A0A5K4F805_SCHMA Loading...

4F5 domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4F805, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 64 aa.

						>A0A5K4F805_SCHMA|A0A5K4F805
MTRGNQRDLAREKNLKKQSEQRKSKASSQKDGNKGLTLEERRLRDAEALRAKQQAKSQASVPKA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.2	Low	80.6	Confident	242 Å²	242	120.5 Å²	120.5	100%	1.192	59%	0.589	S	S	*	*				0	-1	0	-65.9	172.6	74.9	0	0	114.8
2	T	63.8	Low	81.5	Confident	101 Å²	101	120.6 Å²	120.6	62%	0.62	59%	0.587	S	S	*	*			trans	-114.7	-1.4	-167.3	72.7	0	0	0	0	115.7	G4 N5 Q6	T2-G4 PolarHBondContact O-N 3.44Å; T2-N5 PolarHBondContact O-N 3.33Å; T2-Q6 PolarHBondContact O-N 3.46Å
3	R	68.1	Low	82.3	Confident	211 Å²	211	122.5 Å²	122.5	80%	0.796	59%	0.591	S	S	*	*	H	α-helix	trans	-69.8	-31.1	-175.2	-108.7	-174.4	-141.2	104.2	2.9	114.2	R7	R3-R7 PolarHBondContact O-N 3.49Å
4	G	76.3	Confident	83.2	Confident	42 Å²	42	120.6 Å²	120.6	43%	0.433	59%	0.585	S	S	.	*	H	α-helix	trans	-64.9	-49.2	174.6	0	0	0	0	0	111.2	T2 Q6 R7 D8	T2-G4 PolarHBondContact O-N 3.44Å; G4-Q6 VanDerWaalsContact C-N 3.3Å; G4-Q6 PolarHBondContact O-N 3.16Å; G4-R7 PolarHBondContact O-N 2.95Å; G4-D8 PolarHBondContact O-N 3.39Å; G4-D8 VanDerWaalsContact O-N 3.07Å
5	N	83.2	Confident	83.8	Confident	98 Å²	98	119.4 Å²	119.4	52%	0.524	58%	0.582	S	S	.	*	H	α-helix	trans	-55.8	-42.9	179.1	-167	34.3	0	0	0	112.5	T2 R7 D8 L9	T2-N5 PolarHBondContact O-N 3.33Å; N5-R7 VanDerWaalsContact C-N 3.35Å; N5-R7 PolarHBondContact O-N 3.28Å; N5-D8 PolarHBondContact O-N 3.06Å; N5-L9 VanDerWaalsContact O-CB 3.31Å; N5-L9 WeakPolarHBondContact O-CB 3.34Å; N5-L9 WeakPolarHBondContact O-CG 3.28Å; N5-L9 PolarHBondContact O-N 3.46Å
6	Q	86.7	Confident	84.5	Confident	124 Å²	124	119.6 Å²	119.6	58%	0.579	58%	0.579	S	S	*	*	H	α-helix	trans	-66.8	-33.5	179.7	-63.1	-63.1	66.4	0	0	113.5	T2 G4 A10	T2-Q6 PolarHBondContact O-N 3.46Å; G4-Q6 VanDerWaalsContact C-N 3.3Å; G4-Q6 PolarHBondContact O-N 3.16Å; Q6-A10 WeakPolarHBondContact O-CB 3.23Å; Q6-A10 PolarHBondContact O-N 2.93Å
7	R	87.7	Confident	85	Confident	181 Å²	181	119.9 Å²	119.9	68%	0.683	58%	0.577	S	S	*	*	H	α-helix	trans	-71.3	-43.3	176.6	-73	-178.8	177.1	169	-1.6	111.5	R3 G4 N5 A10 R11	R3-R7 PolarHBondContact O-N 3.49Å; G4-R7 PolarHBondContact O-N 2.95Å; N5-R7 VanDerWaalsContact C-N 3.35Å; N5-R7 PolarHBondContact O-N 3.28Å; R7-A10 PolarHBondContact O-N 3.4Å; R7-R11 PolarHBondContact O-N 3.03Å
8	D	90.3	Very high	85.4	Confident	82 Å²	82	118.6 Å²	118.6	44%	0.439	57%	0.569	S	S	.	*	H	α-helix	trans	-67.3	-42.7	-179.8	-63.6	-34	0	0	0	110.9	G4 N5 A10 R11 E12	G4-D8 PolarHBondContact O-N 3.39Å; G4-D8 VanDerWaalsContact O-N 3.07Å; N5-D8 PolarHBondContact O-N 3.06Å; D8-A10 VanDerWaalsContact C-N 3.33Å; D8-A10 PolarHBondContact O-N 3.06Å; D8-R11 WeakPolarHBondContact O-CB 3.39Å; D8-R11 PolarHBondContact O-N 3.39Å; D8-R11 VanDerWaalsContact O-N 3.16Å; D8-R11 IonicContact OD1-CZ 3.6Å; D8-R11 IonicContact OD1-NH1 2.69Å; D8-R11 PolarHBondContact OD1-NH1 3.37Å; D8-R11 IonicContact OD1-NH2 3.65Å; D8-E12 WeakPolarHBondContact O-CB 3.31Å; D8-E12 PolarHBondContact O-N 3.02Å
9	L	89.2	Confident	85.6	Confident	57 Å²	57	113.9 Å²	113.9	30%	0.298	55%	0.551	S	S	.	*	H	α-helix	trans	-59.8	-40.2	171.9	-72.3	172.5	0	0	0	112.4	N5 E12 K13	N5-L9 VanDerWaalsContact O-CB 3.31Å; N5-L9 WeakPolarHBondContact O-CB 3.34Å; N5-L9 WeakPolarHBondContact O-CG 3.28Å; N5-L9 PolarHBondContact O-N 3.46Å; L9-E12 PolarHBondContact O-N 2.91Å; L9-K13 WeakPolarHBondContact O-CB 3.44Å; L9-K13 VanDerWaalsContact O-CG 3.23Å; L9-K13 WeakPolarHBondContact O-CG 3.36Å; L9-K13 PolarHBondContact O-N 3.35Å
