A0A5K4F872_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F872, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 69 aa.

						>A0A5K4F872_SCHMA|A0A5K4F872
MHIKFLIALFLITINVIYSQKTQDKSRNEKKELEEIKKTPQYQQVRTKVINALSDKIDNYVLDQIRKKP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.1	Low	76.9	Confident	188 Å²	188	126.2 Å²	126.2	93%	0.926	62%	0.624	S	S	*	*				0	-32.8	0	-133.2	170.1	179.9	0	0	113.1	I3 K4 F5	M1-I3 PolarHBondContact O-N 3.32Å; M1-K4 PolarHBondContact O-N 3.42Å; M1-F5 HydrophobicContact CG-CE2 4.33Å; M1-F5 WeakPolarHBondContact O-CD2 3.43Å
2	H	65.4	Low	77.5	Confident	161 Å²	161	124.8 Å²	124.8	75%	0.745	62%	0.619	S	S	*	*	H	α-helix	trans	-58.9	-41.1	-175.4	-67.4	-70.1	0	0	0	116.7	K4 F5 L6	H2-K4 VanDerWaalsContact C-N 3.26Å; H2-K4 PolarHBondContact O-N 3.24Å; H2-F5 WeakPolarHBondContact O-CB 3.46Å; H2-F5 PolarHBondContact O-N 3.23Å; H2-L6 PolarHBondContact O-N 3.24Å
3	I	75.3	Confident	78.2	Confident	128 Å²	128	120.2 Å²	120.2	66%	0.656	60%	0.601	S	S	*	*	H	α-helix	trans	-60.2	-34.5	179.9	-90	156.8	0	0	0	112.8	M1 F5 L6 I7	M1-I3 PolarHBondContact O-N 3.32Å; I3-F5 VanDerWaalsContact C-N 3.29Å; I3-F5 PolarHBondContact O-N 3.28Å; I3-L6 PolarHBondContact O-N 3.4Å; I3-I7 HydrophobicContact CG2-CD1 4.22Å; I3-I7 PolarHBondContact O-N 3.07Å
4	K	70.5	Confident	78.7	Confident	168 Å²	168	116 Å²	116	73%	0.73	58%	0.581	S	S	*	*	H	α-helix	trans	-63.9	-36.3	177.1	-65.3	-173	177.1	-175.7	0	111.6	M1 H2 A8	M1-K4 PolarHBondContact O-N 3.42Å; H2-K4 VanDerWaalsContact C-N 3.26Å; H2-K4 PolarHBondContact O-N 3.24Å; K4-A8 PolarHBondContact O-N 3.26Å
5	F	75.4	Confident	78.8	Confident	130 Å²	130	116.1 Å²	116.1	57%	0.57	58%	0.584	S	S	*	*	H	α-helix	trans	-69.3	-38.4	176.8	-75.3	-81.1	0	0	0	112.4	M1 H2 I3 I7 A8 L9	M1-F5 HydrophobicContact CG-CE2 4.33Å; M1-F5 WeakPolarHBondContact O-CD2 3.43Å; H2-F5 WeakPolarHBondContact O-CB 3.46Å; H2-F5 PolarHBondContact O-N 3.23Å; I3-F5 VanDerWaalsContact C-N 3.29Å; I3-F5 PolarHBondContact O-N 3.28Å; F5-I7 PolarHBondContact O-N 3.33Å; F5-A8 PolarHBondContact O-N 2.99Å; F5-L9 PolarHBondContact O-N 2.99Å
6	L	79.3	Confident	78.9	Confident	120 Å²	120	113.2 Å²	113.2	63%	0.628	57%	0.574	S	S	*	*	H	α-helix	trans	-62.4	-42.3	177.4	-70.5	173.7	0	0	0	112	H2 I3 L9 F10	H2-L6 PolarHBondContact O-N 3.24Å; I3-L6 PolarHBondContact O-N 3.4Å; L6-L9 PolarHBondContact O-N 3.48Å; L6-F10 WeakPolarHBondContact O-CB 3.46Å; L6-F10 PolarHBondContact O-N 3.05Å
7	I	82.1	Confident	78.9	Confident	97 Å²	97	112.9 Å²	112.9	50%	0.497	57%	0.573	S	S	.	*	H	α-helix	trans	-64	-44.1	177.3	-64.7	168	0	0	0	110.8	I3 F5 L9 F10 L11	I3-I7 HydrophobicContact CG2-CD1 4.22Å; I3-I7 PolarHBondContact O-N 3.07Å; F5-I7 PolarHBondContact O-N 3.33Å; I7-L9 PolarHBondContact O-N 2.98Å; I7-F10 PolarHBondContact O-N 3.27Å; I7-L11 HydrophobicContact CG2-CD1 4.14Å; I7-L11 HydrophobicContact CG2-CG 4.48Å; I7-L11 WeakPolarHBondContact O-CG 3.42Å; I7-L11 PolarHBondContact O-N 3.48Å
