W48-L52 HydrophobicContact CZ2-CD2 4.26Å; W48-L52 HydrophobicContact CZ2-CG 4.45Å; W48-L52 VanDerWaalsContact NE1-CD1 3.26Å; W48-L52 VanDerWaalsContact O-CB 3.29Å; W48-L52 WeakPolarHBondContact O-CB 3.33Å; W48-L52 WeakPolarHBondContact O-CG 3.4Å; W48-L52 PolarHBondContact O-N 2.85Å; L52-L55 PolarHBondContact O-N 2.97Å; L52-R56 VanDerWaalsContact O-CB 3.27Å; L52-R56 WeakPolarHBondContact O-CB 3.42Å; L52-R56 PolarHBondContact O-N 3.37Å
53	G	73	Confident	69.4	Low	30 Å²	30	111.3 Å²	111.3	31%	0.309	55%	0.546	S	S	.	.	H	α-helix	trans	-62.3	-44.8	174.7	0	0	0	0	0	112.5	A49 I50 V51 R56 N57	A49-G53 PolarHBondContact O-N 3.28Å; I50-G53 PolarHBondContact O-N 2.94Å; V51-G53 VanDerWaalsContact C-N 3.34Å; V51-G53 PolarHBondContact O-N 3.46Å; G53-R56 PolarHBondContact O-N 2.82Å; G53-N57 WeakPolarHBondContact O-CB 3.4Å; G53-N57 VanDerWaalsContact O-CG 3.27Å; G53-N57 PolarHBondContact O-N 3.41Å; G53-N57 PolarHBondContact O-ND2 3.12Å
54	Q	70.6	Confident	68.1	Low	116 Å²	116	112.3 Å²	112.3	54%	0.542	55%	0.552	S	S	.	*	H	α-helix	trans	-62.7	-44.2	174	-72.3	-89.8	-20.9	0	0	111.3	I50 V51 N57 R58	I50-Q54 HydrophobicContact CG2-CG 4.3Å; I50-Q54 WeakPolarHBondContact O-CB 3.27Å; I50-Q54 WeakPolarHBondContact O-CG 3.44Å; I50-Q54 PolarHBondContact O-N 3.36Å; V51-Q54 PolarHBondContact O-N 2.9Å; Q54-N57 PolarHBondContact O-N 3.3Å; Q54-R58 WeakPolarHBondContact O-CG 3.35Å; Q54-R58 PolarHBondContact O-N 2.93Å
55	L	65.9	Low	66.9	Low	115 Å²	115	115.4 Å²	115.4	60%	0.602	56%	0.564	S	S	*	*	H	α-helix	trans	-62.7	-45.3	178.3	-141.6	84.7	0	0	0	111	V51 L52 N57 R58 H59	V51-L55 WeakPolarHBondContact O-CB 3.19Å; V51-L55 PolarHBondContact O-N 3.46Å; L52-L55 PolarHBondContact O-N 2.97Å; L55-N57 VanDerWaalsContact C-N 3.34Å; L55-N57 PolarHBondContact O-N 3.3Å; L55-R58 PolarHBondContact O-N 3.16Å; L55-H59 PolarHBondContact O-N 3.49Å
56	R	58	Low	65.8	Low	181 Å²	181	114.4 Å²	114.4	68%	0.683	56%	0.562	S	S	*	*	H	α-helix	trans	-62.6	-40	176.4	-170.2	178.6	-175.8	-165.8	1.9	111.7	L52 G53 H59 K60	L52-R56 VanDerWaalsContact O-CB 3.27Å; L52-R56 WeakPolarHBondContact O-CB 3.42Å; L52-R56 PolarHBondContact O-N 3.37Å; G53-R56 PolarHBondContact O-N 2.82Å; R56-H59 PolarHBondContact O-N 3.02Å; R56-K60 PolarHBondContact O-N 3.02Å
