A0A5K4F830_SCHMA Loading...

Protein Wnt

AlphaFold DB , UniProt , Accession A0A5K4F830, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 74 aa.

						>A0A5K4F830_SCHMA|A0A5K4F830
MVSKLFFSNESRCFLFAANNGDSKACISAQTALGYLYSGPEICDLQKAFQWHSDACGNGSVESQGFITKHRISF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.2	Low	58.2	Low	219 Å²	219	105.9 Å²	105.9	100%	1.079	55%	0.549	S	S	*	.				0	-26.1	0	-127	169.1	-167.2	0	0	113.3
2	V	50.5	Low	59.9	Low	110 Å²	110	112 Å²	112	67%	0.667	56%	0.56	S	S	*	*	H	α-helix	trans	-66.1	-39.2	-177	-169.8	0	0	0	0	113.5	K4 L5 F6	V2-K4 PolarHBondContact O-N 3.3Å; V2-L5 PolarHBondContact O-N 3.16Å; V2-F6 HydrophobicContact CG1-CD2 4.39Å; V2-F6 PolarHBondContact O-N 3.28Å; V2-F6 VanDerWaalsContact O-N 3.11Å
3	S	53.8	Low	61.3	Low	75 Å²	75	110.2 Å²	110.2	52%	0.524	56%	0.563	S	S	.	*	H	α-helix	trans	-60.6	-44.4	-176.8	-26.9	0	0	0	0	113.1	L5 F6 F7	S3-L5 VanDerWaalsContact C-N 3.3Å; S3-L5 PolarHBondContact O-N 3.17Å; S3-F6 PolarHBondContact O-N 3.12Å; S3-F7 WeakPolarHBondContact O-CB 3.48Å; S3-F7 PolarHBondContact O-N 3.09Å
4	K	51.1	Low	62.7	Low	173 Å²	173	107.3 Å²	107.3	75%	0.752	54%	0.544	S	S	*	.	H	α-helix	trans	-67	-31.1	-178.4	-136.5	161.8	-168.8	164.5	0	112.8	V2 S8	V2-K4 PolarHBondContact O-N 3.3Å; K4-S8 WeakPolarHBondContact O-CB 3.38Å; K4-S8 PolarHBondContact O-N 3.12Å
5	L	49.2	Very low	64	Low	124 Å²	124	103.9 Å²	103.9	65%	0.649	53%	0.528	S	S	*	.	H	α-helix	trans	-76.6	-41.1	178.1	-146.7	85.9	0	0	0	111.4	V2 S3 S8 N9	V2-L5 PolarHBondContact O-N 3.16Å; S3-L5 VanDerWaalsContact C-N 3.3Å; S3-L5 PolarHBondContact O-N 3.17Å; L5-S8 PolarHBondContact O-N 3.18Å; L5-N9 PolarHBondContact O-N 2.77Å; L5-N9 VanDerWaalsContact O-N 3.17Å
6	F	52.8	Low	65.2	Low	133 Å²	133	106.4 Å²	106.4	58%	0.583	53%	0.534	S	S	*	.	H	α-helix	trans	-61.6	-46.7	174	-117.3	-89.8	0	0	0	111.1	V2 S3 S8 N9 E10	V2-F6 HydrophobicContact CG1-CD2 4.39Å; V2-F6 PolarHBondContact O-N 3.28Å; V2-F6 VanDerWaalsContact O-N 3.11Å; S3-F6 PolarHBondContact O-N 3.12Å; F6-S8 VanDerWaalsContact C-N 3.28Å; F6-S8 PolarHBondContact O-N 3.25Å; F6-N9 PolarHBondContact O-N 3.38Å; F6-N9 VanDerWaalsContact O-N 3.17Å; F6-E10 PolarHBondContact O-N 3.33Å
7	F	58	Low	66.1	Low	53 Å²	53	102 Å²	102	23%	0.232	52%	0.518	C	S	.	.	H	α-helix	trans	-56.7	-41.8	175	-124	-110	0	0	0	112.3	S3 N9 S11 L36 E41 I42	S3-F7 WeakPolarHBondContact O-CB 3.48Å; S3-F7 PolarHBondContact O-N 3.09Å; F7-N9 VanDerWaalsContact C-N 3.35Å; F7-N9 PolarHBondContact O-N 3.1Å; F7-S11 WeakPolarHBondContact O-CB 3.37Å; F7-S11 PolarHBondContact O-N 3.17Å; F7-S11 PolarHBondContact O-OG 3.34Å; F7-L36 HydrophobicContact CD1-CD1 3.76Å; F7-L36 HydrophobicContact CD1-CD2 4.1Å; F7-L36 HydrophobicContact CD1-CG 4Å; F7-L36 HydrophobicContact CD2-CD1 4.44Å; F7-L36 HydrophobicContact CE1-CD1 3.16Å; F7-L36 HydrophobicContact CE1-CD2 3.92Å; F7-L36 HydrophobicContact CE1-CG 3.33Å; F7-L36 HydrophobicContact CE2-CD1 3.9Å; F7-L36 HydrophobicContact CG-CD1 4.38Å; F7-L36 HydrophobicContact CZ-CD1 3.23Å; F7-L36 HydrophobicContact CZ-CG 3.84Å; F7-E41 WeakPolarHBondContact CD2-OE2 3.45Å; F7-E41 HydrophobicContact CE1-CB 4.29Å; F7-E41 WeakPolarHBondContact CE2-OE2 3.43Å; F7-E41 HydrophobicContact CZ-CB 4.27Å; F7-I42 HydrophobicContact CD1-CD1 3.99Å; F7-I42 HydrophobicContact CD1-CG1 4.38Å; F7-I42 HydrophobicContact CE1-CD1 3.71Å; F7-I42 HydrophobicContact CE1-CG1 3.96Å
8	S	63.7	Low	67	Low	62 Å²	62	96.5 Å²	96.5	43%	0.434	49%	0.491	S	S	.	.	H	α-helix	trans	-67.2	-34.6	-179	-155.6	0	0	0	0	112.7	K4 L5 F6 S11 R12	K4-S8 WeakPolarHBondContact O-CB 3.38Å; K4-S8 PolarHBondContact O-N 3.12Å; L5-S8 PolarHBondContact O-N 3.18Å; F6-S8 VanDerWaalsContact C-N 3.28Å; F6-S8 PolarHBondContact O-N 3.25Å; S8-S11 WeakPolarHBondContact CA-OG 3.16Å; S8-S11 PolarHBondContact O-OG 3.34Å; S8-S11 VanDerWaalsContact O-OG 3.13Å; S8-R12 WeakPolarHBondContact O-CB 3.45Å; S8-R12 WeakPolarHBondContact O-CG 3.49Å; S8-R12 PolarHBondContact O-N 3.02Å
9	N	65.3	Low	67.5	Low	97 Å²	97	97.7 Å²	97.7	52%	0.519	50%	0.498	S	S	.	.	H	α-helix	trans	-77.2	-46.6	177.5	-73.9	-25.9	0	0	0	112	L5 F6 F7 R12 C13	L5-N9 PolarHBondContact O-N 2.77Å; L5-N9 VanDerWaalsContact O-N 3.17Å; F6-N9 PolarHBondContact O-N 3.38Å; F6-N9 VanDerWaalsContact O-N 3.17Å; F7-N9 VanDerWaalsContact C-N 3.35Å; F7-N9 PolarHBondContact O-N 3.1Å; N9-R12 WeakPolarHBondContact O-CB 3.37Å; N9-R12 PolarHBondContact O-N 2.96Å; N9-C13 PolarHBondContact O-N 2.85Å
10	E	69.3	Low	67.6	Low	99 Å²	99	97 Å²	97	46%	0.463	50%	0.496	S	S	.	.	H	α-helix	trans	-62.8	-44.4	176.8	-86.4	176.4	131.1	0	0	111.6	F6 R12 C13 F14	F6-E10 PolarHBondContact O-N 3.33Å; E10-R12 VanDerWaalsContact C-N 3.27Å; E10-R12 PolarHBondContact O-N 3.32Å; E10-C13 PolarHBondContact O-N 3.31Å; E10-C13 VanDerWaalsContact O-N 3.14Å; E10-F14 HydrophobicContact CB-CD2 4.38Å; E10-F14 HydrophobicContact CB-CE2 4.07Å; E10-F14 WeakPolarHBondContact O-CD2 3.29Å; E10-F14 WeakPolarHBondContact O-CG 3.39Å; E10-F14 PolarHBondContact O-N 3.43Å
11	S	74.9	Confident	67.6	Low	20 Å²	20	96.2 Å²	96.2	14%	0.14	51%	0.512	C	S	.	.	H	α-helix	trans	-60.8	-35.1	175.8	58.1	0	0	0	0	112.7	F7 S8 L15	F7-S11 WeakPolarHBondContact O-CB 3.37Å; F7-S11 PolarHBondContact O-N 3.17Å; F7-S11 PolarHBondContact O-OG 3.34Å; S8-S11 WeakPolarHBondContact CA-OG 3.16Å; S8-S11 PolarHBondContact O-OG 3.34Å; S8-S11 VanDerWaalsContact O-OG 3.13Å; S11-L15 VanDerWaalsContact O-CB 3.3Å; S11-L15 WeakPolarHBondContact O-CB 3.48Å; S11-L15 WeakPolarHBondContact O-CD1 3.25Å; S11-L15 VanDerWaalsContact O-CG 3.28Å; S11-L15 WeakPolarHBondContact O-CG 3.32Å; S11-L15 PolarHBondContact O-N 3.41Å
