A0A5K4F819_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F819, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 61 aa.

						>A0A5K4F819_SCHMA|A0A5K4F819
MKCIGLLFWFSILSRILYLCICIITCPYYTIVSRIVTTGRLFYFFHYIKQENISNEWFVYE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.6	Low	84	Confident	218 Å²	218	136.2 Å²	136.2	100%	1.074	69%	0.691	S	S	*	*				0	19.5	0	-77.5	-179.5	171.6	0	0	115.1	C3	M1-C3 PolarHBondContact O-N 2.84Å
2	K	73.1	Confident	84.9	Confident	211 Å²	211	131.2 Å²	131.2	92%	0.917	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.2	-6.6	-178.5	-69.4	179.3	175.9	175.4	0	115.6
3	C	79.6	Confident	85.6	Confident	99 Å²	99	127 Å²	127	67%	0.669	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.3	-16.2	-174.8	-64.3	0	0	0	0	115.1	M1 G5 L6	M1-C3 PolarHBondContact O-N 2.84Å; C3-G5 VanDerWaalsContact C-N 3.33Å; C3-G5 PolarHBondContact O-N 3.24Å; C3-L6 PolarHBondContact O-N 2.96Å
4	I	85.1	Confident	86.3	Confident	116 Å²	116	121.8 Å²	121.8	60%	0.595	63%	0.626	S	S	*	*	H	α-helix	trans	-65.4	-36.4	-175.5	-66.9	157.6	0	0	0	111.5	L6 L7 F8	I4-L6 VanDerWaalsContact C-N 3.33Å; I4-L6 PolarHBondContact O-N 3.2Å; I4-L7 PolarHBondContact O-N 3.5Å; I4-F8 PolarHBondContact O-N 2.96Å
5	G	88	Confident	86.8	Confident	53 Å²	53	126.2 Å²	126.2	55%	0.546	63%	0.632	S	S	.	*	H	α-helix	trans	-64.9	-33.9	178.7	0	0	0	0	0	113.7	C3 F8 W9	C3-G5 VanDerWaalsContact C-N 3.33Å; C3-G5 PolarHBondContact O-N 3.24Å; G5-F8 PolarHBondContact O-N 3.49Å; G5-W9 PolarHBondContact O-N 3.3Å
6	L	84.6	Confident	87.4	Confident	140 Å²	140	124.3 Å²	124.3	73%	0.733	62%	0.623	S	S	*	*	H	α-helix	trans	-69.6	-41.2	-178.9	-159.9	89.4	0	0	0	111.7	C3 I4 F8 W9 F10	C3-L6 PolarHBondContact O-N 2.96Å; I4-L6 VanDerWaalsContact C-N 3.33Å; I4-L6 PolarHBondContact O-N 3.2Å; L6-F8 VanDerWaalsContact C-N 3.32Å; L6-F8 PolarHBondContact O-N 3.47Å; L6-W9 PolarHBondContact O-N 3.32Å; L6-F10 PolarHBondContact O-N 3.12Å; L6-F10 VanDerWaalsContact O-N 3.11Å
7	L	86.8	Confident	87.8	Confident	124 Å²	124	123.4 Å²	123.4	65%	0.649	62%	0.62	S	S	*	*	H	α-helix	trans	-64.7	-37.2	178.1	-73.1	169.6	0	0	0	112	I4 S11	I4-L7 PolarHBondContact O-N 3.5Å; L7-S11 PolarHBondContact O-N 3.37Å; L7-S11 PolarHBondContact O-OG 3.49Å
8	F	89.6	Confident	88.2	Confident	150 Å²	150	126 Å²	126	66%	0.658	62%	0.622	S	S	*	*	H	α-helix	trans	-67.1	-44.5	177.6	-167.1	-102.1	0	0	0	111.8	I4 G5 L6 F10 S11 I12	I4-F8 PolarHBondContact O-N 2.96Å; G5-F8 PolarHBondContact O-N 3.49Å; L6-F8 VanDerWaalsContact C-N 3.32Å; L6-F8 PolarHBondContact O-N 3.47Å; F8-F10 PolarHBondContact O-N 3.32Å; F8-S11 PolarHBondContact O-N 2.93Å; F8-I12 HydrophobicContact CD1-CD1 3.76Å; F8-I12 HydrophobicContact CE1-CD1 3.45Å; F8-I12 VanDerWaalsContact CE1-CD1 3.45Å; F8-I12 HydrophobicContact CZ-CD1 4.13Å; F8-I12 PolarHBondContact O-N 3.16Å
9	W	89.5	Confident	88.4	Confident	179 Å²	179	125.1 Å²	125.1	68%	0.678	62%	0.619	S	S	*	*	H	α-helix	trans	-62.3	-42.7	178.5	-168.3	-89.1	0	0	0	112.7	G5 L6 S11 I12 L13	G5-W9 PolarHBondContact O-N 3.3Å; L6-W9 PolarHBondContact O-N 3.32Å; W9-S11 VanDerWaalsContact C-N 3.3Å; W9-S11 PolarHBondContact O-N 3.34Å; W9-I12 PolarHBondContact O-N 2.91Å; W9-L13 PolarHBondContact O-N 3.44Å; W9-L13 VanDerWaalsContact O-N 3.11Å
10	F	91.9	Very high	88.8	Confident	145 Å²	145	122.1 Å²	122.1	64%	0.636	61%	0.61	S	S	*	*	H	α-helix	trans	-62.2	-37.2	178.1	-173.4	-101.9	0	0	0	112.8	L6 F8 I12 L13 S14	L6-F10 PolarHBondContact O-N 3.12Å; L6-F10 VanDerWaalsContact O-N 3.11Å; F8-F10 PolarHBondContact O-N 3.32Å; F10-I12 VanDerWaalsContact C-N 3.34Å; F10-I12 PolarHBondContact O-N 3.45Å; F10-L13 PolarHBondContact O-N 3.19Å; F10-S14 PolarHBondContact O-N 3.12Å; F10-S14 PolarHBondContact O-OG 3.49Å