57	N	59.2	Low	64.6	Low	104 Å²	104	115.9 Å²	115.9	56%	0.556	57%	0.567	S	S	*	*	H	α-helix	trans	-68.1	-37.3	176.4	-77.6	-17.3	0	0	0	112.6	G53 Q54 L55 H59 K61	G53-N57 WeakPolarHBondContact O-CB 3.4Å; G53-N57 VanDerWaalsContact O-CG 3.27Å; G53-N57 PolarHBondContact O-N 3.41Å; G53-N57 PolarHBondContact O-ND2 3.12Å; Q54-N57 PolarHBondContact O-N 3.3Å; L55-N57 VanDerWaalsContact C-N 3.34Å; L55-N57 PolarHBondContact O-N 3.3Å; N57-H59 VanDerWaalsContact C-N 3.33Å; N57-K61 PolarHBondContact O-N 3.43Å; N57-K61 VanDerWaalsContact O-N 3.12Å
58	R	58.4	Low	63.4	Low	190 Å²	190	115.7 Å²	115.7	72%	0.717	57%	0.566	S	S	*	*	H	α-helix	trans	-66.9	-35.8	172.1	-68.9	-141.7	-168.6	-148.3	6.4	112	Q54 L55 K62	Q54-R58 WeakPolarHBondContact O-CG 3.35Å; Q54-R58 PolarHBondContact O-N 2.93Å; L55-R58 PolarHBondContact O-N 3.16Å; R58-K62 PolarHBondContact O-N 2.86Å; R58-K62 VanDerWaalsContact O-N 3.14Å
59	H	56.6	Low	62.4	Low	135 Å²	135	114.8 Å²	114.8	63%	0.625	57%	0.567	S	S	*	*	H	α-helix	trans	-66.9	-45.5	176.6	-131.5	-87.8	0	0	0	111.7	L55 R56 N57 K61 K62 T63	L55-H59 PolarHBondContact O-N 3.49Å; R56-H59 PolarHBondContact O-N 3.02Å; N57-H59 VanDerWaalsContact C-N 3.33Å; H59-K61 PolarHBondContact O-N 3.19Å; H59-K62 PolarHBondContact O-N 2.97Å; H59-T63 PolarHBondContact O-N 3.14Å; H59-T63 PolarHBondContact O-OG1 3.49Å
60	K	54.7	Low	61.3	Low	133 Å²	133	117.1 Å²	117.1	58%	0.578	57%	0.571	S	S	*	*	H	α-helix	trans	-59.3	-42.5	175.4	-91.9	-168.9	173.5	-172.7	0	113.1	R56 K62 T63 Q64	R56-K60 PolarHBondContact O-N 3.02Å; K60-K62 VanDerWaalsContact C-N 3.34Å; K60-K62 PolarHBondContact O-N 3.48Å; K60-T63 PolarHBondContact O-N 3.04Å; K60-T63 PolarHBondContact O-OG1 2.87Å; K60-Q64 PolarHBondContact O-N 3.43Å
61	K	56.2	Low	60.2	Low	155 Å²	155	116.9 Å²	116.9	67%	0.674	57%	0.57	S	S	*	*	H	α-helix	trans	-60.7	-44.1	175.6	-89.4	-172.7	173.8	-176.7	0	111.3	N57 H59 T63 Q64 T65	N57-K61 PolarHBondContact O-N 3.43Å; N57-K61 VanDerWaalsContact O-N 3.12Å; H59-K61 PolarHBondContact O-N 3.19Å; K61-T63 PolarHBondContact O-N 3.03Å; K61-Q64 PolarHBondContact O-N 3.38Å; K61-T65 PolarHBondContact O-N 3.35Å; K61-T65 PolarHBondContact O-OG1 3.47Å
62	K	55.8	Low	59.3	Low	150 Å²	150	117.4 Å²	117.4	65%	0.652	57%	0.573	S	S	*	*	H	α-helix	trans	-61.3	-43.3	176.6	-82	-173.7	173.3	-174.8	0	112.6	R58 H59 K60 Q64 T65 V66	R58-K62 PolarHBondContact O-N 2.86Å; R58-K62 VanDerWaalsContact O-N 3.14Å; H59-K62 PolarHBondContact O-N 2.97Å; K60-K62 VanDerWaalsContact C-N 3.34Å; K60-K62 PolarHBondContact O-N 3.48Å; K62-Q64 PolarHBondContact O-N 3.33Å; K62-T65 PolarHBondContact O-N 3.5Å; K62-V66 VanDerWaalsContact O-CG2 3.31Å; K62-V66 WeakPolarHBondContact O-CG2 3.31Å; K62-V66 PolarHBondContact O-N 2.97Å