12	R	79	Confident	68.5	Low	179 Å²	179	90.9 Å²	90.9	68%	0.675	49%	0.488	S	S	*	.	H	α-helix	trans	-65.5	-44.3	172.6	-91.1	-177.3	175.3	-169.6	-1	112.8	S8 N9 E10 F14 L15 F16	S8-R12 WeakPolarHBondContact O-CB 3.45Å; S8-R12 WeakPolarHBondContact O-CG 3.49Å; S8-R12 PolarHBondContact O-N 3.02Å; N9-R12 WeakPolarHBondContact O-CB 3.37Å; N9-R12 PolarHBondContact O-N 2.96Å; E10-R12 VanDerWaalsContact C-N 3.27Å; E10-R12 PolarHBondContact O-N 3.32Å; R12-F14 VanDerWaalsContact C-N 3.34Å; R12-L15 PolarHBondContact O-N 2.85Å; R12-F16 PolarHBondContact O-N 3.41Å
13	C	77.7	Confident	69.5	Low	89 Å²	89	89.1 Å²	89.1	60%	0.601	48%	0.48	S	S	*	.	H	α-helix	trans	-61.8	-44.4	176.1	-70.9	0	0	0	0	111.1	N9 E10 F16 A17	N9-C13 PolarHBondContact O-N 2.85Å; E10-C13 PolarHBondContact O-N 3.31Å; E10-C13 VanDerWaalsContact O-N 3.14Å; C13-F16 PolarHBondContact O-N 2.71Å; C13-A17 WeakPolarHBondContact O-CB 3.35Å; C13-A17 PolarHBondContact O-N 2.91Å
14	F	81.1	Confident	70.2	Confident	69 Å²	69	93.3 Å²	93.3	30%	0.303	49%	0.489	S	S	.	.	H	α-helix	trans	-65.4	-40.1	175.6	-66.7	-53.6	0	0	0	112.4	E10 R12 F16 A17 A18 A29 A32 L33	E10-F14 HydrophobicContact CB-CD2 4.38Å; E10-F14 HydrophobicContact CB-CE2 4.07Å; E10-F14 WeakPolarHBondContact O-CD2 3.29Å; E10-F14 WeakPolarHBondContact O-CG 3.39Å; E10-F14 PolarHBondContact O-N 3.43Å; R12-F14 VanDerWaalsContact C-N 3.34Å; F14-F16 VanDerWaalsContact C-N 3.29Å; F14-F16 PolarHBondContact O-N 3.48Å; F14-A17 PolarHBondContact O-N 3.45Å; F14-A18 WeakPolarHBondContact O-CB 3.41Å; F14-A18 PolarHBondContact O-N 2.77Å; F14-A29 HydrophobicContact CB-CB 4.41Å; F14-A29 HydrophobicContact CD1-CB 4.16Å; F14-A32 HydrophobicContact CD1-CB 4.23Å; F14-A32 HydrophobicContact CE1-CB 4.12Å; F14-A32 HydrophobicContact CE2-CB 4.45Å; F14-A32 HydrophobicContact CG-CB 4.46Å; F14-A32 HydrophobicContact CZ-CB 4.24Å; F14-L33 HydrophobicContact CB-CD1 4.19Å; F14-L33 HydrophobicContact CB-CD2 3.89Å; F14-L33 HydrophobicContact CB-CG 3.82Å
15	L	82.1	Confident	71.1	Confident	57 Å²	57	87.5 Å²	87.5	30%	0.298	47%	0.473	S	S	.	.	H	α-helix	trans	-59.9	-40.7	174.2	-84.6	162.5	0	0	0	111.8	S11 R12 N19 L33 W51	S11-L15 VanDerWaalsContact O-CB 3.3Å; S11-L15 WeakPolarHBondContact O-CB 3.48Å; S11-L15 WeakPolarHBondContact O-CD1 3.25Å; S11-L15 VanDerWaalsContact O-CG 3.28Å; S11-L15 WeakPolarHBondContact O-CG 3.32Å; S11-L15 PolarHBondContact O-N 3.41Å; R12-L15 PolarHBondContact O-N 2.85Å; L15-N19 WeakPolarHBondContact O-CB 3.37Å; L15-N19 PolarHBondContact O-N 3Å; L15-N19 PolarHBondContact O-ND2 3.35Å; L15-L33 HydrophobicContact CD2-CD1 4.29Å; L15-L33 HydrophobicContact CG-CD1 4.34Å; L15-L33 HydrophobicContact CG-CD2 4.41Å; L15-W51 HydrophobicContact CD2-CH2 3.99Å; L15-W51 HydrophobicContact CD2-CZ2 3.62Å
16	F	83	Confident	72.7	Confident	144 Å²	144	82.1 Å²	82.1	63%	0.632	45%	0.445	S	S	*	.	H	α-helix	trans	-68	-45.1	177.2	-165.7	-95.4	0	0	0	111.4	R12 C13 F14 N19 N20	R12-F16 PolarHBondContact O-N 3.41Å; C13-F16 PolarHBondContact O-N 2.71Å; F14-F16 VanDerWaalsContact C-N 3.29Å; F14-F16 PolarHBondContact O-N 3.48Å; F16-N19 PolarHBondContact O-N 3.11Å; F16-N20 VanDerWaalsContact CE1-ND2 3.27Å; F16-N20 WeakPolarHBondContact CE1-ND2 3.17Å; F16-N20 PolarHBondContact O-N 3.26Å
17	A	81.9	Confident	74.3	Confident	31 Å²	31	77.2 Å²	77.2	26%	0.256	43%	0.425	S	S	.	.	H	α-helix	trans	-65.4	-39.4	177.8	0	0	0	0	0	112.9	C13 F14 N19 N20 A29	C13-A17 WeakPolarHBondContact O-CB 3.35Å; C13-A17 PolarHBondContact O-N 2.91Å; F14-A17 PolarHBondContact O-N 3.45Å; A17-N19 PolarHBondContact O-N 3.23Å; A17-N20 PolarHBondContact O-N 3.4Å; A17-A29 HydrophobicContact CB-CB 3.7Å
18	A	80.8	Confident	75.6	Confident	3 Å²	3	78.5 Å²	78.5	3%	0.025	44%	0.441	C	S	.	.	H	α-helix	trans	-70.3	-15	177.8	0	0	0	0	0	113.6	F14 C26 A29 Q30 L33 W51	F14-A18 WeakPolarHBondContact O-CB 3.41Å; F14-A18 PolarHBondContact O-N 2.77Å; A18-C26 PolarHBondContact O-SG 3.16Å; A18-A29 HydrophobicContact CB-CB 3.87Å; A18-Q30 HydrophobicContact CB-CG 3.72Å; A18-Q30 PolarHBondContact O-NE2 3.3Å; A18-L33 HydrophobicContact CB-CD1 3.81Å; A18-W51 HydrophobicContact CB-CH2 4.25Å; A18-W51 HydrophobicContact CB-CZ3 3.83Å
19	N	76.8	Confident	76.8	Confident	119 Å²	119	75.7 Å²	75.7	64%	0.636	42%	0.421	S	S	*	.	H	α-helix	trans	-104.7	-12.2	174.2	-74.2	-55.4	0	0	0	112.8	L15 F16 A17	L15-N19 WeakPolarHBondContact O-CB 3.37Å; L15-N19 PolarHBondContact O-N 3Å; L15-N19 PolarHBondContact O-ND2 3.35Å; F16-N19 PolarHBondContact O-N 3.11Å; A17-N19 PolarHBondContact O-N 3.23Å
20	N	70.8	Confident	78	Confident	84 Å²	84	71.7 Å²	71.7	45%	0.449	40%	0.399	S	S	.	.	S	Bend	trans	-81.3	130.7	174.4	-97	-1.5	0	0	0	110	F16 A17 D22 C26	F16-N20 VanDerWaalsContact CE1-ND2 3.27Å; F16-N20 WeakPolarHBondContact CE1-ND2 3.17Å; F16-N20 PolarHBondContact O-N 3.26Å; A17-N20 PolarHBondContact O-N 3.4Å; N20-D22 PolarHBondContact O-N 3.36Å; N20-C26 PolarHBondContact O-SG 3.34Å; N20-C26 VanDerWaalsContact O-SG 3.35Å
21	G	66.7	Low	78.9	Confident	80 Å²	80	67.2 Å²	67.2	83%	0.825	38%	0.379	S	S	*	.	S	Bend	trans	-67.9	11.2	-171	0	0	0	0	0	116.9	S23	G21-S23 PolarHBondContact O-N 2.96Å; G21-S23 VanDerWaalsContact O-N 3.13Å