11	S	92.6	Very high	89.1	Confident	63 Å²	63	121.3 Å²	121.3	44%	0.441	61%	0.608	S	S	.	*	H	α-helix	trans	-66.4	-34.5	178.8	-61.2	0	0	0	0	112.9	L7 F8 W9 S14 R15	L7-S11 PolarHBondContact O-N 3.37Å; L7-S11 PolarHBondContact O-OG 3.49Å; F8-S11 PolarHBondContact O-N 2.93Å; W9-S11 VanDerWaalsContact C-N 3.3Å; W9-S11 PolarHBondContact O-N 3.34Å; S11-S14 PolarHBondContact O-OG 2.94Å; S11-S14 VanDerWaalsContact O-OG 3.08Å; S11-R15 VanDerWaalsContact O-CG 3.31Å; S11-R15 WeakPolarHBondContact O-CG 3.16Å; S11-R15 PolarHBondContact O-N 3.28Å
12	I	94.8	Very high	90.5	Very high	76 Å²	76	114.1 Å²	114.1	39%	0.39	58%	0.578	S	S	.	*	H	α-helix	trans	-72.4	-44.7	176.3	-66.2	164.8	0	0	0	109.7	F8 W9 F10 S14 R15 I16	F8-I12 HydrophobicContact CD1-CD1 3.76Å; F8-I12 HydrophobicContact CE1-CD1 3.45Å; F8-I12 VanDerWaalsContact CE1-CD1 3.45Å; F8-I12 HydrophobicContact CZ-CD1 4.13Å; F8-I12 PolarHBondContact O-N 3.16Å; W9-I12 PolarHBondContact O-N 2.91Å; F10-I12 VanDerWaalsContact C-N 3.34Å; F10-I12 PolarHBondContact O-N 3.45Å; I12-S14 PolarHBondContact O-N 3.21Å; I12-R15 PolarHBondContact O-N 2.94Å; I12-I16 HydrophobicContact CG2-CD1 3.78Å; I12-I16 HydrophobicContact CG2-CG1 4.48Å; I12-I16 WeakPolarHBondContact O-CG1 3.47Å; I12-I16 PolarHBondContact O-N 3.39Å
13	L	93.6	Very high	91.4	Very high	77 Å²	77	110.1 Å²	110.1	40%	0.403	57%	0.565	S	S	.	*	H	α-helix	trans	-58.3	-46.3	178.1	-79.1	170.5	0	0	0	112.4	W9 F10 R15 I16 L17	W9-L13 PolarHBondContact O-N 3.44Å; W9-L13 VanDerWaalsContact O-N 3.11Å; F10-L13 PolarHBondContact O-N 3.19Å; L13-R15 VanDerWaalsContact C-N 3.33Å; L13-R15 PolarHBondContact O-N 3.43Å; L13-I16 PolarHBondContact O-N 3.05Å; L13-L17 WeakPolarHBondContact O-CB 3.3Å; L13-L17 WeakPolarHBondContact O-CG 3.43Å; L13-L17 PolarHBondContact O-N 3.41Å
14	S	95.2	Very high	92	Very high	54 Å²	54	111.4 Å²	111.4	38%	0.378	56%	0.564	S	S	.	*	H	α-helix	trans	-63.8	-38.4	-179.3	63.2	0	0	0	0	112.4	F10 S11 I12 L17 Y18	F10-S14 PolarHBondContact O-N 3.12Å; F10-S14 PolarHBondContact O-OG 3.49Å; S11-S14 PolarHBondContact O-OG 2.94Å; S11-S14 VanDerWaalsContact O-OG 3.08Å; I12-S14 PolarHBondContact O-N 3.21Å; S14-L17 PolarHBondContact O-N 2.99Å; S14-Y18 WeakPolarHBondContact O-CB 3.41Å; S14-Y18 PolarHBondContact O-N 2.93Å
15	R	94.2	Very high	92.3	Very high	188 Å²	188	108 Å²	108	71%	0.709	55%	0.548	S	S	*	.	H	α-helix	trans	-66	-41	176	-70.6	178.9	75.3	162.4	4.6	112.2	S11 I12 L13 Y18 L19	S11-R15 VanDerWaalsContact O-CG 3.31Å; S11-R15 WeakPolarHBondContact O-CG 3.16Å; S11-R15 PolarHBondContact O-N 3.28Å; I12-R15 PolarHBondContact O-N 2.94Å; L13-R15 VanDerWaalsContact C-N 3.33Å; L13-R15 PolarHBondContact O-N 3.43Å; R15-Y18 PolarHBondContact O-N 3.34Å; R15-L19 WeakPolarHBondContact O-CG 3.48Å; R15-L19 PolarHBondContact O-N 3.01Å
16	I	95.7	Very high	92.2	Very high	95 Å²	95	108.9 Å²	108.9	49%	0.487	55%	0.546	S	S	.	.	H	α-helix	trans	-64.5	-47.3	176.1	-65.4	167	0	0	0	110.1	I12 L13 Y18 L19 C20	I12-I16 HydrophobicContact CG2-CD1 3.78Å; I12-I16 HydrophobicContact CG2-CG1 4.48Å; I12-I16 WeakPolarHBondContact O-CG1 3.47Å; I12-I16 PolarHBondContact O-N 3.39Å; L13-I16 PolarHBondContact O-N 3.05Å; I16-Y18 VanDerWaalsContact C-N 3.32Å; I16-Y18 PolarHBondContact O-N 3.02Å; I16-L19 PolarHBondContact O-N 2.98Å; I16-C20 PolarHBondContact O-N 3.43Å; I16-C20 PolarHBondContact O-SG 3.07Å; I16-C20 VanDerWaalsContact O-SG 3.37Å
17	L	94.3	Very high	92.2	Very high	109 Å²	109	105.3 Å²	105.3	57%	0.571	53%	0.531	S	S	*	.	H	α-helix	trans	-58.7	-43.1	177.7	-73.7	169.5	0	0	0	112	L13 S14 C20 I21	L13-L17 WeakPolarHBondContact O-CB 3.3Å; L13-L17 WeakPolarHBondContact O-CG 3.43Å; L13-L17 PolarHBondContact O-N 3.41Å; S14-L17 PolarHBondContact O-N 2.99Å; L17-C20 PolarHBondContact O-N 2.93Å; L17-I21 WeakPolarHBondContact O-CG1 3.45Å; L17-I21 PolarHBondContact O-N 3.3Å; L17-I21 VanDerWaalsContact O-N 3.1Å