10	A	89.4	Confident	85.8	Confident	46 Å²	46	113.1 Å²	113.1	38%	0.38	55%	0.546	S	S	.	.	H	α-helix	trans	-65.6	-40.5	175.9	0	0	0	0	0	111.8	Q6 R7 D8 K13 N14	Q6-A10 WeakPolarHBondContact O-CB 3.23Å; Q6-A10 PolarHBondContact O-N 2.93Å; R7-A10 PolarHBondContact O-N 3.4Å; D8-A10 VanDerWaalsContact C-N 3.33Å; D8-A10 PolarHBondContact O-N 3.06Å; A10-K13 PolarHBondContact O-N 3.25Å; A10-N14 WeakPolarHBondContact O-CB 3.36Å; A10-N14 VanDerWaalsContact O-CG 3.23Å; A10-N14 PolarHBondContact O-N 3.07Å; A10-N14 PolarHBondContact O-ND2 3.43Å
11	R	91.9	Very high	85.9	Confident	142 Å²	142	112.7 Å²	112.7	54%	0.536	54%	0.543	S	S	.	.	H	α-helix	trans	-64.2	-46.5	175.6	-166.7	-173.6	-57.9	106.8	1.6	111	R7 D8 N14 L15	R7-R11 PolarHBondContact O-N 3.03Å; D8-R11 WeakPolarHBondContact O-CB 3.39Å; D8-R11 PolarHBondContact O-N 3.39Å; D8-R11 VanDerWaalsContact O-N 3.16Å; D8-R11 IonicContact OD1-CZ 3.6Å; D8-R11 IonicContact OD1-NH1 2.69Å; D8-R11 PolarHBondContact OD1-NH1 3.37Å; D8-R11 IonicContact OD1-NH2 3.65Å; R11-N14 PolarHBondContact O-N 3.48Å; R11-L15 HydrophobicContact CG-CD1 4.12Å; R11-L15 WeakPolarHBondContact O-CB 3.34Å; R11-L15 VanDerWaalsContact O-CG 3.3Å; R11-L15 WeakPolarHBondContact O-CG 3.19Å; R11-L15 PolarHBondContact O-N 2.78Å
12	E	91	Very high	87.2	Confident	121 Å²	121	108 Å²	108	57%	0.565	51%	0.512	S	S	*	.	H	α-helix	trans	-60.1	-46.7	177.3	-168.4	-170.6	165	0	0	111.2	D8 L9 N14 L15 K16	D8-E12 WeakPolarHBondContact O-CB 3.31Å; D8-E12 PolarHBondContact O-N 3.02Å; L9-E12 PolarHBondContact O-N 2.91Å; E12-N14 VanDerWaalsContact C-N 3.35Å; E12-N14 PolarHBondContact O-N 2.84Å; E12-L15 PolarHBondContact O-N 2.88Å; E12-K16 VanDerWaalsContact O-CB 3.25Å; E12-K16 WeakPolarHBondContact O-CB 3.28Å; E12-K16 PolarHBondContact O-N 2.88Å
13	K	92.8	Very high	88.3	Confident	146 Å²	146	110.7 Å²	110.7	64%	0.635	52%	0.515	S	S	*	.	H	α-helix	trans	-59.4	-43.3	175.2	-76.2	174.2	-179.1	-178.5	0	112.3	L9 A10 K16 K17	L9-K13 WeakPolarHBondContact O-CB 3.44Å; L9-K13 VanDerWaalsContact O-CG 3.23Å; L9-K13 WeakPolarHBondContact O-CG 3.36Å; L9-K13 PolarHBondContact O-N 3.35Å; A10-K13 PolarHBondContact O-N 3.25Å; K13-K16 PolarHBondContact O-N 3.42Å; K13-K17 VanDerWaalsContact O-CB 3.28Å; K13-K17 WeakPolarHBondContact O-CB 3.25Å; K13-K17 PolarHBondContact O-N 3.26Å
14	N	94.1	Very high	89.2	Confident	96 Å²	96	105.1 Å²	105.1	51%	0.513	51%	0.509	S	S	.	.	H	α-helix	trans	-66.5	-41.1	178.2	-74.7	-17.9	0	0	0	112.1	A10 R11 E12 Q18	A10-N14 WeakPolarHBondContact O-CB 3.36Å; A10-N14 VanDerWaalsContact O-CG 3.23Å; A10-N14 PolarHBondContact O-N 3.07Å; A10-N14 PolarHBondContact O-ND2 3.43Å; R11-N14 PolarHBondContact O-N 3.48Å; E12-N14 VanDerWaalsContact C-N 3.35Å; E12-N14 PolarHBondContact O-N 2.84Å; N14-Q18 WeakPolarHBondContact O-CG 3.3Å; N14-Q18 PolarHBondContact O-N 3.4Å
15	L	93.2	Very high	89.7	Confident	102 Å²	102	107.2 Å²	107.2	53%	0.534	51%	0.506	S	S	.	.	H	α-helix	trans	-65.4	-43.8	174.9	-72.5	170.6	0	0	0	111.3	R11 E12 Q18 S19	R11-L15 HydrophobicContact CG-CD1 4.12Å; R11-L15 WeakPolarHBondContact O-CB 3.34Å; R11-L15 VanDerWaalsContact O-CG 3.3Å; R11-L15 WeakPolarHBondContact O-CG 3.19Å; R11-L15 PolarHBondContact O-N 2.78Å; E12-L15 PolarHBondContact O-N 2.88Å; L15-Q18 PolarHBondContact O-N 2.93Å; L15-S19 WeakPolarHBondContact O-CB 3.43Å; L15-S19 PolarHBondContact O-N 3.29Å