8	A	82.5	Confident	78.6	Confident	47 Å²	47	115.6 Å²	115.6	39%	0.388	58%	0.576	S	S	.	*	H	α-helix	trans	-61.2	-44.4	177.8	0	0	0	0	0	112	K4 F5 F10 L11 I12	K4-A8 PolarHBondContact O-N 3.26Å; F5-A8 PolarHBondContact O-N 2.99Å; A8-F10 VanDerWaalsContact C-N 3.34Å; A8-F10 PolarHBondContact O-N 3.11Å; A8-L11 PolarHBondContact O-N 3.46Å; A8-I12 VanDerWaalsContact O-CG1 3.31Å; A8-I12 WeakPolarHBondContact O-CG1 3.4Å; A8-I12 PolarHBondContact O-N 3.41Å; A8-I12 VanDerWaalsContact O-N 3.11Å
9	L	83.5	Confident	78.3	Confident	113 Å²	113	112.7 Å²	112.7	59%	0.592	57%	0.568	S	S	*	*	H	α-helix	trans	-60.2	-43.2	175.8	-113.7	133.9	0	0	0	111.9	F5 L6 I7 I12 T13	F5-L9 PolarHBondContact O-N 2.99Å; L6-L9 PolarHBondContact O-N 3.48Å; I7-L9 PolarHBondContact O-N 2.98Å; L9-I12 PolarHBondContact O-N 3.25Å; L9-T13 WeakPolarHBondContact O-CG2 3.31Å; L9-T13 PolarHBondContact O-N 3.47Å; L9-T13 PolarHBondContact O-OG1 3.07Å
10	F	86.9	Confident	77.9	Confident	129 Å²	129	112.8 Å²	112.8	57%	0.566	57%	0.567	S	S	*	*	H	α-helix	trans	-65	-39.8	178.4	-175	-107	0	0	0	113	L6 I7 A8 T13 I14	L6-F10 WeakPolarHBondContact O-CB 3.46Å; L6-F10 PolarHBondContact O-N 3.05Å; I7-F10 PolarHBondContact O-N 3.27Å; A8-F10 VanDerWaalsContact C-N 3.34Å; A8-F10 PolarHBondContact O-N 3.11Å; F10-T13 WeakPolarHBondContact CA-OG1 3.23Å; F10-T13 PolarHBondContact O-N 3.05Å; F10-T13 PolarHBondContact O-OG1 3.33Å; F10-I14 HydrophobicContact CD1-CD1 3.76Å; F10-I14 HydrophobicContact CE1-CD1 3.27Å; F10-I14 HydrophobicContact CE1-CG1 4.29Å; F10-I14 HydrophobicContact CE2-CD1 4.31Å; F10-I14 HydrophobicContact CG-CD1 4.47Å; F10-I14 HydrophobicContact CZ-CD1 3.59Å; F10-I14 HydrophobicContact CZ-CG1 4.31Å; F10-I14 WeakPolarHBondContact O-CG1 3.39Å; F10-I14 PolarHBondContact O-N 3.35Å
11	L	84.7	Confident	77.4	Confident	107 Å²	107	114.7 Å²	114.7	56%	0.56	57%	0.571	S	S	*	*	H	α-helix	trans	-66	-39.4	176.3	-70.5	173.1	0	0	0	112.1	I7 A8 N15	I7-L11 HydrophobicContact CG2-CD1 4.14Å; I7-L11 HydrophobicContact CG2-CG 4.48Å; I7-L11 WeakPolarHBondContact O-CG 3.42Å; I7-L11 PolarHBondContact O-N 3.48Å; A8-L11 PolarHBondContact O-N 3.46Å; L11-N15 PolarHBondContact O-N 2.91Å
12	I	84.8	Confident	77.7	Confident	110 Å²	110	110 Å²	110	56%	0.564	55%	0.553	S	S	*	*	H	α-helix	trans	-64.5	-45.3	177.1	-67.2	165.2	0	0	0	110.5	A8 L9 I14 N15 V16	A8-I12 VanDerWaalsContact O-CG1 3.31Å; A8-I12 WeakPolarHBondContact O-CG1 3.4Å; A8-I12 PolarHBondContact O-N 3.41Å; A8-I12 VanDerWaalsContact O-N 3.11Å; L9-I12 PolarHBondContact O-N 3.25Å; I12-I14 PolarHBondContact O-N 3.35Å; I12-N15 PolarHBondContact O-N 3.23Å; I12-V16 WeakPolarHBondContact O-CG2 3.48Å; I12-V16 PolarHBondContact O-N 3.17Å