18	Y	95.4	Very high	92.2	Very high	171 Å²	171	106.9 Å²	106.9	67%	0.671	53%	0.529	S	S	*	.	H	α-helix	trans	-63.1	-43.3	177.3	-176.1	-99.7	0	0	0	112.5	S14 R15 I16 C20 I21 C22	S14-Y18 WeakPolarHBondContact O-CB 3.41Å; S14-Y18 PolarHBondContact O-N 2.93Å; R15-Y18 PolarHBondContact O-N 3.34Å; I16-Y18 VanDerWaalsContact C-N 3.32Å; I16-Y18 PolarHBondContact O-N 3.02Å; Y18-C20 VanDerWaalsContact C-N 3.34Å; Y18-C20 PolarHBondContact O-N 3.37Å; Y18-I21 PolarHBondContact O-N 3.4Å; Y18-C22 WeakPolarHBondContact O-CB 3.45Å; Y18-C22 PolarHBondContact O-N 3.37Å
19	L	93	Very high	92	Very high	108 Å²	108	107.4 Å²	107.4	57%	0.565	53%	0.528	S	S	*	.	H	α-helix	trans	-62.3	-40.7	176.3	-73	171.7	0	0	0	111.9	R15 I16 C22 I23	R15-L19 WeakPolarHBondContact O-CG 3.48Å; R15-L19 PolarHBondContact O-N 3.01Å; I16-L19 PolarHBondContact O-N 2.98Å; L19-C22 PolarHBondContact O-N 2.83Å; L19-I23 WeakPolarHBondContact O-CG1 3.35Å; L19-I23 PolarHBondContact O-N 3.35Å
20	C	95.8	Very high	91.8	Very high	65 Å²	65	101.5 Å²	101.5	44%	0.439	51%	0.512	S	S	.	.	H	α-helix	trans	-60.5	-48.1	175.5	-69.5	0	0	0	0	112.2	I16 L17 Y18 C22 I23 I24	I16-C20 PolarHBondContact O-N 3.43Å; I16-C20 PolarHBondContact O-SG 3.07Å; I16-C20 VanDerWaalsContact O-SG 3.37Å; L17-C20 PolarHBondContact O-N 2.93Å; Y18-C20 VanDerWaalsContact C-N 3.34Å; Y18-C20 PolarHBondContact O-N 3.37Å; C20-C22 VanDerWaalsContact C-N 3.29Å; C20-C22 PolarHBondContact O-N 3.42Å; C20-I23 PolarHBondContact O-N 3.1Å; C20-I24 WeakPolarHBondContact O-CG1 3.49Å; C20-I24 PolarHBondContact O-N 3.03Å; C20-I24 VanDerWaalsContact O-N 3.12Å
21	I	94.9	Very high	91.4	Very high	107 Å²	107	99.3 Å²	99.3	55%	0.549	51%	0.506	S	S	.	.	H	α-helix	trans	-62.3	-39	178.5	-64.5	164.4	0	0	0	110.8	L17 Y18 I24 T25	L17-I21 WeakPolarHBondContact O-CG1 3.45Å; L17-I21 PolarHBondContact O-N 3.3Å; L17-I21 VanDerWaalsContact O-N 3.1Å; Y18-I21 PolarHBondContact O-N 3.4Å; I21-I24 PolarHBondContact O-N 2.9Å; I21-T25 WeakPolarHBondContact O-CB 3.43Å; I21-T25 PolarHBondContact O-N 2.92Å; I21-T25 PolarHBondContact O-OG1 3.31Å
22	C	93.2	Very high	90.9	Very high	66 Å²	66	99.4 Å²	99.4	45%	0.446	50%	0.504	S	S	.	.	H	α-helix	trans	-62.5	-45.6	177.4	-170.2	0	0	0	0	111.9	Y18 L19 C20 I24 T25 C26	Y18-C22 WeakPolarHBondContact O-CB 3.45Å; Y18-C22 PolarHBondContact O-N 3.37Å; L19-C22 PolarHBondContact O-N 2.83Å; C20-C22 VanDerWaalsContact C-N 3.29Å; C20-C22 PolarHBondContact O-N 3.42Å; C22-I24 VanDerWaalsContact C-N 3.31Å; C22-I24 PolarHBondContact O-N 3.34Å; C22-T25 PolarHBondContact O-N 3.42Å; C22-C26 VanDerWaalsContact O-CB 3.26Å; C22-C26 WeakPolarHBondContact O-CB 3.5Å; C22-C26 PolarHBondContact O-N 2.93Å
23	I	92.1	Very high	90.2	Very high	127 Å²	127	99.2 Å²	99.2	65%	0.651	51%	0.509	S	S	*	.	H	α-helix	trans	-62.8	-37.1	178	-67.6	169.2	0	0	0	111.5	L19 C20 P27	L19-I23 WeakPolarHBondContact O-CG1 3.35Å; L19-I23 PolarHBondContact O-N 3.35Å; C20-I23 PolarHBondContact O-N 3.1Å; I23-P27 WeakPolarHBondContact O-CD 3.31Å
24	I	92	Very high	89.6	Confident	126 Å²	126	103.9 Å²	103.9	65%	0.646	52%	0.521	S	S	*	.	H	α-helix	trans	-73.8	-40	178.5	-63.2	168.4	0	0	0	111.5	C20 I21 C22 P27	C20-I24 WeakPolarHBondContact O-CG1 3.49Å; C20-I24 PolarHBondContact O-N 3.03Å; C20-I24 VanDerWaalsContact O-N 3.12Å; I21-I24 PolarHBondContact O-N 2.9Å; C22-I24 VanDerWaalsContact C-N 3.31Å; C22-I24 PolarHBondContact O-N 3.34Å; I24-P27 VanDerWaalsContact O-CD 3.29Å; I24-P27 WeakPolarHBondContact O-CD 3.4Å; I24-P27 VanDerWaalsContact O-CG 3.27Å; I24-P27 WeakPolarHBondContact O-CG 3.44Å