63	T	53.2	Low	58.5	Low	83 Å²	83	117 Å²	117	51%	0.509	57%	0.571	S	S	.	*	H	α-helix	trans	-65.9	-37.9	177.8	6.1	0	0	0	0	112.6	H59 K60 K61 V66 Q67	H59-T63 PolarHBondContact O-N 3.14Å; H59-T63 PolarHBondContact O-OG1 3.49Å; K60-T63 PolarHBondContact O-N 3.04Å; K60-T63 PolarHBondContact O-OG1 2.87Å; K61-T63 PolarHBondContact O-N 3.03Å; T63-V66 PolarHBondContact O-N 3.06Å; T63-Q67 PolarHBondContact O-N 3.03Å
64	Q	54.5	Low	57.7	Low	137 Å²	137	123.5 Å²	123.5	64%	0.64	59%	0.591	S	S	*	*	H	α-helix	trans	-65.5	-40	174.1	-101	178.9	-20.4	0	0	112.4	K60 K61 K62 V66 Q67 N68	K60-Q64 PolarHBondContact O-N 3.43Å; K61-Q64 PolarHBondContact O-N 3.38Å; K62-Q64 PolarHBondContact O-N 3.33Å; Q64-V66 VanDerWaalsContact C-N 3.35Å; Q64-Q67 PolarHBondContact O-N 3.44Å; Q64-N68 WeakPolarHBondContact O-CB 3.32Å; Q64-N68 PolarHBondContact O-N 3.33Å
65	T	56.4	Low	57	Low	98 Å²	98	125 Å²	125	60%	0.601	60%	0.597	S	S	*	*	H	α-helix	trans	-66.4	-37.7	177	-45	0	0	0	0	111.8	K61 K62 K69	K61-T65 PolarHBondContact O-N 3.35Å; K61-T65 PolarHBondContact O-OG1 3.47Å; K62-T65 PolarHBondContact O-N 3.5Å; T65-K69 WeakPolarHBondContact O-CB 3.39Å; T65-K69 PolarHBondContact O-N 2.92Å
66	V	58.5	Low	56.7	Low	93 Å²	93	124.2 Å²	124.2	56%	0.564	60%	0.598	S	S	*	*	H	α-helix	trans	-69.7	-41.7	176.8	175	0	0	0	0	111.5	K62 T63 Q64 K69 N70	K62-V66 VanDerWaalsContact O-CG2 3.31Å; K62-V66 WeakPolarHBondContact O-CG2 3.31Å; K62-V66 PolarHBondContact O-N 2.97Å; T63-V66 PolarHBondContact O-N 3.06Å; Q64-V66 VanDerWaalsContact C-N 3.35Å; V66-K69 PolarHBondContact O-N 3.49Å; V66-N70 PolarHBondContact O-N 3.05Å
67	Q	55.7	Low	56.6	Low	132 Å²	132	121.8 Å²	121.8	62%	0.617	60%	0.598	S	S	*	*	H	α-helix	trans	-65.2	-42.8	174.8	-82.8	-164.4	-23.7	0	0	112.3	T63 Q64 K69 N70 I71	T63-Q67 PolarHBondContact O-N 3.03Å; Q64-Q67 PolarHBondContact O-N 3.44Å; Q67-K69 VanDerWaalsContact C-N 3.32Å; Q67-K69 PolarHBondContact O-N 2.96Å; Q67-N70 PolarHBondContact O-N 3.33Å; Q67-I71 VanDerWaalsContact O-CG1 3.26Å; Q67-I71 WeakPolarHBondContact O-CG1 3.42Å; Q67-I71 PolarHBondContact O-N 3.06Å