16	K	93.7	Very high	89.7	Confident	122 Å²	122	105 Å²	105	53%	0.53	50%	0.502	S	S	.	.	H	α-helix	trans	-60.5	-49.5	176.1	-173.6	177.1	179.5	178.2	0	110.6	E12 K13 Q18 S19 E20	E12-K16 VanDerWaalsContact O-CB 3.25Å; E12-K16 WeakPolarHBondContact O-CB 3.28Å; E12-K16 PolarHBondContact O-N 2.88Å; K13-K16 PolarHBondContact O-N 3.42Å; K16-Q18 PolarHBondContact O-N 3.4Å; K16-S19 CarbonylContact O-C 3.58Å; K16-S19 WeakPolarHBondContact O-CA 3.45Å; K16-S19 WeakPolarHBondContact O-CB 3.5Å; K16-S19 PolarHBondContact O-N 2.63Å; K16-S19 PolarHBondContact O-OG 3.4Å; K16-E20 WeakPolarHBondContact CE-OE1 3.43Å; K16-E20 HydrophobicContact CG-CG 4.44Å; K16-E20 WeakPolarHBondContact O-CG 3.47Å; K16-E20 PolarHBondContact O-N 3.16Å
17	K	94.4	Very high	89.5	Confident	125 Å²	125	102.3 Å²	102.3	54%	0.543	50%	0.496	S	S	.	.	H	α-helix	trans	-57.7	-45.1	177.2	-174.3	178.5	-178	179.9	0	112	K13 S19 E20 Q21	K13-K17 VanDerWaalsContact O-CB 3.28Å; K13-K17 WeakPolarHBondContact O-CB 3.25Å; K13-K17 PolarHBondContact O-N 3.26Å; K17-S19 VanDerWaalsContact C-N 3.33Å; K17-S19 PolarHBondContact O-N 2.91Å; K17-E20 PolarHBondContact O-N 3.5Å; K17-Q21 WeakPolarHBondContact O-CB 3.38Å; K17-Q21 VanDerWaalsContact O-CG 3.28Å; K17-Q21 WeakPolarHBondContact O-CG 3.09Å; K17-Q21 PolarHBondContact O-N 2.83Å
18	Q	91.1	Very high	89.1	Confident	96 Å²	96	96.7 Å²	96.7	45%	0.449	49%	0.485	S	S	.	.	H	α-helix	trans	-63.5	-38.9	175	-75.1	-178.8	68.8	0	0	112.1	N14 L15 K16 R22	N14-Q18 WeakPolarHBondContact O-CG 3.3Å; N14-Q18 PolarHBondContact O-N 3.4Å; L15-Q18 PolarHBondContact O-N 2.93Å; K16-Q18 PolarHBondContact O-N 3.4Å; Q18-R22 WeakPolarHBondContact O-CG 3.44Å; Q18-R22 PolarHBondContact O-N 2.69Å
19	S	89.8	Confident	88.8	Confident	31 Å²	31	98.2 Å²	98.2	22%	0.217	49%	0.489	C	S	.	.	H	α-helix	trans	-66	-39.9	176.6	84.3	0	0	0	0	112.2	L15 K16 K17 R22 K23	L15-S19 WeakPolarHBondContact O-CB 3.43Å; L15-S19 PolarHBondContact O-N 3.29Å; K16-S19 CarbonylContact O-C 3.58Å; K16-S19 WeakPolarHBondContact O-CA 3.45Å; K16-S19 WeakPolarHBondContact O-CB 3.5Å; K16-S19 PolarHBondContact O-N 2.63Å; K16-S19 PolarHBondContact O-OG 3.4Å; K17-S19 VanDerWaalsContact C-N 3.33Å; K17-S19 PolarHBondContact O-N 2.91Å; S19-R22 PolarHBondContact O-N 3.27Å; S19-K23 VanDerWaalsContact O-CG 3.3Å; S19-K23 WeakPolarHBondContact O-CG 3.09Å; S19-K23 PolarHBondContact O-N 3.05Å
20	E	89.8	Confident	88.7	Confident	97 Å²	97	100.3 Å²	100.3	45%	0.453	50%	0.496	S	S	.	.	H	α-helix	trans	-67.2	-45.1	177.4	-73	173.4	172.5	0	0	110.6	K16 K17 R22 K23 S24	K16-E20 WeakPolarHBondContact CE-OE1 3.43Å; K16-E20 HydrophobicContact CG-CG 4.44Å; K16-E20 WeakPolarHBondContact O-CG 3.47Å; K16-E20 PolarHBondContact O-N 3.16Å; K17-E20 PolarHBondContact O-N 3.5Å; E20-R22 VanDerWaalsContact C-N 3.28Å; E20-R22 PolarHBondContact O-N 2.81Å; E20-K23 CarbonylContact O-C 3.59Å; E20-K23 PolarHBondContact O-N 3.3Å; E20-S24 WeakPolarHBondContact O-CB 3.49Å; E20-S24 PolarHBondContact O-N 3.44Å; E20-S24 PolarHBondContact O-OG 2.81Å
21	Q	88.6	Confident	88.5	Confident	104 Å²	104	103.6 Å²	103.6	49%	0.486	51%	0.507	S	S	.	.	H	α-helix	trans	-58.2	-39	173.6	-75.1	175.7	-7.5	0	0	112.3	K17 S24 K25	K17-Q21 WeakPolarHBondContact O-CB 3.38Å; K17-Q21 VanDerWaalsContact O-CG 3.28Å; K17-Q21 WeakPolarHBondContact O-CG 3.09Å; K17-Q21 PolarHBondContact O-N 2.83Å; Q21-S24 WeakPolarHBondContact CA-OG 3.44Å; Q21-S24 PolarHBondContact O-OG 3.04Å; Q21-K25 WeakPolarHBondContact O-CG 3.3Å; Q21-K25 PolarHBondContact O-N 3.03Å
22	R	86.5	Confident	88.1	Confident	143 Å²	143	99.8 Å²	99.8	54%	0.54	51%	0.512	S	S	.	.	H	α-helix	trans	-66.7	-37.3	174.5	-72.9	-170.2	-63.8	-105.2	5.7	112.3	Q18 S19 E20	Q18-R22 WeakPolarHBondContact O-CG 3.44Å; Q18-R22 PolarHBondContact O-N 2.69Å; S19-R22 PolarHBondContact O-N 3.27Å; E20-R22 VanDerWaalsContact C-N 3.28Å; E20-R22 PolarHBondContact O-N 2.81Å