25	T	90.6	Very high	89	Confident	44 Å²	44	106.7 Å²	106.7	27%	0.27	53%	0.531	S	S	.	.	H	α-helix	trans	-81.7	-25.7	-175.1	-36.5	0	0	0	0	112.9	I21 C22 Y28 Y29	I21-T25 WeakPolarHBondContact O-CB 3.43Å; I21-T25 PolarHBondContact O-N 2.92Å; I21-T25 PolarHBondContact O-OG1 3.31Å; C22-T25 PolarHBondContact O-N 3.42Å; T25-Y28 WeakPolarHBondContact O-CB 3.48Å; T25-Y28 PolarHBondContact O-N 2.99Å; T25-Y28 VanDerWaalsContact O-N 3.15Å; T25-Y29 HydrophobicContact CG2-CD2 3.63Å; T25-Y29 HydrophobicContact CG2-CE2 3.17Å; T25-Y29 VanDerWaalsContact O-CD2 3.24Å; T25-Y29 WeakPolarHBondContact O-CD2 3.33Å; T25-Y29 PolarHBondContact O-N 3.1Å
26	C	86	Confident	88.4	Confident	72 Å²	72	101.9 Å²	101.9	49%	0.486	52%	0.522	S	S	.	.	H	α-helix	trans	-56.9	-47.1	178.6	-162.2	0	0	0	0	114.9	C22 Y28 Y29 T30	C22-C26 VanDerWaalsContact O-CB 3.26Å; C22-C26 WeakPolarHBondContact O-CB 3.5Å; C22-C26 PolarHBondContact O-N 2.93Å; C26-Y28 VanDerWaalsContact C-N 3.3Å; C26-Y28 PolarHBondContact O-N 3.22Å; C26-Y29 PolarHBondContact O-N 2.95Å; C26-T30 WeakPolarHBondContact O-CB 3.27Å; C26-T30 PolarHBondContact O-N 3.45Å; C26-T30 PolarHBondContact O-OG1 3.03Å
27	P	85.3	Confident	87.7	Confident	66 Å²	66	100.9 Å²	100.9	43%	0.429	52%	0.521	S	S	.	.	H	α-helix	trans	-64.8	-34.7	174.7	25.1	-34.4	0	0	0	112	I23 I24 T30 I31	I23-P27 WeakPolarHBondContact O-CD 3.31Å; I24-P27 VanDerWaalsContact O-CD 3.29Å; I24-P27 WeakPolarHBondContact O-CD 3.4Å; I24-P27 VanDerWaalsContact O-CG 3.27Å; I24-P27 WeakPolarHBondContact O-CG 3.44Å; P27-T30 PolarHBondContact O-N 2.74Å; P27-I31 WeakPolarHBondContact O-CB 3.37Å; P27-I31 WeakPolarHBondContact O-CD1 3.2Å; P27-I31 WeakPolarHBondContact O-CG1 3.35Å; P27-I31 PolarHBondContact O-N 3.22Å
28	Y	87.1	Confident	87.2	Confident	157 Å²	157	100.1 Å²	100.1	62%	0.616	52%	0.521	S	S	*	.	H	α-helix	trans	-61	-49.6	177.5	-172.2	-97.9	0	0	0	111.4	T25 C26 T30 I31 V32	T25-Y28 WeakPolarHBondContact O-CB 3.48Å; T25-Y28 PolarHBondContact O-N 2.99Å; T25-Y28 VanDerWaalsContact O-N 3.15Å; C26-Y28 VanDerWaalsContact C-N 3.3Å; C26-Y28 PolarHBondContact O-N 3.22Å; Y28-T30 VanDerWaalsContact C-N 3.34Å; Y28-T30 PolarHBondContact O-N 3.48Å; Y28-I31 PolarHBondContact O-N 3.38Å; Y28-V32 HydrophobicContact CD1-CG2 4.49Å; Y28-V32 HydrophobicContact CE1-CG2 4.21Å; Y28-V32 WeakPolarHBondContact O-CG2 3.43Å; Y28-V32 PolarHBondContact O-N 3.46Å; Y28-V32 VanDerWaalsContact O-N 3.1Å
29	Y	84.7	Confident	86.6	Confident	160 Å²	160	94 Å²	94	63%	0.627	51%	0.509	S	S	*	.	H	α-helix	trans	-65.2	-36	176	-72.8	-65.6	0	0	0	112.9	T25 C26 S33	T25-Y29 HydrophobicContact CG2-CD2 3.63Å; T25-Y29 HydrophobicContact CG2-CE2 3.17Å; T25-Y29 VanDerWaalsContact O-CD2 3.24Å; T25-Y29 WeakPolarHBondContact O-CD2 3.33Å; T25-Y29 PolarHBondContact O-N 3.1Å; C26-Y29 PolarHBondContact O-N 2.95Å; Y29-S33 WeakPolarHBondContact O-CB 3.19Å; Y29-S33 PolarHBondContact O-N 3.15Å
30	T	84.7	Confident	86	Confident	56 Å²	56	98.1 Å²	98.1	34%	0.344	52%	0.517	S	S	.	.	H	α-helix	trans	-64.7	-42.3	177.2	-59.3	0	0	0	0	111.7	C26 P27 Y28 R34	C26-T30 WeakPolarHBondContact O-CB 3.27Å; C26-T30 PolarHBondContact O-N 3.45Å; C26-T30 PolarHBondContact O-OG1 3.03Å; P27-T30 PolarHBondContact O-N 2.74Å; Y28-T30 VanDerWaalsContact C-N 3.34Å; Y28-T30 PolarHBondContact O-N 3.48Å; T30-R34 WeakPolarHBondContact O-CB 3.49Å; T30-R34 VanDerWaalsContact O-CG 3.31Å; T30-R34 WeakPolarHBondContact O-CG 3.31Å; T30-R34 PolarHBondContact O-N 2.86Å