13	T	86.6	Confident	77.6	Confident	64 Å²	64	108.6 Å²	108.6	39%	0.393	55%	0.547	S	S	.	.	H	α-helix	trans	-64.7	-41	179.7	51.4	0	0	0	0	112	L9 F10 N15 V16 I17	L9-T13 WeakPolarHBondContact O-CG2 3.31Å; L9-T13 PolarHBondContact O-N 3.47Å; L9-T13 PolarHBondContact O-OG1 3.07Å; F10-T13 WeakPolarHBondContact CA-OG1 3.23Å; F10-T13 PolarHBondContact O-N 3.05Å; F10-T13 PolarHBondContact O-OG1 3.33Å; T13-N15 PolarHBondContact O-N 2.89Å; T13-V16 PolarHBondContact O-N 3.49Å; T13-I17 WeakPolarHBondContact O-CD1 3.45Å; T13-I17 VanDerWaalsContact O-CG1 3.23Å; T13-I17 WeakPolarHBondContact O-CG1 3.37Å; T13-I17 PolarHBondContact O-N 3.38Å
14	I	84.2	Confident	77.1	Confident	62 Å²	62	107.2 Å²	107.2	32%	0.318	54%	0.541	S	S	.	.	H	α-helix	trans	-56.7	-50.2	172.1	-73.3	177.5	0	0	0	110.4	F10 I12 V16 I17 Y18	F10-I14 HydrophobicContact CD1-CD1 3.76Å; F10-I14 HydrophobicContact CE1-CD1 3.27Å; F10-I14 HydrophobicContact CE1-CG1 4.29Å; F10-I14 HydrophobicContact CE2-CD1 4.31Å; F10-I14 HydrophobicContact CG-CD1 4.47Å; F10-I14 HydrophobicContact CZ-CD1 3.59Å; F10-I14 HydrophobicContact CZ-CG1 4.31Å; F10-I14 WeakPolarHBondContact O-CG1 3.39Å; F10-I14 PolarHBondContact O-N 3.35Å; I12-I14 PolarHBondContact O-N 3.35Å; I14-V16 VanDerWaalsContact C-N 3.3Å; I14-V16 PolarHBondContact O-N 2.97Å; I14-I17 PolarHBondContact O-N 3.01Å; I14-Y18 HydrophobicContact CG2-CD2 3.55Å; I14-Y18 HydrophobicContact CG2-CE2 3.69Å; I14-Y18 WeakPolarHBondContact O-CD2 3.3Å; I14-Y18 PolarHBondContact O-N 3.47Å
15	N	80	Confident	77.2	Confident	117 Å²	117	105.3 Å²	105.3	63%	0.626	53%	0.533	S	S	*	.	H	α-helix	trans	-59.9	-41.4	-177.7	-167.2	36.8	0	0	0	112.1	L11 I12 T13 Y18 S19	L11-N15 PolarHBondContact O-N 2.91Å; I12-N15 PolarHBondContact O-N 3.23Å; T13-N15 PolarHBondContact O-N 2.89Å; N15-Y18 PolarHBondContact O-N 3.45Å; N15-S19 VanDerWaalsContact O-CB 3.3Å; N15-S19 WeakPolarHBondContact O-CB 3.49Å; N15-S19 PolarHBondContact O-N 2.92Å
16	V	81.5	Confident	77	Confident	70 Å²	70	101.6 Å²	101.6	42%	0.424	52%	0.523	S	S	.	.	H	α-helix	trans	-63.9	-44.8	176.1	173	0	0	0	0	111.5	I12 T13 I14 S19 Q20	I12-V16 WeakPolarHBondContact O-CG2 3.48Å; I12-V16 PolarHBondContact O-N 3.17Å; T13-V16 PolarHBondContact O-N 3.49Å; I14-V16 VanDerWaalsContact C-N 3.3Å; I14-V16 PolarHBondContact O-N 2.97Å; V16-S19 PolarHBondContact O-N 3.49Å; V16-Q20 WeakPolarHBondContact O-CG 3.33Å; V16-Q20 PolarHBondContact O-N 3Å
17	I	77.8	Confident	76.7	Confident	109 Å²	109	103.6 Å²	103.6	56%	0.559	52%	0.522	S	S	*	.	H	α-helix	trans	-63.8	-44.4	179.1	-67.2	164	0	0	0	110.9	T13 I14 Q20 K21	T13-I17 WeakPolarHBondContact O-CD1 3.45Å; T13-I17 VanDerWaalsContact O-CG1 3.23Å; T13-I17 WeakPolarHBondContact O-CG1 3.37Å; T13-I17 PolarHBondContact O-N 3.38Å; I14-I17 PolarHBondContact O-N 3.01Å; I17-Q20 PolarHBondContact O-N 3.23Å; I17-K21 WeakPolarHBondContact O-CB 3.35Å; I17-K21 PolarHBondContact O-N 2.92Å