23	K	86.2	Confident	87.9	Confident	158 Å²	158	95.5 Å²	95.5	69%	0.687	49%	0.493	S	S	*	.	H	α-helix	trans	-73.2	-35.5	178.5	-71.1	172.1	-177.2	-179	0	112.7	S19 E20 K25	S19-K23 VanDerWaalsContact O-CG 3.3Å; S19-K23 WeakPolarHBondContact O-CG 3.09Å; S19-K23 PolarHBondContact O-N 3.05Å; E20-K23 CarbonylContact O-C 3.59Å; E20-K23 PolarHBondContact O-N 3.3Å; K23-K25 VanDerWaalsContact C-N 3.26Å; K23-K25 PolarHBondContact O-N 3.33Å
24	S	86.8	Confident	87.6	Confident	95 Å²	95	94.3 Å²	94.3	66%	0.664	49%	0.488	S	S	*	.	S	Bend	trans	-78.6	-6.5	-179.5	70	0	0	0	0	113.7	E20 Q21 A26	E20-S24 WeakPolarHBondContact O-CB 3.49Å; E20-S24 PolarHBondContact O-N 3.44Å; E20-S24 PolarHBondContact O-OG 2.81Å; Q21-S24 WeakPolarHBondContact CA-OG 3.44Å; Q21-S24 PolarHBondContact O-OG 3.04Å; S24-A26 PolarHBondContact O-N 3.4Å
25	K	87.3	Confident	87.3	Confident	85 Å²	85	93.7 Å²	93.7	37%	0.37	50%	0.504	S	S	.	.	S	Bend	trans	-56.2	134.9	172.7	-77.9	177.6	-178.7	-175.3	0	110.1	Q21 K23 Q29	Q21-K25 WeakPolarHBondContact O-CG 3.3Å; Q21-K25 PolarHBondContact O-N 3.03Å; K23-K25 VanDerWaalsContact C-N 3.26Å; K23-K25 PolarHBondContact O-N 3.33Å; K25-Q29 HydrophobicContact CB-CB 4.12Å; K25-Q29 HydrophobicContact CG-CB 4.48Å
26	A	83.6	Confident	87.2	Confident	53 Å²	53	91.6 Å²	91.6	44%	0.438	49%	0.493	S	S	.	.			trans	-53.3	151.6	174.2	0	0	0	0	0	110.6	S24 S28 Q29 K30	S24-A26 PolarHBondContact O-N 3.4Å; A26-S28 PolarHBondContact O-N 3.04Å; A26-Q29 WeakPolarHBondContact O-CA 3.43Å; A26-Q29 PolarHBondContact O-N 3.18Å; A26-K30 PolarHBondContact O-N 3.33Å
27	S	81.5	Confident	87.1	Confident	66 Å²	66	89.2 Å²	89.2	46%	0.462	49%	0.489	S	S	.	.	G	3₁₀ helix	trans	-53.8	-32.3	-178.2	-178.4	0	0	0	0	112.9	Q29 N33 R41	S27-Q29 VanDerWaalsContact C-N 3.33Å; S27-N33 WeakPolarHBondContact O-CB 3.47Å; S27-N33 PolarHBondContact O-ND2 2.83Å; S27-N33 PolarHBondContact OG-ND2 2.69Å; S27-R41 VanDerWaalsContact C-NH1 3.3Å; S27-R41 PolarHBondContact O-NH1 3.36Å; S27-R41 PolarHBondContact OG-NH1 3.49Å
28	S	80.4	Confident	86.9	Confident	63 Å²	63	87.4 Å²	87.4	44%	0.441	48%	0.484	S	S	.	.	G	3₁₀ helix	trans	-71.6	-21.8	175.4	48	0	0	0	0	114.5	A26 R41	A26-S28 PolarHBondContact O-N 3.04Å; S28-R41 VanDerWaalsContact CA-NH1 3.26Å; S28-R41 VanDerWaalsContact N-NH1 3.12Å
29	Q	83.5	Confident	87.1	Confident	114 Å²	114	87.9 Å²	87.9	53%	0.533	49%	0.487	S	S	.	.	G	3₁₀ helix	trans	-97.1	-6.5	-178.8	-64.2	-171.2	12.7	0	0	113.5	K25 A26 S27	K25-Q29 HydrophobicContact CB-CB 4.12Å; K25-Q29 HydrophobicContact CG-CB 4.48Å; A26-Q29 WeakPolarHBondContact O-CA 3.43Å; A26-Q29 PolarHBondContact O-N 3.18Å; S27-Q29 VanDerWaalsContact C-N 3.33Å
30	K	87.5	Confident	87.2	Confident	102 Å²	102	90.4 Å²	90.4	44%	0.443	50%	0.495	S	S	.	.	S	Bend	trans	-67.2	139.9	172.4	-67.6	-170.8	178	-176.1	0	109.2	A26 G32 N33 K34	A26-K30 PolarHBondContact O-N 3.33Å; K30-G32 VanDerWaalsContact C-N 3.27Å; K30-G32 PolarHBondContact O-N 3.4Å; K30-N33 CarbonylContact O-C 3.59Å; K30-N33 WeakPolarHBondContact O-CA 3.49Å; K30-N33 PolarHBondContact O-N 3.24Å; K30-K34 PolarHBondContact O-N 3.44Å
31	D	84.3	Confident	87.4	Confident	115 Å²	115	87.8 Å²	87.8	62%	0.615	48%	0.481	S	S	*	.	G	3₁₀ helix	trans	-54.1	-41.4	-172.8	-64	-57	0	0	0	113.2	N33 K34	D31-N33 PolarHBondContact O-N 3.43Å; D31-K34 PolarHBondContact O-N 3.48Å; D31-K34 WeakPolarHBondContact OD1-CE 3Å; D31-K34 IonicContact OD1-NZ 2.63Å; D31-K34 PolarHBondContact OD1-NZ 3.01Å
32	G	84.4	Confident	87.6	Confident	61 Å²	61	89.9 Å²	89.9	63%	0.629	48%	0.484	S	S	*	.	G	3₁₀ helix	trans	-70.8	-8.3	177.9	0	0	0	0	0	115.7	K30 L36	K30-G32 VanDerWaalsContact C-N 3.27Å; K30-G32 PolarHBondContact O-N 3.4Å; G32-L36 VanDerWaalsContact O-CD1 3.32Å; G32-L36 WeakPolarHBondContact O-CD1 3.42Å