31	I	84	Confident	85.2	Confident	99 Å²	99	99.6 Å²	99.6	51%	0.508	52%	0.52	S	S	.	.	H	α-helix	trans	-65.4	-50	178.6	-67.7	160.4	0	0	0	110.3	P27 Y28 S33 R34 I35	P27-I31 WeakPolarHBondContact O-CB 3.37Å; P27-I31 WeakPolarHBondContact O-CD1 3.2Å; P27-I31 WeakPolarHBondContact O-CG1 3.35Å; P27-I31 PolarHBondContact O-N 3.22Å; Y28-I31 PolarHBondContact O-N 3.38Å; I31-S33 VanDerWaalsContact C-N 3.33Å; I31-S33 PolarHBondContact O-N 3.28Å; I31-R34 PolarHBondContact O-N 2.91Å; I31-I35 HydrophobicContact CG2-CD1 3.72Å; I31-I35 HydrophobicContact CG2-CG1 4.44Å; I31-I35 VanDerWaalsContact O-CG1 3.31Å; I31-I35 WeakPolarHBondContact O-CG1 3.45Å; I31-I35 PolarHBondContact O-N 2.99Å
32	V	82.3	Confident	84.7	Confident	65 Å²	65	101.6 Å²	101.6	39%	0.394	53%	0.525	S	S	.	.	H	α-helix	trans	-60.3	-44.7	179.1	175.4	0	0	0	0	110.9	Y28 R34 I35 V36	Y28-V32 HydrophobicContact CD1-CG2 4.49Å; Y28-V32 HydrophobicContact CE1-CG2 4.21Å; Y28-V32 WeakPolarHBondContact O-CG2 3.43Å; Y28-V32 PolarHBondContact O-N 3.46Å; Y28-V32 VanDerWaalsContact O-N 3.1Å; V32-R34 PolarHBondContact O-N 3.06Å; V32-I35 PolarHBondContact O-N 3.45Å; V32-V36 HydrophobicContact CG1-CG2 4.48Å; V32-V36 WeakPolarHBondContact O-CG2 3.17Å; V32-V36 PolarHBondContact O-N 3.43Å
33	S	79.5	Confident	84.2	Confident	71 Å²	71	106.5 Å²	106.5	50%	0.497	54%	0.536	S	S	.	.	H	α-helix	trans	-60.5	-42.7	177	-176.5	0	0	0	0	112.5	Y29 I31 T37	Y29-S33 WeakPolarHBondContact O-CB 3.19Å; Y29-S33 PolarHBondContact O-N 3.15Å; I31-S33 VanDerWaalsContact C-N 3.33Å; I31-S33 PolarHBondContact O-N 3.28Å; S33-T37 WeakPolarHBondContact O-CB 3.29Å; S33-T37 PolarHBondContact O-N 3.34Å; S33-T37 PolarHBondContact O-OG1 3.39Å
34	R	81.2	Confident	83.8	Confident	175 Å²	175	106.3 Å²	106.3	66%	0.66	53%	0.53	S	S	*	.	H	α-helix	trans	-63.7	-45	175.7	-76.5	178.7	-179.2	178.2	1.1	112.2	T30 I31 V32 V36 T37 T38	T30-R34 WeakPolarHBondContact O-CB 3.49Å; T30-R34 VanDerWaalsContact O-CG 3.31Å; T30-R34 WeakPolarHBondContact O-CG 3.31Å; T30-R34 PolarHBondContact O-N 2.86Å; I31-R34 PolarHBondContact O-N 2.91Å; V32-R34 PolarHBondContact O-N 3.06Å; R34-V36 PolarHBondContact O-N 2.72Å; R34-T37 PolarHBondContact O-N 2.92Å; R34-T38 WeakPolarHBondContact O-CB 3.27Å; R34-T38 PolarHBondContact O-N 2.95Å; R34-T38 PolarHBondContact O-OG1 3.12Å
35	I	82.9	Confident	83.6	Confident	114 Å²	114	107 Å²	107	59%	0.585	53%	0.529	S	S	*	.	H	α-helix	trans	-60.2	-47.4	179	-66.8	165.3	0	0	0	110.9	I31 V32 T37 T38 G39	I31-I35 HydrophobicContact CG2-CD1 3.72Å; I31-I35 HydrophobicContact CG2-CG1 4.44Å; I31-I35 VanDerWaalsContact O-CG1 3.31Å; I31-I35 WeakPolarHBondContact O-CG1 3.45Å; I31-I35 PolarHBondContact O-N 2.99Å; V32-I35 PolarHBondContact O-N 3.45Å; I35-T37 VanDerWaalsContact C-N 3.3Å; I35-T37 PolarHBondContact O-N 3.01Å; I35-T38 PolarHBondContact O-N 3.35Å; I35-G39 PolarHBondContact O-N 3.3Å
36	V	80.8	Confident	83.3	Confident	86 Å²	86	109.4 Å²	109.4	52%	0.521	54%	0.537	S	S	.	.	H	α-helix	trans	-62.4	-40.5	178	174.5	0	0	0	0	110.9	V32 R34 R40	V32-V36 HydrophobicContact CG1-CG2 4.48Å; V32-V36 WeakPolarHBondContact O-CG2 3.17Å; V32-V36 PolarHBondContact O-N 3.43Å; R34-V36 PolarHBondContact O-N 2.72Å; V36-R40 WeakPolarHBondContact O-CG 3.36Å; V36-R40 PolarHBondContact O-N 3.02Å; V36-R40 VanDerWaalsContact O-N 3.07Å
37	T	82.8	Confident	83.2	Confident	75 Å²	75	112 Å²	112	46%	0.46	54%	0.537	S	S	.	.	H	α-helix	trans	-66.7	-44.8	178.4	-55.9	0	0	0	0	111.7	S33 R34 I35 R40 L41	S33-T37 WeakPolarHBondContact O-CB 3.29Å; S33-T37 PolarHBondContact O-N 3.34Å; S33-T37 PolarHBondContact O-OG1 3.39Å; R34-T37 PolarHBondContact O-N 2.92Å; I35-T37 VanDerWaalsContact C-N 3.3Å; I35-T37 PolarHBondContact O-N 3.01Å; T37-R40 PolarHBondContact O-N 3.1Å; T37-L41 HydrophobicContact CG2-CD1 4.43Å; T37-L41 WeakPolarHBondContact O-CG 3.46Å; T37-L41 PolarHBondContact O-N 3.47Å; T37-L41 VanDerWaalsContact O-N 3.1Å