22	D	69.9	Low	79.6	Confident	108 Å²	108	67.6 Å²	67.6	58%	0.578	38%	0.383	S	S	*	.			trans	-77.9	96.3	170.9	-168.4	-32	0	0	0	108.9	N20 K24 A25 C26	N20-D22 PolarHBondContact O-N 3.36Å; D22-K24 VanDerWaalsContact C-N 3.25Å; D22-K24 PolarHBondContact O-N 3.34Å; D22-A25 HydrophobicContact CB-CB 4.3Å; D22-A25 PolarHBondContact O-N 3.23Å; D22-A25 VanDerWaalsContact O-N 3.08Å; D22-C26 VanDerWaalsContact O-CB 3.22Å; D22-C26 WeakPolarHBondContact O-CB 3.38Å; D22-C26 PolarHBondContact O-N 3.11Å
23	S	70.9	Confident	80.1	Confident	72 Å²	72	59.1 Å²	59.1	50%	0.503	35%	0.351	S	S	.	.	H	α-helix	trans	-49.2	-39.5	-167	55.8	0	0	0	0	114.3	G21 C26 I27	G21-S23 PolarHBondContact O-N 2.96Å; G21-S23 VanDerWaalsContact O-N 3.13Å; S23-C26 WeakPolarHBondContact O-CB 3.46Å; S23-I27 VanDerWaalsContact O-CD1 3.24Å; S23-I27 WeakPolarHBondContact O-CD1 3.38Å; S23-I27 WeakPolarHBondContact O-CG1 3.24Å; S23-I27 PolarHBondContact O-N 2.95Å
24	K	69.2	Low	80.7	Confident	164 Å²	164	54.9 Å²	54.9	71%	0.713	32%	0.323	S	S	*	.	H	α-helix	trans	-73.3	-44.1	-179.8	-76	-173.5	178.2	180	0	113.2	D22 C26 S28	D22-K24 VanDerWaalsContact C-N 3.25Å; D22-K24 PolarHBondContact O-N 3.34Å; K24-C26 VanDerWaalsContact C-N 3.26Å; K24-S28 PolarHBondContact O-N 3.4Å; K24-S28 PolarHBondContact O-OG 3.45Å
25	A	71	Confident	81	Confident	50 Å²	50	56.3 Å²	56.3	41%	0.413	33%	0.327	S	S	.	.	H	α-helix	trans	-65.5	-37.3	175.8	0	0	0	0	0	110.5	D22 S28 A29	D22-A25 HydrophobicContact CB-CB 4.3Å; D22-A25 PolarHBondContact O-N 3.23Å; D22-A25 VanDerWaalsContact O-N 3.08Å; A25-S28 PolarHBondContact O-N 3.31Å; A25-A29 WeakPolarHBondContact O-CB 3.4Å; A25-A29 PolarHBondContact O-N 3.26Å; A25-A29 VanDerWaalsContact O-N 3.09Å
26	C	82.6	Confident	81.3	Confident	11 Å²	11	54.8 Å²	54.8	7%	0.074	32%	0.319	C	S	.	.	H	α-helix	trans	-60.3	-50.2	177	-147.2	0	0	0	0	111.5	A18 N20 D22 S23 K24 S28 A29 Q30	A18-C26 PolarHBondContact O-SG 3.16Å; N20-C26 PolarHBondContact O-SG 3.34Å; N20-C26 VanDerWaalsContact O-SG 3.35Å; D22-C26 VanDerWaalsContact O-CB 3.22Å; D22-C26 WeakPolarHBondContact O-CB 3.38Å; D22-C26 PolarHBondContact O-N 3.11Å; S23-C26 WeakPolarHBondContact O-CB 3.46Å; K24-C26 VanDerWaalsContact C-N 3.26Å; C26-S28 VanDerWaalsContact C-N 3.34Å; C26-S28 PolarHBondContact O-N 2.93Å; C26-A29 PolarHBondContact O-N 3.25Å; C26-Q30 WeakPolarHBondContact O-CB 3.36Å; C26-Q30 WeakPolarHBondContact O-CG 3.41Å; C26-Q30 PolarHBondContact O-N 3.23Å; C26-Q30 PolarHBondContact SG-NE2 2.88Å; C26-Q30 VanDerWaalsContact SG-NE2 3.41Å
27	I	86	Confident	81.6	Confident	31 Å²	31	49.3 Å²	49.3	16%	0.159	29%	0.294	C	S	.	.	H	α-helix	trans	-56.6	-46.5	178.4	-71.9	157.8	0	0	0	112	S23 Q30 T31 N58	S23-I27 VanDerWaalsContact O-CD1 3.24Å; S23-I27 WeakPolarHBondContact O-CD1 3.38Å; S23-I27 WeakPolarHBondContact O-CG1 3.24Å; S23-I27 PolarHBondContact O-N 2.95Å; I27-Q30 PolarHBondContact O-N 3.08Å; I27-T31 WeakPolarHBondContact O-CB 3.15Å; I27-T31 PolarHBondContact O-N 3.44Å; I27-T31 PolarHBondContact O-OG1 2.9Å; I27-N58 HydrophobicContact CD1-CB 4.06Å; I27-N58 WeakPolarHBondContact CD1-O 3.48Å; I27-N58 HydrophobicContact CG1-CB 3.46Å; I27-N58 VanDerWaalsContact CG1-CB 3.46Å
28	S	86	Confident	81.9	Confident	80 Å²	80	49.6 Å²	49.6	56%	0.559	29%	0.294	S	S	*	.	H	α-helix	trans	-65.8	-42.5	-177.1	-54.2	0	0	0	0	110.6	K24 A25 C26 T31 A32	K24-S28 PolarHBondContact O-N 3.4Å; K24-S28 PolarHBondContact O-OG 3.45Å; A25-S28 PolarHBondContact O-N 3.31Å; C26-S28 VanDerWaalsContact C-N 3.34Å; C26-S28 PolarHBondContact O-N 2.93Å; S28-T31 PolarHBondContact O-N 3.4Å; S28-A32 WeakPolarHBondContact O-CB 3.37Å; S28-A32 PolarHBondContact O-N 2.91Å
29	A	88.5	Confident	82.1	Confident	3 Å²	3	50.2 Å²	50.2	3%	0.025	30%	0.301	C	S	.	.	H	α-helix	trans	-67.1	-42.6	177.3	0	0	0	0	0	112.6	F14 A17 A18 A25 C26 A32 L33	F14-A29 HydrophobicContact CB-CB 4.41Å; F14-A29 HydrophobicContact CD1-CB 4.16Å; A17-A29 HydrophobicContact CB-CB 3.7Å; A18-A29 HydrophobicContact CB-CB 3.87Å; A25-A29 WeakPolarHBondContact O-CB 3.4Å; A25-A29 PolarHBondContact O-N 3.26Å; A25-A29 VanDerWaalsContact O-N 3.09Å; C26-A29 PolarHBondContact O-N 3.25Å; A29-A32 PolarHBondContact O-N 3.49Å; A29-L33 WeakPolarHBondContact O-CG 3.47Å; A29-L33 PolarHBondContact O-N 2.95Å
30	Q	88.9	Confident	82.5	Confident	12 Å²	12	50.8 Å²	50.8	6%	0.056	31%	0.311	C	S	.	.	H	α-helix	trans	-62.9	-42.9	175.7	-69.5	168.8	-9.5	0	0	111.2	A18 C26 I27 L33 G34 W51 D54 A55 N58	A18-Q30 HydrophobicContact CB-CG 3.72Å; A18-Q30 PolarHBondContact O-NE2 3.3Å; C26-Q30 WeakPolarHBondContact O-CB 3.36Å; C26-Q30 WeakPolarHBondContact O-CG 3.41Å; C26-Q30 PolarHBondContact O-N 3.23Å; C26-Q30 PolarHBondContact SG-NE2 2.88Å; C26-Q30 VanDerWaalsContact SG-NE2 3.41Å; I27-Q30 PolarHBondContact O-N 3.08Å; Q30-L33 PolarHBondContact O-N 3.2Å; Q30-G34 PolarHBondContact O-N 3.28Å; Q30-W51 HydrophobicContact CB-CE3 4.2Å; Q30-W51 HydrophobicContact CG-CE3 3.88Å; Q30-W51 HydrophobicContact CG-CZ3 4Å; Q30-D54 PolarHBondContact OE1-O 3.17Å; Q30-A55 HydrophobicContact CB-CB 3.72Å; Q30-N58 PolarHBondContact NE2-ND2 3.19Å; Q30-N58 PolarHBondContact OE1-ND2 2.99Å
31	T	89.7	Confident	83.1	Confident	5 Å²	5	52.1 Å²	52.1	3%	0.031	32%	0.315	C	S	.	.	H	α-helix	trans	-63.4	-43.7	176.4	-54.5	0	0	0	0	111	I27 S28 G34 Y35 S60 E62 S63	I27-T31 WeakPolarHBondContact O-CB 3.15Å; I27-T31 PolarHBondContact O-N 3.44Å; I27-T31 PolarHBondContact O-OG1 2.9Å; S28-T31 PolarHBondContact O-N 3.4Å; T31-G34 PolarHBondContact O-N 3.46Å; T31-Y35 HydrophobicContact CG2-CD2 4.15Å; T31-Y35 HydrophobicContact CG2-CE2 3.76Å; T31-Y35 VanDerWaalsContact O-CD2 3.29Å; T31-Y35 WeakPolarHBondContact O-CD2 3.36Å; T31-Y35 PolarHBondContact O-N 2.91Å; T31-Y35 VanDerWaalsContact O-N 3.11Å; T31-S60 PolarHBondContact OG1-OG 3.23Å; T31-S60 VanDerWaalsContact OG1-OG 3.08Å; T31-E62 HydrophobicContact CG2-CB 4.4Å; T31-E62 HydrophobicContact CG2-CG 4.24Å; T31-S63 PolarHBondContact OG1-OG 2.76Å