33	N	87.7	Confident	88.1	Confident	31 Å²	31	88.1 Å²	88.1	17%	0.166	49%	0.485	C	S	.	.	G	3₁₀ helix	trans	-116.9	0	-178.9	-72.5	-0	0	0	0	112.8	S27 K30 D31 G35 L36 R44	S27-N33 WeakPolarHBondContact O-CB 3.47Å; S27-N33 PolarHBondContact O-ND2 2.83Å; S27-N33 PolarHBondContact OG-ND2 2.69Å; K30-N33 CarbonylContact O-C 3.59Å; K30-N33 WeakPolarHBondContact O-CA 3.49Å; K30-N33 PolarHBondContact O-N 3.24Å; D31-N33 PolarHBondContact O-N 3.43Å; N33-G35 PolarHBondContact O-N 2.88Å; N33-L36 PolarHBondContact O-N 3.18Å; N33-R44 PolarHBondContact OD1-NH1 3.26Å
34	K	86.1	Confident	88.4	Confident	122 Å²	122	84.7 Å²	84.7	53%	0.53	47%	0.468	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.3	133	179.8	-75.8	177.7	174.3	173.2	0	110.1	K30 D31 L36	K30-K34 PolarHBondContact O-N 3.44Å; D31-K34 PolarHBondContact O-N 3.48Å; D31-K34 WeakPolarHBondContact OD1-CE 3Å; D31-K34 IonicContact OD1-NZ 2.63Å; D31-K34 PolarHBondContact OD1-NZ 3.01Å; K34-L36 PolarHBondContact O-N 2.89Å
35	G	88.3	Confident	88.7	Confident	83 Å²	83	85.4 Å²	85.4	86%	0.856	47%	0.465	S	S	*	.	T	Hydrogen-bonded Turn	trans	76.3	-3.2	179	0	0	0	0	0	115	N33	N33-G35 PolarHBondContact O-N 2.88Å
36	L	89.5	Confident	89.1	Confident	57 Å²	57	84 Å²	84	30%	0.298	47%	0.468	S	S	.	.			trans	-92.5	134.5	-179.4	-67.1	153.8	0	0	0	111	G32 N33 K34 E40 R41 R44	G32-L36 VanDerWaalsContact O-CD1 3.32Å; G32-L36 WeakPolarHBondContact O-CD1 3.42Å; N33-L36 PolarHBondContact O-N 3.18Å; K34-L36 PolarHBondContact O-N 2.89Å; L36-E40 WeakPolarHBondContact CA-OE2 3.29Å; L36-E40 HydrophobicContact CD2-CB 4.12Å; L36-E40 VanDerWaalsContact CD2-OE2 3.31Å; L36-E40 WeakPolarHBondContact CD2-OE2 3.32Å; L36-R41 HydrophobicContact CB-CG 4.07Å; L36-R44 VanDerWaalsContact CD2-NH2 3.34Å
37	T	92.2	Very high	89.7	Confident	72 Å²	72	87.3 Å²	87.3	44%	0.442	48%	0.475	S	S	.	.			trans	-68.9	167	173.6	68.9	0	0	0	0	110.9	E39 E40 R41	T37-E39 VanDerWaalsContact C-N 3.3Å; T37-E40 PolarHBondContact N-OE2 3.21Å; T37-E40 VanDerWaalsContact OG1-CD 3.29Å; T37-E40 VanDerWaalsContact OG1-CG 3.29Å; T37-E40 WeakPolarHBondContact OG1-CG 3.2Å; T37-E40 PolarHBondContact OG1-N 3.42Å; T37-R41 WeakPolarHBondContact O-CG 3.48Å; T37-R41 PolarHBondContact O-N 2.83Å; T37-R41 PolarHBondContact O-NE 2.97Å
38	L	90.7	Very high	90.4	Very high	87 Å²	87	87.2 Å²	87.2	46%	0.455	48%	0.478	S	S	.	.	H	α-helix	trans	-60.9	-43.5	174.4	-164.7	163.4	0	0	0	110.7	R41 R42	L38-R41 PolarHBondContact O-N 3.25Å; L38-R42 HydrophobicContact CD2-CG 3.9Å; L38-R42 PolarHBondContact O-N 3.39Å
39	E	93.7	Very high	91.2	Very high	106 Å²	106	88.8 Å²	88.8	50%	0.495	48%	0.481	S	S	.	.	H	α-helix	trans	-63.9	-44.7	180	-64.9	-52.6	130.2	0	0	112.4	T37 R41 R42 L43	T37-E39 VanDerWaalsContact C-N 3.3Å; E39-R41 VanDerWaalsContact C-N 3.25Å; E39-R41 PolarHBondContact O-N 3.21Å; E39-R42 WeakPolarHBondContact O-CB 3.36Å; E39-R42 PolarHBondContact O-N 2.84Å; E39-R42 VanDerWaalsContact O-N 3.12Å; E39-R42 IonicContact OE1-CZ 3.88Å; E39-R42 IonicContact OE1-NH1 2.84Å; E39-R42 PolarHBondContact OE1-NH1 3.09Å; E39-L43 WeakPolarHBondContact O-CG 3.24Å; E39-L43 PolarHBondContact O-N 3.04Å
40	E	93.6	Very high	91.7	Very high	84 Å²	84	90.9 Å²	90.9	39%	0.393	48%	0.484	S	S	.	.	H	α-helix	trans	-59.6	-35.9	175.5	-73	161.2	-171.1	0	0	112.8	L36 T37 R44	L36-E40 WeakPolarHBondContact CA-OE2 3.29Å; L36-E40 HydrophobicContact CD2-CB 4.12Å; L36-E40 VanDerWaalsContact CD2-OE2 3.31Å; L36-E40 WeakPolarHBondContact CD2-OE2 3.32Å; T37-E40 PolarHBondContact N-OE2 3.21Å; T37-E40 VanDerWaalsContact OG1-CD 3.29Å; T37-E40 VanDerWaalsContact OG1-CG 3.29Å; T37-E40 WeakPolarHBondContact OG1-CG 3.2Å; T37-E40 PolarHBondContact OG1-N 3.42Å; E40-R44 WeakPolarHBondContact O-CB 3.31Å; E40-R44 PolarHBondContact O-N 3.25Å; E40-R44 VanDerWaalsContact O-N 3.09Å