38	T	82.6	Confident	83.1	Confident	93 Å²	93	112.6 Å²	112.6	57%	0.571	54%	0.536	S	S	*	.	H	α-helix	trans	-64.3	-41.3	176.5	-57.7	0	0	0	0	111.8	R34 I35 L41 F42	R34-T38 WeakPolarHBondContact O-CB 3.27Å; R34-T38 PolarHBondContact O-N 2.95Å; R34-T38 PolarHBondContact O-OG1 3.12Å; I35-T38 PolarHBondContact O-N 3.35Å; T38-L41 PolarHBondContact O-N 2.93Å; T38-F42 WeakPolarHBondContact O-CB 3.02Å; T38-F42 PolarHBondContact O-N 3.38Å
39	G	84	Confident	82.8	Confident	42 Å²	42	112 Å²	112	43%	0.433	54%	0.537	S	S	.	.	H	α-helix	trans	-62.8	-42	177.1	0	0	0	0	0	113.1	I35 F42 Y43	I35-G39 PolarHBondContact O-N 3.3Å; G39-F42 PolarHBondContact O-N 3.33Å; G39-Y43 PolarHBondContact O-N 2.99Å
40	R	79	Confident	82.5	Confident	194 Å²	194	109.6 Å²	109.6	73%	0.732	53%	0.531	S	S	*	.	H	α-helix	trans	-63.8	-42.7	175.3	-75.1	-178.8	71.2	-176	2.3	112.2	V36 T37 F42 F44	V36-R40 WeakPolarHBondContact O-CG 3.36Å; V36-R40 PolarHBondContact O-N 3.02Å; V36-R40 VanDerWaalsContact O-N 3.07Å; T37-R40 PolarHBondContact O-N 3.1Å; R40-F42 VanDerWaalsContact C-N 3.35Å; R40-F44 VanDerWaalsContact O-CB 3.27Å; R40-F44 WeakPolarHBondContact O-CB 3.36Å; R40-F44 PolarHBondContact O-N 3.36Å
41	L	78.8	Confident	82.2	Confident	96 Å²	96	111.4 Å²	111.4	50%	0.503	54%	0.536	S	S	.	.	H	α-helix	trans	-62	-44.8	175.5	-72.7	170.8	0	0	0	110.9	T37 T38 F44 F45	T37-L41 HydrophobicContact CG2-CD1 4.43Å; T37-L41 WeakPolarHBondContact O-CG 3.46Å; T37-L41 PolarHBondContact O-N 3.47Å; T37-L41 VanDerWaalsContact O-N 3.1Å; T38-L41 PolarHBondContact O-N 2.93Å; L41-F44 PolarHBondContact O-N 3.33Å; L41-F45 WeakPolarHBondContact O-CD2 3.24Å; L41-F45 PolarHBondContact O-N 3.22Å
42	F	85	Confident	81.6	Confident	149 Å²	149	111.4 Å²	111.4	65%	0.654	54%	0.537	S	S	*	.	H	α-helix	trans	-62.8	-46.5	178.5	-171.5	-94.5	0	0	0	112.8	T38 G39 R40 F44 F45 H46	T38-F42 WeakPolarHBondContact O-CB 3.02Å; T38-F42 PolarHBondContact O-N 3.38Å; G39-F42 PolarHBondContact O-N 3.33Å; R40-F42 VanDerWaalsContact C-N 3.35Å; F42-F44 VanDerWaalsContact C-N 3.29Å; F42-F44 PolarHBondContact O-N 3.4Å; F42-F45 PolarHBondContact O-N 3.47Å; F42-H46 WeakPolarHBondContact O-CB 3.41Å; F42-H46 PolarHBondContact O-N 3.37Å
43	Y	82.5	Confident	81.4	Confident	169 Å²	169	112.3 Å²	112.3	66%	0.663	54%	0.539	S	S	*	.	H	α-helix	trans	-60.8	-39.8	176	-174.5	-96.2	0	0	0	111.8	G39 H46 Y47	G39-Y43 PolarHBondContact O-N 2.99Å; Y43-H46 PolarHBondContact O-N 3Å; Y43-Y47 WeakPolarHBondContact O-CB 3.46Å; Y43-Y47 PolarHBondContact O-N 3.31Å
44	F	85.1	Confident	81.3	Confident	123 Å²	123	112.5 Å²	112.5	54%	0.539	54%	0.54	S	S	.	.	H	α-helix	trans	-64.5	-46.7	176.7	-172.9	-105.1	0	0	0	112.4	R40 L41 F42 H46 Y47 I48	R40-F44 VanDerWaalsContact O-CB 3.27Å; R40-F44 WeakPolarHBondContact O-CB 3.36Å; R40-F44 PolarHBondContact O-N 3.36Å; L41-F44 PolarHBondContact O-N 3.33Å; F42-F44 VanDerWaalsContact C-N 3.29Å; F42-F44 PolarHBondContact O-N 3.4Å; F44-H46 VanDerWaalsContact C-N 3.32Å; F44-H46 PolarHBondContact O-N 3Å; F44-Y47 PolarHBondContact O-N 3.42Å; F44-I48 HydrophobicContact CD1-CD1 3.71Å; F44-I48 HydrophobicContact CE1-CD1 3.21Å; F44-I48 HydrophobicContact CE1-CG1 4.34Å; F44-I48 HydrophobicContact CE2-CD1 4.24Å; F44-I48 HydrophobicContact CG-CD1 4.42Å; F44-I48 HydrophobicContact CZ-CD1 3.52Å; F44-I48 HydrophobicContact CZ-CG1 4.38Å; F44-I48 PolarHBondContact O-N 3.05Å
45	F	86.5	Confident	81.1	Confident	141 Å²	141	108.3 Å²	108.3	62%	0.618	53%	0.531	S	S	*	.	H	α-helix	trans	-61.7	-39.7	174.7	-85.1	-69.4	0	0	0	112.4	L41 F42 K49	L41-F45 WeakPolarHBondContact O-CD2 3.24Å; L41-F45 PolarHBondContact O-N 3.22Å; F42-F45 PolarHBondContact O-N 3.47Å; F45-K49 WeakPolarHBondContact O-CB 3.26Å; F45-K49 PolarHBondContact O-N 2.94Å