68	N	55.2	Low	56.3	Low	104 Å²	104	120.6 Å²	120.6	56%	0.556	60%	0.598	S	S	*	*	H	α-helix	trans	-65.7	-37.4	-179.7	-156	18.3	0	0	0	111.5	Q64 I71 V72	Q64-N68 WeakPolarHBondContact O-CB 3.32Å; Q64-N68 PolarHBondContact O-N 3.33Å; N68-I71 PolarHBondContact O-N 3.33Å; N68-V72 WeakPolarHBondContact O-CG2 3.47Å; N68-V72 PolarHBondContact O-N 3.28Å
69	K	57.4	Low	56.1	Low	144 Å²	144	116.8 Å²	116.8	63%	0.626	60%	0.598	S	S	*	*	H	α-helix	trans	-65	-43.2	174.6	-161.1	176.4	-177.4	-176.2	0	112.1	T65 V66 Q67 I71 V72 D73	T65-K69 WeakPolarHBondContact O-CB 3.39Å; T65-K69 PolarHBondContact O-N 2.92Å; V66-K69 PolarHBondContact O-N 3.49Å; Q67-K69 VanDerWaalsContact C-N 3.32Å; Q67-K69 PolarHBondContact O-N 2.96Å; K69-I71 VanDerWaalsContact C-N 3.3Å; K69-I71 PolarHBondContact O-N 3.35Å; K69-V72 PolarHBondContact O-N 3.37Å; K69-D73 WeakPolarHBondContact O-CB 3.26Å; K69-D73 PolarHBondContact O-N 3.44Å
70	N	57.1	Low	56.2	Low	111 Å²	111	116.3 Å²	116.3	59%	0.594	61%	0.609	S	S	*	*	H	α-helix	trans	-65.2	-28.7	175.5	-95.4	8.2	0	0	0	113.7	V66 Q67 K74	V66-N70 PolarHBondContact O-N 3.05Å; Q67-N70 PolarHBondContact O-N 3.33Å; N70-K74 WeakPolarHBondContact O-CB 3.34Å; N70-K74 PolarHBondContact O-N 3Å
71	I	56.9	Low	55.9	Low	95 Å²	95	119 Å²	119	49%	0.487	62%	0.623	S	S	.	*	H	α-helix	trans	-75.8	-42.7	176.4	-66	162.6	0	0	0	110.4	Q67 N68 K69 K74 H75	Q67-I71 VanDerWaalsContact O-CG1 3.26Å; Q67-I71 WeakPolarHBondContact O-CG1 3.42Å; Q67-I71 PolarHBondContact O-N 3.06Å; N68-I71 PolarHBondContact O-N 3.33Å; K69-I71 VanDerWaalsContact C-N 3.3Å; K69-I71 PolarHBondContact O-N 3.35Å; I71-K74 PolarHBondContact O-N 3.08Å; I71-H75 PolarHBondContact O-N 3.31Å; I71-H75 VanDerWaalsContact O-N 3.08Å
72	V	57.6	Low	55.3	Low	78 Å²	78	120.3 Å²	120.3	47%	0.473	65%	0.652	S	S	.	*	H	α-helix	trans	-62.7	-47.8	176.7	173.9	0	0	0	0	110.5	N68 K69 K74 H75 T76	N68-V72 WeakPolarHBondContact O-CG2 3.47Å; N68-V72 PolarHBondContact O-N 3.28Å; K69-V72 PolarHBondContact O-N 3.37Å; V72-K74 PolarHBondContact O-N 3.06Å; V72-H75 PolarHBondContact O-N 3.22Å; V72-T76 PolarHBondContact O-N 2.91Å; V72-T76 PolarHBondContact O-OG1 2.93Å
73	D	57.2	Low	55.3	Low	73 Å²	73	118.9 Å²	118.9	39%	0.39	65%	0.652	S	S	.	*	H	α-helix	trans	-63	-27.7	179.2	-72.7	-25.7	0	0	0	112.7	K69 N77	K69-D73 WeakPolarHBondContact O-CB 3.26Å; K69-D73 PolarHBondContact O-N 3.44Å; D73-N77 PolarHBondContact O-ND2 2.85Å