18	Y	73.3	Confident	76.6	Confident	160 Å²	160	103.7 Å²	103.7	63%	0.627	52%	0.523	S	S	*	.	H	α-helix	trans	-63.7	-41.1	176.7	-90.5	-92.9	0	0	0	111.8	I14 N15 K21 T22	I14-Y18 HydrophobicContact CG2-CD2 3.55Å; I14-Y18 HydrophobicContact CG2-CE2 3.69Å; I14-Y18 WeakPolarHBondContact O-CD2 3.3Å; I14-Y18 PolarHBondContact O-N 3.47Å; N15-Y18 PolarHBondContact O-N 3.45Å; Y18-K21 PolarHBondContact O-N 3.33Å; Y18-T22 PolarHBondContact O-N 3.21Å; Y18-T22 VanDerWaalsContact O-N 3.15Å; Y18-T22 PolarHBondContact O-OG1 3.32Å
19	S	73.1	Confident	76.4	Confident	61 Å²	61	105.8 Å²	105.8	43%	0.427	53%	0.525	S	S	.	.	H	α-helix	trans	-67.4	-38.2	177.9	-170.9	0	0	0	0	113	N15 V16 T22 Q23	N15-S19 VanDerWaalsContact O-CB 3.3Å; N15-S19 WeakPolarHBondContact O-CB 3.49Å; N15-S19 PolarHBondContact O-N 2.92Å; V16-S19 PolarHBondContact O-N 3.49Å; S19-T22 PolarHBondContact O-OG1 3.47Å; S19-Q23 PolarHBondContact O-N 3.12Å
20	Q	71.6	Confident	76.2	Confident	114 Å²	114	106.9 Å²	106.9	53%	0.533	53%	0.525	S	S	.	.	H	α-helix	trans	-69.2	-42	175.6	-75	-175	28.4	0	0	111.3	V16 I17 T22 Q23 D24	V16-Q20 WeakPolarHBondContact O-CG 3.33Å; V16-Q20 PolarHBondContact O-N 3Å; I17-Q20 PolarHBondContact O-N 3.23Å; Q20-T22 VanDerWaalsContact C-N 3.29Å; Q20-T22 PolarHBondContact O-N 3.15Å; Q20-Q23 PolarHBondContact O-N 2.92Å; Q20-Q23 VanDerWaalsContact O-N 3.15Å; Q20-D24 PolarHBondContact O-N 3.15Å
21	K	67.6	Low	76.1	Confident	153 Å²	153	105.9 Å²	105.9	67%	0.665	52%	0.521	S	S	*	.	H	α-helix	trans	-60	-38.5	178.6	-172.8	176.6	-179.2	179.6	0	112.4	I17 Y18 K25	I17-K21 WeakPolarHBondContact O-CB 3.35Å; I17-K21 PolarHBondContact O-N 2.92Å; Y18-K21 PolarHBondContact O-N 3.33Å; K21-K25 VanDerWaalsContact O-CB 3.31Å; K21-K25 WeakPolarHBondContact O-CB 3.33Å; K21-K25 PolarHBondContact O-N 2.93Å; K21-K25 VanDerWaalsContact O-N 3.12Å
22	T	64.5	Low	76.1	Confident	89 Å²	89	106.4 Å²	106.4	55%	0.546	52%	0.52	S	S	.	.	H	α-helix	trans	-71.4	-37.2	176.2	50.3	0	0	0	0	112.4	Y18 S19 Q20 S26	Y18-T22 PolarHBondContact O-N 3.21Å; Y18-T22 VanDerWaalsContact O-N 3.15Å; Y18-T22 PolarHBondContact O-OG1 3.32Å; S19-T22 PolarHBondContact O-OG1 3.47Å; Q20-T22 VanDerWaalsContact C-N 3.29Å; Q20-T22 PolarHBondContact O-N 3.15Å; T22-S26 WeakPolarHBondContact O-CB 3.43Å; T22-S26 PolarHBondContact O-N 2.93Å
23	Q	64.3	Low	76.1	Confident	133 Å²	133	104.9 Å²	104.9	62%	0.621	51%	0.513	S	S	*	.	H	α-helix	trans	-65.5	-45.8	175	-78.9	-170.2	-43.6	0	0	112.7	S19 Q20 S26 R27	S19-Q23 PolarHBondContact O-N 3.12Å; Q20-Q23 PolarHBondContact O-N 2.92Å; Q20-Q23 VanDerWaalsContact O-N 3.15Å; Q23-S26 PolarHBondContact O-N 3.31Å; Q23-R27 WeakPolarHBondContact O-CB 3.5Å; Q23-R27 PolarHBondContact O-N 2.68Å