32	A	89.7	Confident	83.9	Confident	29 Å²	29	51.5 Å²	51.5	24%	0.24	29%	0.292	C	S	.	.	H	α-helix	trans	-62.7	-41.9	176.1	0	0	0	0	0	112.5	F14 S28 A29 G34 Y35 L36	F14-A32 HydrophobicContact CD1-CB 4.23Å; F14-A32 HydrophobicContact CE1-CB 4.12Å; F14-A32 HydrophobicContact CE2-CB 4.45Å; F14-A32 HydrophobicContact CG-CB 4.46Å; F14-A32 HydrophobicContact CZ-CB 4.24Å; S28-A32 WeakPolarHBondContact O-CB 3.37Å; S28-A32 PolarHBondContact O-N 2.91Å; A29-A32 PolarHBondContact O-N 3.49Å; A32-G34 VanDerWaalsContact C-N 3.34Å; A32-Y35 PolarHBondContact O-N 3.28Å; A32-L36 WeakPolarHBondContact O-CB 3.49Å; A32-L36 PolarHBondContact O-N 2.84Å
33	L	89.6	Confident	84.7	Confident	0 Å²	0	50.2 Å²	50.2	0%	0	29%	0.291	C	S	.	.	H	α-helix	trans	-62.5	-41.4	173.8	-74.1	168.7	0	0	0	111.4	F14 L15 A18 A29 Q30 Y35 L36 Y37 W51	F14-L33 HydrophobicContact CB-CD1 4.19Å; F14-L33 HydrophobicContact CB-CD2 3.89Å; F14-L33 HydrophobicContact CB-CG 3.82Å; L15-L33 HydrophobicContact CD2-CD1 4.29Å; L15-L33 HydrophobicContact CG-CD1 4.34Å; L15-L33 HydrophobicContact CG-CD2 4.41Å; A18-L33 HydrophobicContact CB-CD1 3.81Å; A29-L33 WeakPolarHBondContact O-CG 3.47Å; A29-L33 PolarHBondContact O-N 2.95Å; Q30-L33 PolarHBondContact O-N 3.2Å; L33-Y35 VanDerWaalsContact C-N 3.32Å; L33-Y35 PolarHBondContact O-N 3.12Å; L33-L36 HydrophobicContact CD2-CD2 4.28Å; L33-L36 WeakPolarHBondContact O-CB 3.36Å; L33-L36 PolarHBondContact O-N 2.89Å; L33-L36 VanDerWaalsContact O-N 3.16Å; L33-Y37 HydrophobicContact CB-CD2 4.43Å; L33-Y37 HydrophobicContact CD2-CE2 4.24Å; L33-Y37 WeakPolarHBondContact O-CD2 3.13Å; L33-Y37 PolarHBondContact O-N 3.42Å; L33-W51 HydrophobicContact CB-CB 4.29Å; L33-W51 HydrophobicContact CB-CD2 3.91Å; L33-W51 HydrophobicContact CB-CE3 4.5Å; L33-W51 HydrophobicContact CB-CG 3.79Å; L33-W51 HydrophobicContact CD1-CD2 3.92Å; L33-W51 HydrophobicContact CD1-CE3 4.01Å; L33-W51 HydrophobicContact CD1-CH2 3.86Å; L33-W51 HydrophobicContact CD1-CZ2 3.77Å; L33-W51 HydrophobicContact CD1-CZ3 3.98Å
34	G	89.1	Confident	85.5	Confident	0 Å²	0	49.3 Å²	49.3	0%	0	28%	0.28	C	S	.	.	H	α-helix	trans	-52.8	-49.6	173.4	0	0	0	0	0	112.1	Q30 T31 A32 Y37 S38 A48 H52	Q30-G34 PolarHBondContact O-N 3.28Å; T31-G34 PolarHBondContact O-N 3.46Å; A32-G34 VanDerWaalsContact C-N 3.34Å; G34-Y37 PolarHBondContact O-N 3.39Å; G34-S38 WeakPolarHBondContact O-CB 3.42Å; G34-S38 PolarHBondContact O-N 3Å; G34-A48 WeakPolarHBondContact O-CB 3.32Å; G34-H52 VanDerWaalsContact C-NE2 3.29Å; G34-H52 WeakPolarHBondContact CA-NE2 3.48Å
35	Y	88.8	Confident	86.4	Confident	99 Å²	99	46.3 Å²	46.3	39%	0.388	27%	0.271	S	S	.	.	H	α-helix	trans	-63.4	-43.6	175.2	-75.5	-60.1	0	0	0	113.1	T31 A32 L33 Y37 S38 G39 E62 F66	T31-Y35 HydrophobicContact CG2-CD2 4.15Å; T31-Y35 HydrophobicContact CG2-CE2 3.76Å; T31-Y35 VanDerWaalsContact O-CD2 3.29Å; T31-Y35 WeakPolarHBondContact O-CD2 3.36Å; T31-Y35 PolarHBondContact O-N 2.91Å; T31-Y35 VanDerWaalsContact O-N 3.11Å; A32-Y35 PolarHBondContact O-N 3.28Å; L33-Y35 VanDerWaalsContact C-N 3.32Å; L33-Y35 PolarHBondContact O-N 3.12Å; Y35-Y37 VanDerWaalsContact C-N 3.31Å; Y35-Y37 PolarHBondContact O-N 2.83Å; Y35-S38 WeakPolarHBondContact CA-OG 3.07Å; Y35-S38 CarbonylContact O-C 3.58Å; Y35-S38 PolarHBondContact O-N 3.35Å; Y35-S38 VanDerWaalsContact O-N 3.1Å; Y35-S38 PolarHBondContact O-OG 3.33Å; Y35-G39 PolarHBondContact O-N 3.04Å; Y35-E62 HydrophobicContact CE2-CG 4.39Å; Y35-E62 WeakPolarHBondContact OH-CG 3.44Å; Y35-E62 PolarHBondContact OH-OE1 3.06Å; Y35-F66 HydrophobicContact CE1-CD2 4.46Å
36	L	88.5	Confident	87.3	Confident	25 Å²	25	51.9 Å²	51.9	13%	0.131	29%	0.289	C	S	.	.	H	α-helix	trans	-56	-46.8	179.1	-162.2	87.3	0	0	0	111.6	F7 A32 L33 G39 I42	F7-L36 HydrophobicContact CD1-CD1 3.76Å; F7-L36 HydrophobicContact CD1-CD2 4.1Å; F7-L36 HydrophobicContact CD1-CG 4Å; F7-L36 HydrophobicContact CD2-CD1 4.44Å; F7-L36 HydrophobicContact CE1-CD1 3.16Å; F7-L36 HydrophobicContact CE1-CD2 3.92Å; F7-L36 HydrophobicContact CE1-CG 3.33Å; F7-L36 HydrophobicContact CE2-CD1 3.9Å; F7-L36 HydrophobicContact CG-CD1 4.38Å; F7-L36 HydrophobicContact CZ-CD1 3.23Å; F7-L36 HydrophobicContact CZ-CG 3.84Å; A32-L36 WeakPolarHBondContact O-CB 3.49Å; A32-L36 PolarHBondContact O-N 2.84Å; L33-L36 HydrophobicContact CD2-CD2 4.28Å; L33-L36 WeakPolarHBondContact O-CB 3.36Å; L33-L36 PolarHBondContact O-N 2.89Å; L33-L36 VanDerWaalsContact O-N 3.16Å; L36-G39 PolarHBondContact O-N 2.98Å; L36-I42 HydrophobicContact CD2-CD1 3.78Å; L36-I42 HydrophobicContact CG-CD1 3.95Å