74	K	56.2	Low	55.4	Low	167 Å²	167	120.7 Å²	120.7	73%	0.726	66%	0.66	S	S	*	*	H	α-helix	trans	-78.5	-30.4	175.4	-137	177.4	-174.9	-174.2	0	112.7	N70 I71 V72	N70-K74 WeakPolarHBondContact O-CB 3.34Å; N70-K74 PolarHBondContact O-N 3Å; I71-K74 PolarHBondContact O-N 3.08Å; V72-K74 PolarHBondContact O-N 3.06Å
75	H	57.4	Low	55.5	Low	146 Å²	146	119.8 Å²	119.8	68%	0.676	66%	0.661	S	S	*	*	H	α-helix	trans	-83.5	-30.7	178.4	-97.9	-78.9	0	0	0	113.4	I71 V72 N77	I71-H75 PolarHBondContact O-N 3.31Å; I71-H75 VanDerWaalsContact O-N 3.08Å; V72-H75 PolarHBondContact O-N 3.22Å; H75-N77 VanDerWaalsContact C-N 3.33Å
76	T	58.1	Low	55.4	Low	100 Å²	100	121.1 Å²	121.1	61%	0.613	66%	0.664	S	S	*	*	H	α-helix	trans	-77.2	-17.9	176.4	39.8	0	0	0	0	113.8	V72	V72-T76 PolarHBondContact O-N 2.91Å; V72-T76 PolarHBondContact O-OG1 2.93Å
77	N	56.3	Low	55.2	Low	129 Å²	129	122.9 Å²	122.9	69%	0.69	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.4	5.5	178.3	-70.4	-40.9	0	0	0	113.7	D73 H75 P79	D73-N77 PolarHBondContact O-ND2 2.85Å; H75-N77 VanDerWaalsContact C-N 3.33Å; N77-P79 VanDerWaalsContact O-CD 3.31Å; N77-P79 WeakPolarHBondContact O-CD 3.31Å
78	S	53.4	Low	55.2	Low	80 Å²	80	122.3 Å²	122.3	56%	0.559	67%	0.674	S	S	*	*	S	Bend	trans	-74.8	116.5	168.8	-70.7	0	0	0	0	108.5	C80	S78-C80 PolarHBondContact O-N 3.35Å
79	P	53.2	Low	55.2	Low	110 Å²	110	123.6 Å²	123.6	71%	0.714	68%	0.683	S	S	*	*			trans	-62.2	132	173.3	26	-30.6	0	0	0	108.3	N77 E81	N77-P79 VanDerWaalsContact O-CD 3.31Å; N77-P79 WeakPolarHBondContact O-CD 3.31Å; P79-E81 VanDerWaalsContact C-N 3.27Å; P79-E81 PolarHBondContact O-N 3.12Å
80	C	59.7	Low	55	Low	125 Å²	125	122 Å²	122	85%	0.845	69%	0.687	S	S	*	*			trans	-63.9	95	162.7	-117.6	0	0	0	0	106.6	S78 S82	S78-C80 PolarHBondContact O-N 3.35Å; C80-S82 PolarHBondContact O-N 2.92Å; C80-S82 VanDerWaalsContact O-N 3.12Å
81	E	47.6	Very low	54.8	Low	188 Å²	188	122.9 Å²	122.9	88%	0.879	70%	0.695	S	S	*	*			trans	-65.4	105.8	158.8	-82.2	-176.9	143.9	0	0	106.6	P79	P79-E81 VanDerWaalsContact C-N 3.27Å; P79-E81 PolarHBondContact O-N 3.12Å
82	S	44.3	Very low	54.6	Low	184 Å²	184	125.5 Å²	125.5	100%	1.287	71%	0.714	S	S	*	*			trans	-92.4	0	161.6	-64.6	0	0	0	0	109.6	C80	C80-S82 PolarHBondContact O-N 2.92Å; C80-S82 VanDerWaalsContact O-N 3.12Å

Retrieved 82 of 82 residues in 18.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).