24	D	64.5	Low	76.1	Confident	98 Å²	98	107.6 Å²	107.6	52%	0.524	52%	0.521	S	S	.	.	H	α-helix	trans	-66.1	-41.3	179.3	-82.2	-23.6	0	0	0	111.8	Q20 S26 R27 N28	Q20-D24 PolarHBondContact O-N 3.15Å; D24-S26 PolarHBondContact O-N 2.89Å; D24-R27 PolarHBondContact O-N 2.98Å; D24-N28 WeakPolarHBondContact O-CB 3.31Å; D24-N28 PolarHBondContact O-N 3.5Å
25	K	72.9	Confident	76.4	Confident	128 Å²	128	110.9 Å²	110.9	56%	0.557	54%	0.535	S	S	*	.	H	α-helix	trans	-59.5	-48	173.6	-166.4	178.3	-166.9	-90.8	0	111	K21 R27 N28 E29	K21-K25 VanDerWaalsContact O-CB 3.31Å; K21-K25 WeakPolarHBondContact O-CB 3.33Å; K21-K25 PolarHBondContact O-N 2.93Å; K21-K25 VanDerWaalsContact O-N 3.12Å; K25-R27 VanDerWaalsContact C-N 3.32Å; K25-R27 PolarHBondContact O-N 3.36Å; K25-N28 PolarHBondContact O-N 2.86Å; K25-E29 WeakPolarHBondContact CE-OE1 3.44Å; K25-E29 HydrophobicContact CG-CG 4.41Å; K25-E29 IonicContact NZ-OE1 2.68Å; K25-E29 PolarHBondContact NZ-OE1 3.31Å; K25-E29 WeakPolarHBondContact O-CB 3.38Å; K25-E29 VanDerWaalsContact O-CG 3.27Å; K25-E29 WeakPolarHBondContact O-CG 3.33Å; K25-E29 PolarHBondContact O-N 3.18Å
26	S	71.3	Confident	76.7	Confident	52 Å²	52	108.7 Å²	108.7	36%	0.364	52%	0.523	S	S	.	.	H	α-helix	trans	-63.2	-37.4	178.8	-173.2	0	0	0	0	112.6	T22 Q23 D24 K30	T22-S26 WeakPolarHBondContact O-CB 3.43Å; T22-S26 PolarHBondContact O-N 2.93Å; Q23-S26 PolarHBondContact O-N 3.31Å; D24-S26 PolarHBondContact O-N 2.89Å; S26-K30 WeakPolarHBondContact O-CB 3.46Å; S26-K30 WeakPolarHBondContact O-CG 3.23Å; S26-K30 PolarHBondContact O-N 3.05Å
27	R	73.5	Confident	77	Confident	163 Å²	163	109.4 Å²	109.4	62%	0.615	52%	0.52	S	S	*	.	H	α-helix	trans	-68.9	-41	177.6	-166	177	-171.2	-174	2.6	111.8	Q23 D24 K25 K31	Q23-R27 WeakPolarHBondContact O-CB 3.5Å; Q23-R27 PolarHBondContact O-N 2.68Å; D24-R27 PolarHBondContact O-N 2.98Å; K25-R27 VanDerWaalsContact C-N 3.32Å; K25-R27 PolarHBondContact O-N 3.36Å; R27-K31 WeakPolarHBondContact O-CG 3.27Å; R27-K31 PolarHBondContact O-N 2.86Å
28	N	78.5	Confident	77.6	Confident	98 Å²	98	112.2 Å²	112.2	52%	0.524	53%	0.528	S	S	.	.	H	α-helix	trans	-69.2	-43.2	176.8	-73.2	-13.5	0	0	0	111.7	D24 K25 K30 K31 E32	D24-N28 WeakPolarHBondContact O-CB 3.31Å; D24-N28 PolarHBondContact O-N 3.5Å; K25-N28 PolarHBondContact O-N 2.86Å; N28-K30 VanDerWaalsContact C-N 3.3Å; N28-K30 PolarHBondContact O-N 3.39Å; N28-K31 PolarHBondContact O-N 3.15Å; N28-K31 VanDerWaalsContact O-N 3.15Å; N28-E32 WeakPolarHBondContact O-CB 3.28Å; N28-E32 PolarHBondContact O-N 3.3Å