37	Y	88.1	Confident	87.5	Confident	30 Å²	30	56 Å²	56	12%	0.118	31%	0.305	C	S	.	.	H	α-helix	trans	-73.1	-27.1	178.7	-77.8	-69.5	0	0	0	112.7	L33 G34 Y35 G39 I42 C43 D44 K47 W51	L33-Y37 HydrophobicContact CB-CD2 4.43Å; L33-Y37 HydrophobicContact CD2-CE2 4.24Å; L33-Y37 WeakPolarHBondContact O-CD2 3.13Å; L33-Y37 PolarHBondContact O-N 3.42Å; G34-Y37 PolarHBondContact O-N 3.39Å; Y35-Y37 VanDerWaalsContact C-N 3.31Å; Y35-Y37 PolarHBondContact O-N 2.83Å; Y37-G39 VanDerWaalsContact C-N 3.3Å; Y37-I42 HydrophobicContact CD1-CB 4.34Å; Y37-I42 HydrophobicContact CD1-CD1 4.26Å; Y37-I42 HydrophobicContact CD1-CG2 3.52Å; Y37-I42 HydrophobicContact CE1-CD1 4.25Å; Y37-I42 HydrophobicContact CE1-CG2 3.83Å; Y37-C43 CarbonylContact O-C 3.5Å; Y37-C43 WeakPolarHBondContact O-CA 3.4Å; Y37-C43 PolarHBondContact O-N 3.3Å; Y37-D44 HydrophobicContact CD1-CB 3.99Å; Y37-D44 PolarHBondContact O-N 2.94Å; Y37-K47 HydrophobicContact CD1-CB 3.86Å; Y37-K47 HydrophobicContact CD1-CD 3.91Å; Y37-K47 HydrophobicContact CD2-CB 4.2Å; Y37-K47 HydrophobicContact CE1-CB 4.28Å; Y37-K47 HydrophobicContact CE1-CD 3.47Å; Y37-K47 VanDerWaalsContact CE1-CD 3.47Å; Y37-K47 HydrophobicContact CE2-CD 4.28Å; Y37-K47 HydrophobicContact CG-CB 3.84Å; Y37-K47 HydrophobicContact CG-CD 4.49Å; Y37-W51 AromaticContact CD2-CD1 3.39Å; Y37-W51 AromaticContact CD2-NE1 3.59Å; Y37-W51 AromaticContact CE2-CD1 3.61Å; Y37-W51 AromaticContact CE2-NE1 3.25Å; Y37-W51 VanDerWaalsContact CE2-NE1 3.25Å
38	S	87.9	Confident	87.7	Confident	36 Å²	36	54.6 Å²	54.6	25%	0.252	30%	0.298	S	S	.	.	H	α-helix	trans	-77.2	-16.3	172.7	79.6	0	0	0	0	113.8	G34 Y35	G34-S38 WeakPolarHBondContact O-CB 3.42Å; G34-S38 PolarHBondContact O-N 3Å; Y35-S38 WeakPolarHBondContact CA-OG 3.07Å; Y35-S38 CarbonylContact O-C 3.58Å; Y35-S38 PolarHBondContact O-N 3.35Å; Y35-S38 VanDerWaalsContact O-N 3.1Å; Y35-S38 PolarHBondContact O-OG 3.33Å
39	G	85.9	Confident	87.8	Confident	16 Å²	16	54.2 Å²	54.2	17%	0.165	29%	0.287	C	S	.	.	S	Bend	trans	-73.5	161	-175.3	0	0	0	0	0	113.5	Y35 L36 Y37 E41 I42 C43	Y35-G39 PolarHBondContact O-N 3.04Å; L36-G39 PolarHBondContact O-N 2.98Å; Y37-G39 VanDerWaalsContact C-N 3.3Å; G39-E41 PolarHBondContact O-N 3.17Å; G39-E41 VanDerWaalsContact O-N 3.12Å; G39-I42 PolarHBondContact O-N 3.17Å; G39-C43 WeakPolarHBondContact O-CA 3.48Å; G39-C43 PolarHBondContact O-N 3.48Å
40	P	85.1	Confident	87.9	Confident	132 Å²	132	59.1 Å²	59.1	86%	0.857	31%	0.309	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.4	-17	-175.1	26.8	-35.3	0	0	0	114.3
41	E	82.8	Confident	88	Confident	111 Å²	111	60.1 Å²	60.1	52%	0.519	31%	0.312	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.4	-34.4	179.3	-71.9	-161	178	0	0	113.9	F7 G39	F7-E41 WeakPolarHBondContact CD2-OE2 3.45Å; F7-E41 HydrophobicContact CE1-CB 4.29Å; F7-E41 WeakPolarHBondContact CE2-OE2 3.43Å; F7-E41 HydrophobicContact CZ-CB 4.27Å; G39-E41 PolarHBondContact O-N 3.17Å; G39-E41 VanDerWaalsContact O-N 3.12Å
42	I	83.6	Confident	88.1	Confident	67 Å²	67	59.9 Å²	59.9	34%	0.344	31%	0.311	S	S	.	.	T	Hydrogen-bonded Turn	trans	-110.9	-45	-178.5	-54.2	178.6	0	0	0	111	F7 L36 Y37 G39 D44	F7-I42 HydrophobicContact CD1-CD1 3.99Å; F7-I42 HydrophobicContact CD1-CG1 4.38Å; F7-I42 HydrophobicContact CE1-CD1 3.71Å; F7-I42 HydrophobicContact CE1-CG1 3.96Å; L36-I42 HydrophobicContact CD2-CD1 3.78Å; L36-I42 HydrophobicContact CG-CD1 3.95Å; Y37-I42 HydrophobicContact CD1-CB 4.34Å; Y37-I42 HydrophobicContact CD1-CD1 4.26Å; Y37-I42 HydrophobicContact CD1-CG2 3.52Å; Y37-I42 HydrophobicContact CE1-CD1 4.25Å; Y37-I42 HydrophobicContact CE1-CG2 3.83Å; G39-I42 PolarHBondContact O-N 3.17Å; I42-D44 VanDerWaalsContact C-N 3.32Å; I42-D44 HydrophobicContact CG2-CB 4.17Å; I42-D44 PolarHBondContact O-N 3.31Å
43	C	86	Confident	88	Confident	82 Å²	82	60.1 Å²	60.1	55%	0.554	31%	0.311	S	S	*	.			trans	44.6	51	178	-151.3	0	0	0	0	113.9	Y37 G39	Y37-C43 CarbonylContact O-C 3.5Å; Y37-C43 WeakPolarHBondContact O-CA 3.4Å; Y37-C43 PolarHBondContact O-N 3.3Å; G39-C43 WeakPolarHBondContact O-CA 3.48Å; G39-C43 PolarHBondContact O-N 3.48Å
44	D	89	Confident	87.9	Confident	53 Å²	53	63 Å²	63	28%	0.283	33%	0.326	S	S	.	.			trans	-107.1	86	172.7	-176	-17.5	0	0	0	108.3	Y37 I42 Q46 K47 A48	Y37-D44 HydrophobicContact CD1-CB 3.99Å; Y37-D44 PolarHBondContact O-N 2.94Å; I42-D44 VanDerWaalsContact C-N 3.32Å; I42-D44 HydrophobicContact CG2-CB 4.17Å; I42-D44 PolarHBondContact O-N 3.31Å; D44-Q46 PolarHBondContact O-N 3.18Å; D44-Q46 PolarHBondContact OD1-N 3.14Å; D44-K47 HydrophobicContact CB-CB 4.25Å; D44-K47 PolarHBondContact O-N 2.89Å; D44-K47 PolarHBondContact OD1-N 3.32Å; D44-K47 WeakPolarHBondContact OD2-CD 3.14Å; D44-K47 WeakPolarHBondContact OD2-CG 3.41Å; D44-A48 WeakPolarHBondContact O-CB 3.38Å; D44-A48 PolarHBondContact O-N 3.15Å
45	L	87.7	Confident	87.9	Confident	101 Å²	101	63 Å²	63	53%	0.529	33%	0.326	S	S	.	.	H	α-helix	trans	-63.9	-27.9	-175.7	-62.8	179.1	0	0	0	112.6	A48 F49	L45-A48 PolarHBondContact O-N 3.47Å; L45-F49 WeakPolarHBondContact O-CB 3.36Å; L45-F49 PolarHBondContact O-N 2.86Å
46	Q	89.2	Confident	87.9	Confident	167 Å²	167	59.8 Å²	59.8	78%	0.78	32%	0.317	S	S	*	.	H	α-helix	trans	-69.5	-46.5	177.8	-169.2	177.1	12.6	0	0	110.5	D44 F49 Q50	D44-Q46 PolarHBondContact O-N 3.18Å; D44-Q46 PolarHBondContact OD1-N 3.14Å; Q46-F49 PolarHBondContact O-N 3.26Å; Q46-Q50 PolarHBondContact O-N 3.44Å
47	K	87.6	Confident	87.7	Confident	98 Å²	98	62 Å²	62	43%	0.426	35%	0.346	S	S	.	.	H	α-helix	trans	-64.8	-40	172.1	-84.9	-170.5	-175.5	176.5	0	112.7	Y37 D44 F49 Q50 W51	Y37-K47 HydrophobicContact CD1-CB 3.86Å; Y37-K47 HydrophobicContact CD1-CD 3.91Å; Y37-K47 HydrophobicContact CD2-CB 4.2Å; Y37-K47 HydrophobicContact CE1-CB 4.28Å; Y37-K47 HydrophobicContact CE1-CD 3.47Å; Y37-K47 VanDerWaalsContact CE1-CD 3.47Å; Y37-K47 HydrophobicContact CE2-CD 4.28Å; Y37-K47 HydrophobicContact CG-CB 3.84Å; Y37-K47 HydrophobicContact CG-CD 4.49Å; D44-K47 HydrophobicContact CB-CB 4.25Å; D44-K47 PolarHBondContact O-N 2.89Å; D44-K47 PolarHBondContact OD1-N 3.32Å; D44-K47 WeakPolarHBondContact OD2-CD 3.14Å; D44-K47 WeakPolarHBondContact OD2-CG 3.41Å; K47-F49 VanDerWaalsContact C-N 3.29Å; K47-F49 PolarHBondContact O-N 2.63Å; K47-Q50 PolarHBondContact O-N 3.13Å; K47-W51 PolarHBondContact O-N 2.91Å