46	H	85.6	Confident	80.5	Confident	95 Å²	95	108.2 Å²	108.2	44%	0.44	53%	0.528	S	S	.	.	H	α-helix	trans	-64.9	-41.1	176.9	-169	-88.8	0	0	0	111.9	F42 Y43 F44 K49 Q50	F42-H46 WeakPolarHBondContact O-CB 3.41Å; F42-H46 PolarHBondContact O-N 3.37Å; Y43-H46 PolarHBondContact O-N 3Å; F44-H46 VanDerWaalsContact C-N 3.32Å; F44-H46 PolarHBondContact O-N 3Å; H46-K49 PolarHBondContact O-N 3.44Å; H46-Q50 PolarHBondContact O-N 3.42Å
47	Y	83.7	Confident	79.9	Confident	125 Å²	125	113.7 Å²	113.7	49%	0.49	54%	0.539	S	S	.	.	H	α-helix	trans	-64.5	-48	177.4	-174.7	-89.3	0	0	0	112	Y43 F44 K49 Q50 E51	Y43-Y47 WeakPolarHBondContact O-CB 3.46Å; Y43-Y47 PolarHBondContact O-N 3.31Å; F44-Y47 PolarHBondContact O-N 3.42Å; Y47-K49 VanDerWaalsContact C-N 3.3Å; Y47-K49 PolarHBondContact O-N 3.29Å; Y47-Q50 PolarHBondContact O-N 3.11Å; Y47-Q50 VanDerWaalsContact O-N 3.12Å; Y47-E51 WeakPolarHBondContact CE1-OE2 3.37Å; Y47-E51 PolarHBondContact O-N 3.47Å; Y47-E51 PolarHBondContact OH-OE2 3.45Å
48	I	83	Confident	79.3	Confident	80 Å²	80	117.8 Å²	117.8	41%	0.41	55%	0.551	S	S	.	*	H	α-helix	trans	-60.1	-41.6	176.4	-68.5	172.6	0	0	0	111.1	F44 Q50 E51 N52	F44-I48 HydrophobicContact CD1-CD1 3.71Å; F44-I48 HydrophobicContact CE1-CD1 3.21Å; F44-I48 HydrophobicContact CE1-CG1 4.34Å; F44-I48 HydrophobicContact CE2-CD1 4.24Å; F44-I48 HydrophobicContact CG-CD1 4.42Å; F44-I48 HydrophobicContact CZ-CD1 3.52Å; F44-I48 HydrophobicContact CZ-CG1 4.38Å; F44-I48 PolarHBondContact O-N 3.05Å; I48-Q50 VanDerWaalsContact C-N 3.3Å; I48-Q50 PolarHBondContact O-N 3.47Å; I48-E51 PolarHBondContact O-N 3.35Å; I48-N52 WeakPolarHBondContact O-CB 3.34Å; I48-N52 PolarHBondContact O-N 3.28Å
49	K	80.8	Confident	78.9	Confident	144 Å²	144	118.8 Å²	118.8	63%	0.626	56%	0.557	S	S	*	*	H	α-helix	trans	-61	-39.6	176.8	-173.8	175.9	178.1	-179.6	0	111.8	F45 H46 Y47 I53	F45-K49 WeakPolarHBondContact O-CB 3.26Å; F45-K49 PolarHBondContact O-N 2.94Å; H46-K49 PolarHBondContact O-N 3.44Å; Y47-K49 VanDerWaalsContact C-N 3.3Å; Y47-K49 PolarHBondContact O-N 3.29Å; K49-I53 HydrophobicContact CG-CD1 4.22Å; K49-I53 WeakPolarHBondContact O-CD1 3.44Å; K49-I53 VanDerWaalsContact O-CG1 3.3Å; K49-I53 WeakPolarHBondContact O-CG1 3.48Å; K49-I53 PolarHBondContact O-N 3.06Å
50	Q	77.4	Confident	78.1	Confident	109 Å²	109	126.1 Å²	126.1	51%	0.509	57%	0.573	S	S	.	*	H	α-helix	trans	-71.5	-40	177	-77.1	-153	94	0	0	113.3	H46 Y47 I48 N52 I53 S54	H46-Q50 PolarHBondContact O-N 3.42Å; Y47-Q50 PolarHBondContact O-N 3.11Å; Y47-Q50 VanDerWaalsContact O-N 3.12Å; I48-Q50 VanDerWaalsContact C-N 3.3Å; I48-Q50 PolarHBondContact O-N 3.47Å; Q50-N52 VanDerWaalsContact C-N 3.33Å; Q50-N52 PolarHBondContact O-N 3.35Å; Q50-I53 PolarHBondContact O-N 3.08Å; Q50-S54 WeakPolarHBondContact O-CB 3.34Å; Q50-S54 PolarHBondContact O-N 3.3Å; Q50-S54 PolarHBondContact O-OG 3.11Å
51	E	77.8	Confident	76.9	Confident	94 Å²	94	127.6 Å²	127.6	44%	0.439	59%	0.588	S	S	.	*	H	α-helix	trans	-62.7	-41.5	176.7	-168	172.1	91.3	0	0	110.9	Y47 I48 S54 N55	Y47-E51 WeakPolarHBondContact CE1-OE2 3.37Å; Y47-E51 PolarHBondContact O-N 3.47Å; Y47-E51 PolarHBondContact OH-OE2 3.45Å; I48-E51 PolarHBondContact O-N 3.35Å; E51-S54 PolarHBondContact O-N 3.29Å; E51-N55 WeakPolarHBondContact O-CB 3.37Å; E51-N55 VanDerWaalsContact O-CG 3.29Å; E51-N55 PolarHBondContact O-N 3.4Å; E51-N55 PolarHBondContact O-ND2 3.46Å; E51-N55 VanDerWaalsContact O-ND2 3.16Å