29	E	79.8	Confident	78.5	Confident	92 Å²	92	106.8 Å²	106.8	43%	0.43	51%	0.512	S	S	.	.	H	α-helix	trans	-61.1	-37.4	175.9	-74.9	172.7	172.4	0	0	112	K25 L33	K25-E29 WeakPolarHBondContact CE-OE1 3.44Å; K25-E29 HydrophobicContact CG-CG 4.41Å; K25-E29 IonicContact NZ-OE1 2.68Å; K25-E29 PolarHBondContact NZ-OE1 3.31Å; K25-E29 WeakPolarHBondContact O-CB 3.38Å; K25-E29 VanDerWaalsContact O-CG 3.27Å; K25-E29 WeakPolarHBondContact O-CG 3.33Å; K25-E29 PolarHBondContact O-N 3.18Å; E29-L33 VanDerWaalsContact O-CB 3.28Å; E29-L33 WeakPolarHBondContact O-CB 3.4Å; E29-L33 PolarHBondContact O-N 2.95Å
30	K	79.5	Confident	79.5	Confident	136 Å²	136	108 Å²	108	59%	0.591	52%	0.518	S	S	*	.	H	α-helix	trans	-64.7	-43.9	174	-79.1	177.8	-178	-175.4	0	112.3	S26 N28 L33 E34	S26-K30 WeakPolarHBondContact O-CB 3.46Å; S26-K30 WeakPolarHBondContact O-CG 3.23Å; S26-K30 PolarHBondContact O-N 3.05Å; N28-K30 VanDerWaalsContact C-N 3.3Å; N28-K30 PolarHBondContact O-N 3.39Å; K30-L33 PolarHBondContact O-N 3.12Å; K30-E34 WeakPolarHBondContact O-CG 3.45Å; K30-E34 PolarHBondContact O-N 2.83Å
31	K	83.6	Confident	80.4	Confident	108 Å²	108	108.4 Å²	108.4	47%	0.47	52%	0.52	S	S	.	.	H	α-helix	trans	-63.7	-46	176.6	-73.2	178.7	176.6	-175.3	0	111.3	R27 N28 L33 E34 E35	R27-K31 WeakPolarHBondContact O-CG 3.27Å; R27-K31 PolarHBondContact O-N 2.86Å; N28-K31 PolarHBondContact O-N 3.15Å; N28-K31 VanDerWaalsContact O-N 3.15Å; K31-L33 VanDerWaalsContact C-N 3.32Å; K31-L33 PolarHBondContact O-N 2.97Å; K31-E34 WeakPolarHBondContact O-CB 3.44Å; K31-E34 PolarHBondContact O-N 3.22Å; K31-E34 VanDerWaalsContact O-N 3.12Å; K31-E35 WeakPolarHBondContact O-CG 3.42Å; K31-E35 PolarHBondContact O-N 3.44Å
32	E	85.8	Confident	81.6	Confident	117 Å²	117	104.4 Å²	104.4	55%	0.547	50%	0.501	S	S	.	.	H	α-helix	trans	-59.8	-43.3	176.7	-171.6	-179.2	178.2	0	0	111	N28 E34 E35 I36	N28-E32 WeakPolarHBondContact O-CB 3.28Å; N28-E32 PolarHBondContact O-N 3.3Å; E32-E34 VanDerWaalsContact C-N 3.35Å; E32-E34 PolarHBondContact O-N 3.42Å; E32-E35 PolarHBondContact O-N 3.4Å; E32-I36 HydrophobicContact CG-CD1 3.89Å; E32-I36 HydrophobicContact CG-CG1 4.5Å; E32-I36 WeakPolarHBondContact O-CB 3.47Å; E32-I36 VanDerWaalsContact O-CG1 3.23Å; E32-I36 WeakPolarHBondContact O-CG1 3.47Å; E32-I36 PolarHBondContact O-N 2.89Å
33	L	83.4	Confident	82.9	Confident	79 Å²	79	104 Å²	104	41%	0.414	49%	0.493	S	S	.	.	H	α-helix	trans	-63.4	-38.7	174.9	-179.2	62.3	0	0	0	112.5	E29 K30 K31 E35 I36 K37 Y42	E29-L33 VanDerWaalsContact O-CB 3.28Å; E29-L33 WeakPolarHBondContact O-CB 3.4Å; E29-L33 PolarHBondContact O-N 2.95Å; K30-L33 PolarHBondContact O-N 3.12Å; K31-L33 VanDerWaalsContact C-N 3.32Å; K31-L33 PolarHBondContact O-N 2.97Å; L33-E35 VanDerWaalsContact C-N 3.32Å; L33-I36 PolarHBondContact O-N 2.88Å; L33-K37 HydrophobicContact CG-CD 4.4Å; L33-K37 WeakPolarHBondContact O-CB 3.4Å; L33-K37 WeakPolarHBondContact O-CG 3.37Å; L33-K37 PolarHBondContact O-N 2.82Å; L33-Y42 HydrophobicContact CD1-CE2 4.47Å