41	R	92.7	Very high	92.1	Very high	43 Å²	43	88.5 Å²	88.5	16%	0.162	48%	0.484	C	S	.	.	H	α-helix	trans	-67.8	-44	175	-70.9	-177.2	-67	-174.3	-0.5	111.5	S27 S28 L36 T37 L38 E39 L43 R44 D45	S27-R41 VanDerWaalsContact C-NH1 3.3Å; S27-R41 PolarHBondContact O-NH1 3.36Å; S27-R41 PolarHBondContact OG-NH1 3.49Å; S28-R41 VanDerWaalsContact CA-NH1 3.26Å; S28-R41 VanDerWaalsContact N-NH1 3.12Å; L36-R41 HydrophobicContact CB-CG 4.07Å; T37-R41 WeakPolarHBondContact O-CG 3.48Å; T37-R41 PolarHBondContact O-N 2.83Å; T37-R41 PolarHBondContact O-NE 2.97Å; L38-R41 PolarHBondContact O-N 3.25Å; E39-R41 VanDerWaalsContact C-N 3.25Å; E39-R41 PolarHBondContact O-N 3.21Å; R41-L43 VanDerWaalsContact C-N 3.34Å; R41-L43 PolarHBondContact O-N 2.87Å; R41-R44 PolarHBondContact O-N 3.12Å; R41-D45 PolarHBondContact O-N 3.27Å
42	R	94.4	Very high	92.7	Very high	147 Å²	147	90.5 Å²	90.5	56%	0.555	49%	0.487	S	S	*	.	H	α-helix	trans	-61.1	-43.6	176	-75.3	178.6	171.4	160.4	-2.4	111.9	L38 E39 D45 A46	L38-R42 HydrophobicContact CD2-CG 3.9Å; L38-R42 PolarHBondContact O-N 3.39Å; E39-R42 WeakPolarHBondContact O-CB 3.36Å; E39-R42 PolarHBondContact O-N 2.84Å; E39-R42 VanDerWaalsContact O-N 3.12Å; E39-R42 IonicContact OE1-CZ 3.88Å; E39-R42 IonicContact OE1-NH1 2.84Å; E39-R42 PolarHBondContact OE1-NH1 3.09Å; R42-D45 PolarHBondContact O-N 3.02Å; R42-A46 VanDerWaalsContact O-CB 3.24Å; R42-A46 WeakPolarHBondContact O-CB 3.35Å; R42-A46 PolarHBondContact O-N 3.36Å
43	L	95.2	Very high	93.2	Very high	107 Å²	107	92.8 Å²	92.8	56%	0.56	48%	0.481	S	S	*	.	H	α-helix	trans	-60.4	-47.7	177.6	-71.9	172.4	0	0	0	110.9	E39 R41 D45 A46 E47	E39-L43 WeakPolarHBondContact O-CG 3.24Å; E39-L43 PolarHBondContact O-N 3.04Å; R41-L43 VanDerWaalsContact C-N 3.34Å; R41-L43 PolarHBondContact O-N 2.87Å; L43-D45 PolarHBondContact O-N 3.46Å; L43-A46 PolarHBondContact O-N 3Å; L43-E47 WeakPolarHBondContact O-CG 3.49Å; L43-E47 PolarHBondContact O-N 3.45Å
44	R	92.6	Very high	93.5	Very high	85 Å²	85	96.7 Å²	96.7	32%	0.321	50%	0.498	S	S	.	.	H	α-helix	trans	-59.5	-47.1	176.4	-170.4	-167.1	-48.9	124.1	22.3	112.8	N33 L36 E40 R41 A46 E47 A48	N33-R44 PolarHBondContact OD1-NH1 3.26Å; L36-R44 VanDerWaalsContact CD2-NH2 3.34Å; E40-R44 WeakPolarHBondContact O-CB 3.31Å; E40-R44 PolarHBondContact O-N 3.25Å; E40-R44 VanDerWaalsContact O-N 3.09Å; R41-R44 PolarHBondContact O-N 3.12Å; R44-A46 VanDerWaalsContact C-N 3.29Å; R44-A46 PolarHBondContact O-N 2.88Å; R44-E47 PolarHBondContact O-N 3.25Å; R44-A48 WeakPolarHBondContact O-CB 3.43Å; R44-A48 PolarHBondContact O-N 2.88Å
45	D	93.8	Very high	93.9	Very high	111 Å²	111	93.6 Å²	93.6	59%	0.594	50%	0.495	S	S	*	.	H	α-helix	trans	-63.7	-38.1	179.4	-70.8	-15.9	0	0	0	110.9	R41 R42 L43 L49	R41-D45 PolarHBondContact O-N 3.27Å; R42-D45 PolarHBondContact O-N 3.02Å; L43-D45 PolarHBondContact O-N 3.46Å; D45-L49 WeakPolarHBondContact O-CB 3.48Å; D45-L49 PolarHBondContact O-N 3.39Å
46	A	96.3	Very high	94.1	Very high	54 Å²	54	97.3 Å²	97.3	45%	0.446	49%	0.488	S	S	.	.	H	α-helix	trans	-67.7	-41.4	176.3	0	0	0	0	0	112.7	R42 L43 R44 L49 R50	R42-A46 VanDerWaalsContact O-CB 3.24Å; R42-A46 WeakPolarHBondContact O-CB 3.35Å; R42-A46 PolarHBondContact O-N 3.36Å; L43-A46 PolarHBondContact O-N 3Å; R44-A46 VanDerWaalsContact C-N 3.29Å; R44-A46 PolarHBondContact O-N 2.88Å; A46-L49 PolarHBondContact O-N 2.9Å; A46-R50 WeakPolarHBondContact O-CB 3.43Å; A46-R50 PolarHBondContact O-N 2.89Å