52	N	72.7	Confident	76.8	Confident	99 Å²	99	129.2 Å²	129.2	53%	0.529	59%	0.592	S	S	.	*	H	α-helix	trans	-63.9	-42.5	175.5	-167.4	84.8	0	0	0	112.9	I48 Q50 S54 N55 E56	I48-N52 WeakPolarHBondContact O-CB 3.34Å; I48-N52 PolarHBondContact O-N 3.28Å; Q50-N52 VanDerWaalsContact C-N 3.33Å; Q50-N52 PolarHBondContact O-N 3.35Å; N52-S54 VanDerWaalsContact C-N 3.33Å; N52-S54 PolarHBondContact O-N 3.38Å; N52-N55 PolarHBondContact O-N 3.31Å; N52-E56 WeakPolarHBondContact O-CB 3.34Å; N52-E56 PolarHBondContact O-N 3.35Å
53	I	78	Confident	76.3	Confident	85 Å²	85	128.1 Å²	128.1	44%	0.436	59%	0.589	S	S	.	*	H	α-helix	trans	-63.4	-40.6	176.1	-68.6	165.5	0	0	0	111	K49 Q50 W57	K49-I53 HydrophobicContact CG-CD1 4.22Å; K49-I53 WeakPolarHBondContact O-CD1 3.44Å; K49-I53 VanDerWaalsContact O-CG1 3.3Å; K49-I53 WeakPolarHBondContact O-CG1 3.48Å; K49-I53 PolarHBondContact O-N 3.06Å; Q50-I53 PolarHBondContact O-N 3.08Å; I53-W57 PolarHBondContact O-N 3.49Å
54	S	76.5	Confident	76	Confident	74 Å²	74	125.8 Å²	125.8	52%	0.517	59%	0.585	S	S	.	*	H	α-helix	trans	-67.8	-40.5	179.5	-53.8	0	0	0	0	111.7	Q50 E51 N52 F58	Q50-S54 WeakPolarHBondContact O-CB 3.34Å; Q50-S54 PolarHBondContact O-N 3.3Å; Q50-S54 PolarHBondContact O-OG 3.11Å; E51-S54 PolarHBondContact O-N 3.29Å; N52-S54 VanDerWaalsContact C-N 3.33Å; N52-S54 PolarHBondContact O-N 3.38Å; S54-F58 PolarHBondContact O-N 3.37Å
55	N	77	Confident	75.5	Confident	88 Å²	88	126 Å²	126	47%	0.471	59%	0.587	S	S	.	*	H	α-helix	trans	-69.8	-37.3	177.1	-73.1	-32.8	0	0	0	112.6	E51 N52 F58 V59	E51-N55 WeakPolarHBondContact O-CB 3.37Å; E51-N55 VanDerWaalsContact O-CG 3.29Å; E51-N55 PolarHBondContact O-N 3.4Å; E51-N55 PolarHBondContact O-ND2 3.46Å; E51-N55 VanDerWaalsContact O-ND2 3.16Å; N52-N55 PolarHBondContact O-N 3.31Å; N55-F58 PolarHBondContact O-N 3.48Å; N55-V59 WeakPolarHBondContact O-CG2 3.31Å; N55-V59 PolarHBondContact O-N 3.41Å; N55-V59 VanDerWaalsContact O-N 3.12Å
56	E	71.2	Confident	74.8	Confident	112 Å²	112	125.1 Å²	125.1	52%	0.523	59%	0.586	S	S	.	*	H	α-helix	trans	-62.4	-45.9	177	-169.5	169.2	88.2	0	0	110.9	N52 F58 V59 Y60	N52-E56 WeakPolarHBondContact O-CB 3.34Å; N52-E56 PolarHBondContact O-N 3.35Å; E56-F58 VanDerWaalsContact C-N 3.27Å; E56-F58 PolarHBondContact O-N 3.4Å; E56-V59 PolarHBondContact O-N 3Å; E56-Y60 HydrophobicContact CG-CD2 4.12Å; E56-Y60 HydrophobicContact CG-CE2 3.79Å; E56-Y60 WeakPolarHBondContact O-CD2 3.35Å; E56-Y60 PolarHBondContact O-N 3.18Å
57	W	67.6	Low	74.1	Confident	200 Å²	200	127.1 Å²	127.1	76%	0.758	60%	0.595	S	S	*	*	H	α-helix	trans	-58.7	-36.3	172.8	-97.5	72.3	0	0	0	113.3	I53 Y60	I53-W57 PolarHBondContact O-N 3.49Å; W57-Y60 PolarHBondContact O-N 3.44Å
58	F	70.7	Confident	73.4	Confident	161 Å²	161	127.2 Å²	127.2	71%	0.706	60%	0.603	S	S	*	*	H	α-helix	trans	-73.3	-27.1	-179.2	-171.4	-98.6	0	0	0	114	S54 N55 E56	S54-F58 PolarHBondContact O-N 3.37Å; N55-F58 PolarHBondContact O-N 3.48Å; E56-F58 VanDerWaalsContact C-N 3.27Å; E56-F58 PolarHBondContact O-N 3.4Å
59	V	73.4	Confident	72.6	Confident	115 Å²	115	130.8 Å²	130.8	70%	0.697	62%	0.618	S	S	*	*	H	α-helix	trans	-79.7	-20.5	177.5	175	0	0	0	0	112.1	N55 E56	N55-V59 WeakPolarHBondContact O-CG2 3.31Å; N55-V59 PolarHBondContact O-N 3.41Å; N55-V59 VanDerWaalsContact O-N 3.12Å; E56-V59 PolarHBondContact O-N 3Å
60	Y	68.6	Low	71.9	Confident	195 Å²	195	129.8 Å²	129.8	77%	0.765	62%	0.617	S	S	*	*			trans	-90.5	-3.1	179.8	-76.9	-68.4	0	0	0	114.6	E56 W57	E56-Y60 HydrophobicContact CG-CD2 4.12Å; E56-Y60 HydrophobicContact CG-CE2 3.79Å; E56-Y60 WeakPolarHBondContact O-CD2 3.35Å; E56-Y60 PolarHBondContact O-N 3.18Å; W57-Y60 PolarHBondContact O-N 3.44Å
61	E	52.4	Low	71.4	Confident	225 Å²	225	131.6 Å²	131.6	100%	1.051	63%	0.627	S	S	*	*			trans	-95.5	0	163	-79	-156.4	98	0	0	111.3

Retrieved 61 of 61 residues in 236.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).