34	E	88.3	Confident	84.3	Confident	120 Å²	120	103.6 Å²	103.6	56%	0.561	49%	0.491	S	S	*	.	H	α-helix	trans	-65.9	-33.8	175.1	-76.8	-179.6	-174.9	0	0	112.9	K30 K31 E32	K30-E34 WeakPolarHBondContact O-CG 3.45Å; K30-E34 PolarHBondContact O-N 2.83Å; K31-E34 WeakPolarHBondContact O-CB 3.44Å; K31-E34 PolarHBondContact O-N 3.22Å; K31-E34 VanDerWaalsContact O-N 3.12Å; E32-E34 VanDerWaalsContact C-N 3.35Å; E32-E34 PolarHBondContact O-N 3.42Å
35	E	88.6	Confident	85.7	Confident	131 Å²	131	103.2 Å²	103.2	61%	0.612	49%	0.492	S	S	*	.	H	α-helix	trans	-71.8	-47.1	173	-70.7	176.2	-172.4	0	0	111.2	K31 E32 L33 K37 K38	K31-E35 WeakPolarHBondContact O-CG 3.42Å; K31-E35 PolarHBondContact O-N 3.44Å; E32-E35 PolarHBondContact O-N 3.4Å; L33-E35 VanDerWaalsContact C-N 3.32Å; E35-K37 PolarHBondContact O-N 3.33Å; E35-K38 WeakPolarHBondContact O-CB 3.19Å; E35-K38 PolarHBondContact O-N 3.48Å
36	I	88.3	Confident	86.6	Confident	71 Å²	71	103.1 Å²	103.1	36%	0.364	49%	0.489	S	S	.	.	H	α-helix	trans	-58.3	-38.3	176	-69.1	167.1	0	0	0	110.6	E32 L33 K38 T39 Y42	E32-I36 HydrophobicContact CG-CD1 3.89Å; E32-I36 HydrophobicContact CG-CG1 4.5Å; E32-I36 WeakPolarHBondContact O-CB 3.47Å; E32-I36 VanDerWaalsContact O-CG1 3.23Å; E32-I36 WeakPolarHBondContact O-CG1 3.47Å; E32-I36 PolarHBondContact O-N 2.89Å; L33-I36 PolarHBondContact O-N 2.88Å; I36-K38 PolarHBondContact O-N 3.27Å; I36-K38 VanDerWaalsContact O-N 3.09Å; I36-T39 WeakPolarHBondContact O-CB 3.33Å; I36-T39 WeakPolarHBondContact O-CG2 3.39Å; I36-T39 PolarHBondContact O-N 3Å; I36-T39 PolarHBondContact O-OG1 2.65Å; I36-Y42 HydrophobicContact CG2-CD2 3.92Å; I36-Y42 HydrophobicContact CG2-CG 4.39Å; I36-Y42 WeakPolarHBondContact O-CB 3.5Å
37	K	87.5	Confident	87.6	Confident	85 Å²	85	103.9 Å²	103.9	37%	0.37	49%	0.491	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.9	-26.6	176.2	-86.6	169.7	177.4	-179.5	0	114.1	L33 E35 Y42 Q43	L33-K37 HydrophobicContact CG-CD 4.4Å; L33-K37 WeakPolarHBondContact O-CB 3.4Å; L33-K37 WeakPolarHBondContact O-CG 3.37Å; L33-K37 PolarHBondContact O-N 2.82Å; E35-K37 PolarHBondContact O-N 3.33Å; K37-Y42 VanDerWaalsContact CA-CD1 3.49Å; K37-Y42 HydrophobicContact CB-CD1 4.23Å; K37-Y42 HydrophobicContact CB-CE1 4.09Å; K37-Y42 HydrophobicContact CG-CD1 4.1Å; K37-Y42 HydrophobicContact CG-CD2 4.44Å; K37-Y42 HydrophobicContact CG-CE1 3.53Å; K37-Y42 HydrophobicContact CG-CE2 3.91Å; K37-Y42 VanDerWaalsContact CG-CZ 3.42Å; K37-Y42 WeakPolarHBondContact O-CD1 3.07Å; K37-Q43 PolarHBondContact O-NE2 3.48Å