47	E	96.1	Very high	94.1	Very high	124 Å²	124	98 Å²	98	58%	0.579	50%	0.497	S	S	*	.	H	α-helix	trans	-62.9	-45.9	175.1	-75	176.3	168.4	0	0	111.6	L43 R44 L49 R50 A51	L43-E47 WeakPolarHBondContact O-CG 3.49Å; L43-E47 PolarHBondContact O-N 3.45Å; R44-E47 PolarHBondContact O-N 3.25Å; E47-L49 VanDerWaalsContact C-N 3.3Å; E47-L49 PolarHBondContact O-N 3.4Å; E47-R50 PolarHBondContact O-N 2.86Å; E47-A51 WeakPolarHBondContact O-CB 3.45Å; E47-A51 PolarHBondContact O-N 3.24Å
48	A	95.7	Very high	93.9	Very high	63 Å²	63	101.6 Å²	101.6	52%	0.521	51%	0.509	S	S	.	.	H	α-helix	trans	-60.8	-39.9	176	0	0	0	0	0	111.8	R44 K52	R44-A48 WeakPolarHBondContact O-CB 3.43Å; R44-A48 PolarHBondContact O-N 2.88Å; A48-K52 WeakPolarHBondContact O-CB 3.33Å; A48-K52 PolarHBondContact O-N 3.35Å
49	L	96	Very high	93.6	Very high	97 Å²	97	101.5 Å²	101.5	51%	0.508	52%	0.521	S	S	.	.	H	α-helix	trans	-65.5	-45	175.3	-176.7	64.6	0	0	0	111.8	D45 A46 E47 K52 Q53	D45-L49 WeakPolarHBondContact O-CB 3.48Å; D45-L49 PolarHBondContact O-N 3.39Å; A46-L49 PolarHBondContact O-N 2.9Å; E47-L49 VanDerWaalsContact C-N 3.3Å; E47-L49 PolarHBondContact O-N 3.4Å; L49-K52 PolarHBondContact O-N 2.97Å; L49-Q53 WeakPolarHBondContact O-CG 3.35Å; L49-Q53 PolarHBondContact O-N 3.45Å
50	R	96	Very high	92.8	Very high	157 Å²	157	100.4 Å²	100.4	59%	0.592	53%	0.525	S	S	*	.	H	α-helix	trans	-61.2	-45.8	177.7	-174.4	-176.9	-74.9	146.9	-5.2	111	A46 E47 K52 Q53 Q54	A46-R50 WeakPolarHBondContact O-CB 3.43Å; A46-R50 PolarHBondContact O-N 2.89Å; E47-R50 PolarHBondContact O-N 2.86Å; R50-K52 VanDerWaalsContact C-N 3.33Å; R50-K52 PolarHBondContact O-N 3.24Å; R50-Q53 PolarHBondContact O-N 3.37Å; R50-Q54 WeakPolarHBondContact O-CG 3.23Å; R50-Q54 PolarHBondContact O-N 2.92Å
51	A	95.9	Very high	91.8	Very high	53 Å²	53	101.1 Å²	101.1	44%	0.438	54%	0.535	S	S	.	.	H	α-helix	trans	-60.8	-42.6	176	0	0	0	0	0	111.7	E47 Q54 A55	E47-A51 WeakPolarHBondContact O-CB 3.45Å; E47-A51 PolarHBondContact O-N 3.24Å; A51-Q54 PolarHBondContact O-N 3.11Å; A51-A55 WeakPolarHBondContact O-CB 3.47Å; A51-A55 PolarHBondContact O-N 3.26Å
52	K	96.2	Very high	90.4	Very high	156 Å²	156	104.2 Å²	104.2	68%	0.678	56%	0.561	S	S	*	*	H	α-helix	trans	-64.1	-40.2	175.8	-174.9	176.8	-178.8	178.1	0	112.5	A48 L49 R50 K56	A48-K52 WeakPolarHBondContact O-CB 3.33Å; A48-K52 PolarHBondContact O-N 3.35Å; L49-K52 PolarHBondContact O-N 2.97Å; R50-K52 VanDerWaalsContact C-N 3.33Å; R50-K52 PolarHBondContact O-N 3.24Å; K52-K56 WeakPolarHBondContact O-CB 3.32Å; K52-K56 PolarHBondContact O-N 2.93Å
53	Q	94.8	Very high	89	Confident	110 Å²	110	107.1 Å²	107.1	51%	0.514	58%	0.577	S	S	.	*	H	α-helix	trans	-63.9	-46	175.7	-74.6	172.6	-12.5	0	0	110.9	L49 R50 K56 S57	L49-Q53 WeakPolarHBondContact O-CG 3.35Å; L49-Q53 PolarHBondContact O-N 3.45Å; R50-Q53 PolarHBondContact O-N 3.37Å; Q53-K56 PolarHBondContact O-N 2.9Å; Q53-S57 WeakPolarHBondContact O-CB 3.34Å; Q53-S57 PolarHBondContact O-N 3.3Å; Q53-S57 PolarHBondContact O-OG 3.45Å; Q53-S57 VanDerWaalsContact O-OG 3.11Å
54	Q	94.6	Very high	87.3	Confident	112 Å²	112	109.8 Å²	109.8	52%	0.523	62%	0.615	S	S	.	*	H	α-helix	trans	-60.7	-47	176.1	-71.9	174.1	-25.5	0	0	112	R50 A51 K56 S57 Q58	R50-Q54 WeakPolarHBondContact O-CG 3.23Å; R50-Q54 PolarHBondContact O-N 2.92Å; A51-Q54 PolarHBondContact O-N 3.11Å; Q54-K56 VanDerWaalsContact C-N 3.34Å; Q54-K56 PolarHBondContact O-N 3.26Å; Q54-S57 PolarHBondContact O-N 3.45Å; Q54-Q58 WeakPolarHBondContact O-CB 3.32Å; Q54-Q58 VanDerWaalsContact O-CG 3.32Å; Q54-Q58 WeakPolarHBondContact O-CG 3.38Å; Q54-Q58 PolarHBondContact O-N 2.89Å
55	A	93.4	Very high	87.1	Confident	57 Å²	57	111 Å²	111	47%	0.471	63%	0.629	S	S	.	*	H	α-helix	trans	-61.9	-41.3	177.2	0	0	0	0	0	111.9	A51 Q58 A59	A51-A55 WeakPolarHBondContact O-CB 3.47Å; A51-A55 PolarHBondContact O-N 3.26Å; A55-Q58 PolarHBondContact O-N 2.8Å; A55-A59 VanDerWaalsContact O-CB 3.29Å; A55-A59 WeakPolarHBondContact O-CB 3.5Å; A55-A59 PolarHBondContact O-N 2.84Å