48	A	89.3	Confident	87.5	Confident	0 Å²	0	64.3 Å²	64.3	0%	0	36%	0.361	C	S	.	.	H	α-helix	trans	-57.2	-46.5	176.5	0	0	0	0	0	110.8	G34 D44 L45 Q50 W51 H52	G34-A48 WeakPolarHBondContact O-CB 3.32Å; D44-A48 WeakPolarHBondContact O-CB 3.38Å; D44-A48 PolarHBondContact O-N 3.15Å; L45-A48 PolarHBondContact O-N 3.47Å; A48-Q50 VanDerWaalsContact C-N 3.35Å; A48-Q50 PolarHBondContact O-N 2.91Å; A48-W51 PolarHBondContact O-N 3.45Å; A48-H52 PolarHBondContact O-CD2 2.98Å; A48-H52 PolarHBondContact O-N 2.88Å
49	F	89.6	Confident	87.3	Confident	73 Å²	73	65.1 Å²	65.1	32%	0.32	38%	0.375	S	S	.	.	H	α-helix	trans	-62.1	-40.8	176.8	-172.8	-90.9	0	0	0	112.6	L45 Q46 K47 S53 I67 H70	L45-F49 WeakPolarHBondContact O-CB 3.36Å; L45-F49 PolarHBondContact O-N 2.86Å; Q46-F49 PolarHBondContact O-N 3.26Å; K47-F49 VanDerWaalsContact C-N 3.29Å; K47-F49 PolarHBondContact O-N 2.63Å; F49-S53 WeakPolarHBondContact CE1-OG 3.45Å; F49-S53 VanDerWaalsContact O-CB 3.32Å; F49-S53 WeakPolarHBondContact O-CB 3.09Å; F49-S53 PolarHBondContact O-N 3.09Å; F49-S53 PolarHBondContact O-OG 3.36Å; F49-I67 HydrophobicContact CE2-CB 4.42Å; F49-I67 HydrophobicContact CE2-CG1 4.44Å; F49-I67 HydrophobicContact CE2-CG2 3.83Å; F49-I67 HydrophobicContact CZ-CG2 3.98Å; F49-H70 HydrophobicContact CD2-CB 4.47Å
50	Q	90.3	Very high	87.2	Confident	105 Å²	105	64.8 Å²	64.8	49%	0.491	37%	0.37	S	S	.	.	H	α-helix	trans	-62.1	-50	176.8	-171.3	63.5	51.1	0	0	111.4	Q46 K47 A48 H52 S53 D54	Q46-Q50 PolarHBondContact O-N 3.44Å; K47-Q50 PolarHBondContact O-N 3.13Å; A48-Q50 VanDerWaalsContact C-N 3.35Å; A48-Q50 PolarHBondContact O-N 2.91Å; Q50-H52 PolarHBondContact O-N 2.99Å; Q50-S53 WeakPolarHBondContact O-CA 3.37Å; Q50-S53 WeakPolarHBondContact O-CB 3.48Å; Q50-S53 PolarHBondContact O-N 3.2Å; Q50-D54 PolarHBondContact NE2-OD1 3.35Å; Q50-D54 VanDerWaalsContact NE2-OD1 3.13Å; Q50-D54 PolarHBondContact O-N 3.28Å
51	W	90.5	Very high	87.2	Confident	34 Å²	34	63.9 Å²	63.9	13%	0.129	36%	0.361	C	S	.	.	H	α-helix	trans	-63.1	-41.6	-180	-77.5	117.1	0	0	0	112.9	L15 A18 Q30 L33 Y37 K47 A48 S53 D54 A55	L15-W51 HydrophobicContact CD2-CH2 3.99Å; L15-W51 HydrophobicContact CD2-CZ2 3.62Å; A18-W51 HydrophobicContact CB-CH2 4.25Å; A18-W51 HydrophobicContact CB-CZ3 3.83Å; Q30-W51 HydrophobicContact CB-CE3 4.2Å; Q30-W51 HydrophobicContact CG-CE3 3.88Å; Q30-W51 HydrophobicContact CG-CZ3 4Å; L33-W51 HydrophobicContact CB-CB 4.29Å; L33-W51 HydrophobicContact CB-CD2 3.91Å; L33-W51 HydrophobicContact CB-CE3 4.5Å; L33-W51 HydrophobicContact CB-CG 3.79Å; L33-W51 HydrophobicContact CD1-CD2 3.92Å; L33-W51 HydrophobicContact CD1-CE3 4.01Å; L33-W51 HydrophobicContact CD1-CH2 3.86Å; L33-W51 HydrophobicContact CD1-CZ2 3.77Å; L33-W51 HydrophobicContact CD1-CZ3 3.98Å; Y37-W51 AromaticContact CD2-CD1 3.39Å; Y37-W51 AromaticContact CD2-NE1 3.59Å; Y37-W51 AromaticContact CE2-CD1 3.61Å; Y37-W51 AromaticContact CE2-NE1 3.25Å; Y37-W51 VanDerWaalsContact CE2-NE1 3.25Å; K47-W51 PolarHBondContact O-N 2.91Å; A48-W51 PolarHBondContact O-N 3.45Å; W51-S53 VanDerWaalsContact C-N 3.31Å; W51-S53 PolarHBondContact O-N 2.79Å; W51-D54 PolarHBondContact O-N 2.89Å; W51-A55 WeakPolarHBondContact O-CB 3.48Å; W51-A55 PolarHBondContact O-N 3.34Å
52	H	90.8	Very high	87.3	Confident	0 Å²	0	64.2 Å²	64.2	0%	0	36%	0.363	C	S	.	.	H	α-helix	trans	-63.6	-38.6	172.9	-77.1	-58.9	0	0	0	111.4	G34 A48 Q50 A55 C56 S63 F66 I67	G34-H52 VanDerWaalsContact C-NE2 3.29Å; G34-H52 WeakPolarHBondContact CA-NE2 3.48Å; A48-H52 PolarHBondContact O-CD2 2.98Å; A48-H52 PolarHBondContact O-N 2.88Å; Q50-H52 PolarHBondContact O-N 2.99Å; H52-A55 PolarHBondContact O-N 3.42Å; H52-C56 WeakPolarHBondContact O-CB 3.47Å; H52-C56 PolarHBondContact O-N 3.49Å; H52-S63 WeakPolarHBondContact ND1-CB 3.41Å; H52-S63 PolarHBondContact ND1-OG 3.25Å; H52-S63 WeakPolarHBondContact O-CB 3.19Å; H52-F66 HydrophobicContact CB-CD1 4.39Å; H52-F66 AromaticContact CD2-CD1 3.24Å; H52-F66 WeakPolarHBondContact CD2-CD1 3.43Å; H52-F66 AromaticContact CD2-CE1 3.62Å; H52-F66 AromaticContact CD2-CG 3.51Å; H52-F66 AromaticContact CG-CD1 3.89Å; H52-F66 AromaticContact NE2-CD1 3.76Å; H52-F66 AromaticContact NE2-CD2 3.69Å; H52-F66 AromaticContact NE2-CE2 3.99Å; H52-F66 AromaticContact NE2-CG 3.57Å; H52-I67 HydrophobicContact CB-CD1 4.33Å; H52-I67 HydrophobicContact CB-CG1 3.93Å; H52-I67 WeakPolarHBondContact O-CD1 3.45Å
53	S	88.2	Confident	87.4	Confident	34 Å²	34	61 Å²	61	24%	0.238	35%	0.347	C	S	.	.	H	α-helix	trans	-61.5	-44.2	176.7	-66.1	0	0	0	0	112.3	F49 Q50 W51 C56 G57 I67	F49-S53 WeakPolarHBondContact CE1-OG 3.45Å; F49-S53 VanDerWaalsContact O-CB 3.32Å; F49-S53 WeakPolarHBondContact O-CB 3.09Å; F49-S53 PolarHBondContact O-N 3.09Å; F49-S53 PolarHBondContact O-OG 3.36Å; Q50-S53 WeakPolarHBondContact O-CA 3.37Å; Q50-S53 WeakPolarHBondContact O-CB 3.48Å; Q50-S53 PolarHBondContact O-N 3.2Å; W51-S53 VanDerWaalsContact C-N 3.31Å; W51-S53 PolarHBondContact O-N 2.79Å; S53-C56 WeakPolarHBondContact O-CB 3.47Å; S53-C56 PolarHBondContact O-N 3.11Å; S53-G57 PolarHBondContact O-N 2.93Å; S53-I67 VanDerWaalsContact CA-CD1 3.46Å