56	K	92.7	Very high	86.7	Confident	162 Å²	162	111 Å²	111	70%	0.704	63%	0.631	S	S	*	*	H	α-helix	trans	-64.3	-45	175	-172.6	179.4	179.6	-175.5	0	111.3	K52 Q53 Q54 Q58 A59 S60	K52-K56 WeakPolarHBondContact O-CB 3.32Å; K52-K56 PolarHBondContact O-N 2.93Å; Q53-K56 PolarHBondContact O-N 2.9Å; Q54-K56 VanDerWaalsContact C-N 3.34Å; Q54-K56 PolarHBondContact O-N 3.26Å; K56-Q58 PolarHBondContact O-N 3Å; K56-A59 PolarHBondContact O-N 3.49Å; K56-S60 VanDerWaalsContact O-CB 3.23Å; K56-S60 WeakPolarHBondContact O-CB 3.29Å; K56-S60 PolarHBondContact O-N 2.83Å; K56-S60 PolarHBondContact O-OG 3.35Å
57	S	90	Very high	86.2	Confident	70 Å²	70	114.2 Å²	114.2	49%	0.49	64%	0.642	S	S	.	*	H	α-helix	trans	-57.9	-48.4	176.2	-67.4	0	0	0	0	110.8	Q53 Q54 S60 V61	Q53-S57 WeakPolarHBondContact O-CB 3.34Å; Q53-S57 PolarHBondContact O-N 3.3Å; Q53-S57 PolarHBondContact O-OG 3.45Å; Q53-S57 VanDerWaalsContact O-OG 3.11Å; Q54-S57 PolarHBondContact O-N 3.45Å; S57-S60 WeakPolarHBondContact CA-OG 3.28Å; S57-S60 PolarHBondContact O-N 2.89Å; S57-S60 PolarHBondContact O-OG 3.04Å; S57-V61 VanDerWaalsContact O-CG2 3.28Å; S57-V61 WeakPolarHBondContact O-CG2 3.09Å; S57-V61 PolarHBondContact O-N 3.46Å
58	Q	86.9	Confident	85.6	Confident	148 Å²	148	113.6 Å²	113.6	69%	0.692	65%	0.645	S	S	*	*	H	α-helix	trans	-62.6	-43.2	177.6	-70.7	177.2	20.3	0	0	112.8	Q54 A55 K56 S60 V61	Q54-Q58 WeakPolarHBondContact O-CB 3.32Å; Q54-Q58 VanDerWaalsContact O-CG 3.32Å; Q54-Q58 WeakPolarHBondContact O-CG 3.38Å; Q54-Q58 PolarHBondContact O-N 2.89Å; A55-Q58 PolarHBondContact O-N 2.8Å; K56-Q58 PolarHBondContact O-N 3Å; Q58-S60 VanDerWaalsContact C-N 3.28Å; Q58-S60 PolarHBondContact O-N 3.37Å; Q58-V61 PolarHBondContact O-N 3.22Å
59	A	84.7	Confident	85	Confident	86 Å²	86	116.8 Å²	116.8	71%	0.711	65%	0.653	S	S	*	*	H	α-helix	trans	-69.2	-28	176.9	0	0	0	0	0	112.8	A55 K56	A55-A59 VanDerWaalsContact O-CB 3.29Å; A55-A59 WeakPolarHBondContact O-CB 3.5Å; A55-A59 PolarHBondContact O-N 2.84Å; K56-A59 PolarHBondContact O-N 3.49Å
60	S	76.6	Confident	84.2	Confident	82 Å²	82	118.1 Å²	118.1	57%	0.573	66%	0.663	S	S	*	*	H	α-helix	trans	-84.7	-11.1	177.4	67.4	0	0	0	0	114.1	K56 S57 Q58 P62	K56-S60 VanDerWaalsContact O-CB 3.23Å; K56-S60 WeakPolarHBondContact O-CB 3.29Å; K56-S60 PolarHBondContact O-N 2.83Å; K56-S60 PolarHBondContact O-OG 3.35Å; S57-S60 WeakPolarHBondContact CA-OG 3.28Å; S57-S60 PolarHBondContact O-N 2.89Å; S57-S60 PolarHBondContact O-OG 3.04Å; Q58-S60 VanDerWaalsContact C-N 3.28Å; Q58-S60 PolarHBondContact O-N 3.37Å; S60-P62 WeakPolarHBondContact O-CD 3.36Å
61	V	72.7	Confident	83.4	Confident	99 Å²	99	115.3 Å²	115.3	60%	0.6	67%	0.668	S	S	*	*	S	Bend	trans	-71.4	109.7	165.5	-171.8	0	0	0	0	105.2	S57 Q58 K63	S57-V61 VanDerWaalsContact O-CG2 3.28Å; S57-V61 WeakPolarHBondContact O-CG2 3.09Å; S57-V61 PolarHBondContact O-N 3.46Å; Q58-V61 PolarHBondContact O-N 3.22Å; V61-K63 PolarHBondContact O-N 2.77Å
62	P	64.6	Low	82.4	Confident	108 Å²	108	120.1 Å²	120.1	70%	0.701	69%	0.685	S	S	*	*			trans	-58.4	116.5	169.9	26.7	-30.9	0	0	0	105.2	S60 A64	S60-P62 WeakPolarHBondContact O-CD 3.36Å; P62-A64 PolarHBondContact O-N 2.95Å
63	K	65.1	Low	81.3	Confident	208 Å²	208	117.1 Å²	117.1	90%	0.904	69%	0.686	S	S	*	*			trans	-60.5	94.1	169	-174.9	-178.5	-178.8	179.8	0	106	V61	V61-K63 PolarHBondContact O-N 2.77Å
64	A	59.3	Low	80.1	Confident	163 Å²	163	117.7 Å²	117.7	100%	1.347	70%	0.702	S	S	*	*			trans	-70.5	0	166.8	0	0	0	0	0	109	P62	P62-A64 PolarHBondContact O-N 2.95Å

Retrieved 64 of 64 residues in 164.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).