54	D	88.9	Confident	87.3	Confident	61 Å²	61	61.5 Å²	61.5	33%	0.326	34%	0.341	S	S	.	.	H	α-helix	trans	-65.2	-43.9	176.9	-62.4	-14.2	0	0	0	110.7	Q30 Q50 W51 C56 G57 N58	Q30-D54 PolarHBondContact OE1-O 3.17Å; Q50-D54 PolarHBondContact NE2-OD1 3.35Å; Q50-D54 VanDerWaalsContact NE2-OD1 3.13Å; Q50-D54 PolarHBondContact O-N 3.28Å; W51-D54 PolarHBondContact O-N 2.89Å; D54-C56 VanDerWaalsContact C-N 3.32Å; D54-C56 PolarHBondContact O-N 3.3Å; D54-G57 PolarHBondContact O-N 3.39Å; D54-N58 PolarHBondContact O-N 3.33Å; D54-N58 VanDerWaalsContact O-N 3.11Å; D54-N58 PolarHBondContact O-ND2 3.2Å; D54-N58 VanDerWaalsContact O-ND2 3.15Å
55	A	88.7	Confident	87	Confident	0 Å²	0	61.1 Å²	61.1	0%	0	35%	0.349	C	S	.	.	H	α-helix	trans	-60.6	-41.6	175.5	0	0	0	0	0	112.3	Q30 W51 H52 N58 G59 S60 S63	Q30-A55 HydrophobicContact CB-CB 3.72Å; W51-A55 WeakPolarHBondContact O-CB 3.48Å; W51-A55 PolarHBondContact O-N 3.34Å; H52-A55 PolarHBondContact O-N 3.42Å; A55-N58 CarbonylContact O-C 3.51Å; A55-N58 PolarHBondContact O-N 3.15Å; A55-G59 PolarHBondContact O-N 3.06Å; A55-S60 VanDerWaalsContact C-CB 3.46Å; A55-S60 WeakPolarHBondContact O-CB 3.28Å; A55-S60 PolarHBondContact O-N 3.06Å; A55-S63 WeakPolarHBondContact CB-OG 3.08Å
56	C	87.7	Confident	86.7	Confident	30 Å²	30	58.1 Å²	58.1	20%	0.203	33%	0.332	C	S	.	.	H	α-helix	trans	-65.5	-42.9	178.7	-173.6	0	0	0	0	111.4	H52 S53 D54 N58 G59 Q64 I67	H52-C56 WeakPolarHBondContact O-CB 3.47Å; H52-C56 PolarHBondContact O-N 3.49Å; S53-C56 WeakPolarHBondContact O-CB 3.47Å; S53-C56 PolarHBondContact O-N 3.11Å; D54-C56 VanDerWaalsContact C-N 3.32Å; D54-C56 PolarHBondContact O-N 3.3Å; C56-N58 PolarHBondContact O-N 2.94Å; C56-G59 PolarHBondContact O-N 3.13Å; C56-Q64 WeakPolarHBondContact SG-CG 3.24Å; C56-I67 HydrophobicContact CB-CD1 3.46Å; C56-I67 VanDerWaalsContact CB-CD1 3.46Å
57	G	84.4	Confident	86.2	Confident	71 Å²	71	51 Å²	51	73%	0.732	30%	0.299	S	S	*	.	H	α-helix	trans	-59.5	-30	172.3	0	0	0	0	0	113	S53 D54	S53-G57 PolarHBondContact O-N 2.93Å; D54-G57 PolarHBondContact O-N 3.39Å
58	N	84.1	Confident	85.8	Confident	80 Å²	80	50.5 Å²	50.5	43%	0.428	30%	0.304	S	S	.	.	T	Hydrogen-bonded Turn	trans	-87.1	1.1	174.9	-67.6	-39.3	0	0	0	114.2	I27 Q30 D54 A55 C56	I27-N58 HydrophobicContact CD1-CB 4.06Å; I27-N58 WeakPolarHBondContact CD1-O 3.48Å; I27-N58 HydrophobicContact CG1-CB 3.46Å; I27-N58 VanDerWaalsContact CG1-CB 3.46Å; Q30-N58 PolarHBondContact NE2-ND2 3.19Å; Q30-N58 PolarHBondContact OE1-ND2 2.99Å; D54-N58 PolarHBondContact O-N 3.33Å; D54-N58 VanDerWaalsContact O-N 3.11Å; D54-N58 PolarHBondContact O-ND2 3.2Å; D54-N58 VanDerWaalsContact O-ND2 3.15Å; A55-N58 CarbonylContact O-C 3.51Å; A55-N58 PolarHBondContact O-N 3.15Å; C56-N58 PolarHBondContact O-N 2.94Å
59	G	83.1	Confident	85.1	Confident	53 Å²	53	58.5 Å²	58.5	55%	0.546	34%	0.339	S	S	.	.	T	Hydrogen-bonded Turn	trans	101.1	16.1	175.4	0	0	0	0	0	115.9	A55 C56 V61	A55-G59 PolarHBondContact O-N 3.06Å; C56-G59 PolarHBondContact O-N 3.13Å; G59-V61 PolarHBondContact O-N 3.29Å
60	S	84.1	Confident	84.2	Confident	8 Å²	8	58.1 Å²	58.1	6%	0.056	34%	0.338	C	S	.	.			trans	-71.4	107.6	174.4	-172.4	0	0	0	0	112.2	T31 A55 E62 S63 Q64	T31-S60 PolarHBondContact OG1-OG 3.23Å; T31-S60 VanDerWaalsContact OG1-OG 3.08Å; A55-S60 VanDerWaalsContact C-CB 3.46Å; A55-S60 WeakPolarHBondContact O-CB 3.28Å; A55-S60 PolarHBondContact O-N 3.06Å; S60-E62 VanDerWaalsContact C-N 3.31Å; S60-S63 PolarHBondContact OG-N 2.86Å; S60-S63 PolarHBondContact OG-OG 2.94Å; S60-Q64 PolarHBondContact O-N 2.78Å; S60-Q64 VanDerWaalsContact O-N 3.12Å
61	V	85.2	Confident	82.9	Confident	113 Å²	113	62.2 Å²	62.2	69%	0.685	35%	0.349	S	S	*	.	H	α-helix	trans	-66.8	-33.6	173.4	-178.6	0	0	0	0	111.6	G59 Q64 G65	G59-V61 PolarHBondContact O-N 3.29Å; V61-Q64 WeakPolarHBondContact O-CB 3.3Å; V61-Q64 PolarHBondContact O-N 2.98Å; V61-G65 PolarHBondContact O-N 3.35Å
62	E	86.1	Confident	81.2	Confident	118 Å²	118	67.3 Å²	67.3	55%	0.551	38%	0.378	S	S	*	.	H	α-helix	trans	-65.6	-45.2	178.3	-172.2	172.8	-161.2	0	0	111.1	T31 Y35 S60 Q64 G65 F66	T31-E62 HydrophobicContact CG2-CB 4.4Å; T31-E62 HydrophobicContact CG2-CG 4.24Å; Y35-E62 HydrophobicContact CE2-CG 4.39Å; Y35-E62 WeakPolarHBondContact OH-CG 3.44Å; Y35-E62 PolarHBondContact OH-OE1 3.06Å; S60-E62 VanDerWaalsContact C-N 3.31Å; E62-Q64 VanDerWaalsContact C-N 3.31Å; E62-Q64 PolarHBondContact O-N 3.25Å; E62-G65 PolarHBondContact O-N 2.83Å; E62-G65 VanDerWaalsContact O-N 3.17Å; E62-F66 PolarHBondContact O-N 3.08Å
63	S	85.2	Confident	79.5	Confident	0 Å²	0	71.6 Å²	71.6	0%	0	41%	0.407	C	S	.	.	H	α-helix	trans	-69.7	-27.6	176.8	-65.5	0	0	0	0	112.8	T31 H52 A55 S60 G65 F66 I67	T31-S63 PolarHBondContact OG1-OG 2.76Å; H52-S63 WeakPolarHBondContact ND1-CB 3.41Å; H52-S63 PolarHBondContact ND1-OG 3.25Å; H52-S63 WeakPolarHBondContact O-CB 3.19Å; A55-S63 WeakPolarHBondContact CB-OG 3.08Å; S60-S63 PolarHBondContact OG-N 2.86Å; S60-S63 PolarHBondContact OG-OG 2.94Å; S63-G65 VanDerWaalsContact C-N 3.28Å; S63-G65 PolarHBondContact O-N 2.94Å; S63-F66 PolarHBondContact O-N 3.46Å; S63-I67 WeakPolarHBondContact O-CG1 3.13Å; S63-I67 PolarHBondContact O-N 3.42Å
64	Q	83.8	Confident	77.5	Confident	93 Å²	93	81.4 Å²	81.4	44%	0.435	45%	0.446	S	S	.	.	H	α-helix	trans	-56.7	-43.1	169.5	-85.8	-178.1	-14.1	0	0	111.8	C56 S60 V61 E62 F66 T68	C56-Q64 WeakPolarHBondContact SG-CG 3.24Å; S60-Q64 PolarHBondContact O-N 2.78Å; S60-Q64 VanDerWaalsContact O-N 3.12Å; V61-Q64 WeakPolarHBondContact O-CB 3.3Å; V61-Q64 PolarHBondContact O-N 2.98Å; E62-Q64 VanDerWaalsContact C-N 3.31Å; E62-Q64 PolarHBondContact O-N 3.25Å; Q64-F66 VanDerWaalsContact C-N 3.34Å; Q64-F66 PolarHBondContact O-N 3.3Å; Q64-T68 VanDerWaalsContact O-CB 3.25Å; Q64-T68 WeakPolarHBondContact O-CB 3.46Å; Q64-T68 PolarHBondContact O-N 3.4Å; Q64-T68 PolarHBondContact O-OG1 3.02Å
65	G	82.6	Confident	76.9	Confident	45 Å²	45	82.5 Å²	82.5	46%	0.464	45%	0.452	S	S	.	.	H	α-helix	trans	-59.1	-45.3	176.6	0	0	0	0	0	112.1	V61 E62 S63 K69	V61-G65 PolarHBondContact O-N 3.35Å; E62-G65 PolarHBondContact O-N 2.83Å; E62-G65 VanDerWaalsContact O-N 3.17Å; S63-G65 VanDerWaalsContact C-N 3.28Å; S63-G65 PolarHBondContact O-N 2.94Å; G65-K69 WeakPolarHBondContact O-CB 3.22Å; G65-K69 PolarHBondContact O-N 2.89Å; G65-K69 VanDerWaalsContact O-N 3.16Å
66	F	80.6	Confident	76.3	Confident	37 Å²	37	86.8 Å²	86.8	16%	0.162	48%	0.476	C	S	.	.	H	α-helix	trans	-63.2	-51	179	-162	-84.5	0	0	0	112	Y35 H52 E62 S63 Q64 T68 K69 H70	Y35-F66 HydrophobicContact CE1-CD2 4.46Å; H52-F66 HydrophobicContact CB-CD1 4.39Å; H52-F66 AromaticContact CD2-CD1 3.24Å; H52-F66 WeakPolarHBondContact CD2-CD1 3.43Å; H52-F66 AromaticContact CD2-CE1 3.62Å; H52-F66 AromaticContact CD2-CG 3.51Å; H52-F66 AromaticContact CG-CD1 3.89Å; H52-F66 AromaticContact NE2-CD1 3.76Å; H52-F66 AromaticContact NE2-CD2 3.69Å; H52-F66 AromaticContact NE2-CE2 3.99Å; H52-F66 AromaticContact NE2-CG 3.57Å; E62-F66 PolarHBondContact O-N 3.08Å; S63-F66 PolarHBondContact O-N 3.46Å; Q64-F66 VanDerWaalsContact C-N 3.34Å; Q64-F66 PolarHBondContact O-N 3.3Å; F66-T68 PolarHBondContact O-N 2.97Å; F66-K69 PolarHBondContact O-N 3.35Å; F66-H70 AromaticContact CD1-CD2 3.66Å; F66-H70 AromaticContact CE1-CD2 3.37Å; F66-H70 WeakPolarHBondContact CE1-CD2 3.06Å; F66-H70 AromaticContact CE1-NE2 3.74Å; F66-H70 AromaticContact CZ-CD2 3.75Å; F66-H70 AromaticContact CZ-NE2 3.6Å; F66-H70 PolarHBondContact O-CD2 3.41Å; F66-H70 PolarHBondContact O-N 3.03Å; F66-H70 VanDerWaalsContact O-N 3.17Å
67	I	80	Confident	75.7	Confident	17 Å²	17	89.9 Å²	89.9	9%	0.087	49%	0.491	C	S	.	.	H	α-helix	trans	-62.3	-45.2	179.9	-63.3	170.6	0	0	0	110.8	F49 H52 S53 C56 S63 K69 H70 R71	F49-I67 HydrophobicContact CE2-CB 4.42Å; F49-I67 HydrophobicContact CE2-CG1 4.44Å; F49-I67 HydrophobicContact CE2-CG2 3.83Å; F49-I67 HydrophobicContact CZ-CG2 3.98Å; H52-I67 HydrophobicContact CB-CD1 4.33Å; H52-I67 HydrophobicContact CB-CG1 3.93Å; H52-I67 WeakPolarHBondContact O-CD1 3.45Å; S53-I67 VanDerWaalsContact CA-CD1 3.46Å; C56-I67 HydrophobicContact CB-CD1 3.46Å; C56-I67 VanDerWaalsContact CB-CD1 3.46Å; S63-I67 WeakPolarHBondContact O-CG1 3.13Å; S63-I67 PolarHBondContact O-N 3.42Å; I67-K69 PolarHBondContact O-N 3.26Å; I67-H70 PolarHBondContact O-N 3.32Å; I67-H70 VanDerWaalsContact O-N 3.12Å; I67-R71 HydrophobicContact CG2-CB 4.44Å; I67-R71 WeakPolarHBondContact O-CB 3.27Å; I67-R71 PolarHBondContact O-N 3.32Å
68	T	79.5	Confident	75.1	Confident	88 Å²	88	91.1 Å²	91.1	54%	0.54	48%	0.477	S	S	.	.	H	α-helix	trans	-60.4	-38.2	-177.5	-58.8	0	0	0	0	110.8	Q64 F66	Q64-T68 VanDerWaalsContact O-CB 3.25Å; Q64-T68 WeakPolarHBondContact O-CB 3.46Å; Q64-T68 PolarHBondContact O-N 3.4Å; Q64-T68 PolarHBondContact O-OG1 3.02Å; F66-T68 PolarHBondContact O-N 2.97Å
69	K	73.5	Confident	74.6	Confident	169 Å²	169	91.8 Å²	91.8	74%	0.735	48%	0.48	S	S	*	.	H	α-helix	trans	-67.1	-38	177.3	-138.9	-179.3	-173.5	-177	0	112.8	G65 F66 I67	G65-K69 WeakPolarHBondContact O-CB 3.22Å; G65-K69 PolarHBondContact O-N 2.89Å; G65-K69 VanDerWaalsContact O-N 3.16Å; F66-K69 PolarHBondContact O-N 3.35Å; I67-K69 PolarHBondContact O-N 3.26Å
70	H	70.2	Confident	74	Confident	65 Å²	65	94.3 Å²	94.3	30%	0.301	48%	0.476	S	S	.	.	H	α-helix	trans	-90.4	-22.4	-176.5	-78.7	-74.7	0	0	0	114.7	F49 F66 I67 I72 S73	F49-H70 HydrophobicContact CD2-CB 4.47Å; F66-H70 AromaticContact CD1-CD2 3.66Å; F66-H70 AromaticContact CE1-CD2 3.37Å; F66-H70 WeakPolarHBondContact CE1-CD2 3.06Å; F66-H70 AromaticContact CE1-NE2 3.74Å; F66-H70 AromaticContact CZ-CD2 3.75Å; F66-H70 AromaticContact CZ-NE2 3.6Å; F66-H70 PolarHBondContact O-CD2 3.41Å; F66-H70 PolarHBondContact O-N 3.03Å; F66-H70 VanDerWaalsContact O-N 3.17Å; I67-H70 PolarHBondContact O-N 3.32Å; I67-H70 VanDerWaalsContact O-N 3.12Å; H70-I72 PolarHBondContact O-N 3.28Å; H70-S73 PolarHBondContact O-N 3.13Å; H70-S73 VanDerWaalsContact O-N 3.09Å
71	R	63.1	Low	73.3	Confident	190 Å²	190	100.5 Å²	100.5	72%	0.717	51%	0.506	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.2	-15.3	178.7	-171.3	173.9	169.6	171.1	-1.8	113.1	I67 S73	I67-R71 HydrophobicContact CG2-CB 4.44Å; I67-R71 WeakPolarHBondContact O-CB 3.27Å; I67-R71 PolarHBondContact O-N 3.32Å; R71-S73 VanDerWaalsContact C-N 3.3Å
72	I	54.9	Low	72.4	Confident	142 Å²	142	99.5 Å²	99.5	73%	0.728	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.3	-7	175.5	-53.8	166.7	0	0	0	111	H70	H70-I72 PolarHBondContact O-N 3.28Å
73	S	54.9	Low	71.2	Confident	89 Å²	89	98 Å²	98	62%	0.622	49%	0.487	S	S	*	.			trans	-104.8	7.2	-175	-59	0	0	0	0	115.5	H70 R71	H70-S73 PolarHBondContact O-N 3.13Å; H70-S73 VanDerWaalsContact O-N 3.09Å; R71-S73 VanDerWaalsContact C-N 3.3Å
74	F	46.7	Very low	70	Confident	241 Å²	241	106.9 Å²	106.9	100%	1.057	53%	0.532	S	S	*	.			trans	-129.6	0	173	-70.1	-83.1	0	0	0	110.1

Retrieved 74 of 74 residues in 19.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).