38	K	89.8	Confident	88.6	Confident	169 Å²	169	103.5 Å²	103.5	74%	0.735	49%	0.494	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.8	-12.2	178.5	-60.9	171.2	-173.5	173.9	0	112.6	E35 I36	E35-K38 WeakPolarHBondContact O-CB 3.19Å; E35-K38 PolarHBondContact O-N 3.48Å; I36-K38 PolarHBondContact O-N 3.27Å; I36-K38 VanDerWaalsContact O-N 3.09Å
39	T	91.9	Very high	89.2	Confident	46 Å²	46	102.5 Å²	102.5	28%	0.282	49%	0.491	S	S	.	.	S	Bend	trans	-72.5	144.2	-179.6	67.9	0	0	0	0	111.5	I36 Q41 Y42 Q43	I36-T39 WeakPolarHBondContact O-CB 3.33Å; I36-T39 WeakPolarHBondContact O-CG2 3.39Å; I36-T39 PolarHBondContact O-N 3Å; I36-T39 PolarHBondContact O-OG1 2.65Å; T39-Q41 PolarHBondContact O-N 3.25Å; T39-Y42 PolarHBondContact O-N 2.91Å; T39-Y42 WeakPolarHBondContact OG1-CB 3.24Å; T39-Y42 PolarHBondContact OG1-N 2.9Å; T39-Q43 PolarHBondContact O-N 3.27Å
40	P	93.3	Very high	89.9	Confident	86 Å²	86	101.9 Å²	101.9	56%	0.558	49%	0.49	S	S	*	.	H	α-helix	trans	-57.1	-36.1	174.6	-26.1	34.8	0	0	0	113.2	Q43 Q44	P40-Q43 PolarHBondContact O-N 3.21Å; P40-Q44 WeakPolarHBondContact O-CG 3.45Å; P40-Q44 PolarHBondContact O-N 2.95Å
41	Q	92.2	Very high	90.6	Very high	123 Å²	123	99.8 Å²	99.8	58%	0.575	49%	0.485	S	S	*	.	H	α-helix	trans	-63.4	-46	179.6	-65	81.1	-3.3	0	0	111.2	T39 Q43 Q44 V45	T39-Q41 PolarHBondContact O-N 3.25Å; Q41-Q43 VanDerWaalsContact C-N 3.31Å; Q41-Q43 PolarHBondContact O-N 3.2Å; Q41-Q44 PolarHBondContact O-N 3.28Å; Q41-V45 WeakPolarHBondContact O-CG2 3.33Å; Q41-V45 PolarHBondContact O-N 3.09Å
42	Y	92.9	Very high	90.9	Very high	69 Å²	69	97.7 Å²	97.7	27%	0.271	49%	0.488	S	S	.	.	H	α-helix	trans	-60.3	-43.6	175.3	179.2	-86	0	0	0	111.4	L33 I36 K37 T39 Q44 V45 R46	L33-Y42 HydrophobicContact CD1-CE2 4.47Å; I36-Y42 HydrophobicContact CG2-CD2 3.92Å; I36-Y42 HydrophobicContact CG2-CG 4.39Å; I36-Y42 WeakPolarHBondContact O-CB 3.5Å; K37-Y42 VanDerWaalsContact CA-CD1 3.49Å; K37-Y42 HydrophobicContact CB-CD1 4.23Å; K37-Y42 HydrophobicContact CB-CE1 4.09Å; K37-Y42 HydrophobicContact CG-CD1 4.1Å; K37-Y42 HydrophobicContact CG-CD2 4.44Å; K37-Y42 HydrophobicContact CG-CE1 3.53Å; K37-Y42 HydrophobicContact CG-CE2 3.91Å; K37-Y42 VanDerWaalsContact CG-CZ 3.42Å; K37-Y42 WeakPolarHBondContact O-CD1 3.07Å; T39-Y42 PolarHBondContact O-N 2.91Å; T39-Y42 WeakPolarHBondContact OG1-CB 3.24Å; T39-Y42 PolarHBondContact OG1-N 2.9Å; Y42-Q44 PolarHBondContact O-N 3.44Å; Y42-V45 PolarHBondContact O-N 3.01Å; Y42-R46 HydrophobicContact CD1-CB 4.44Å; Y42-R46 HydrophobicContact CE1-CB 4.2Å; Y42-R46 VanDerWaalsContact O-CB 3.24Å; Y42-R46 WeakPolarHBondContact O-CB 3.36Å; Y42-R46 PolarHBondContact O-N 3.32Å
43	Q	90.8	Very high	91.2	Very high	81 Å²	81	96.4 Å²	96.4	38%	0.379	49%	0.485	S	S	.	.	H	α-helix	trans	-62.8	-42.3	178.7	-66.5	-66.2	-18.8	0	0	111.8	K37 T39 P40 Q41 R46 T47	K37-Q43 PolarHBondContact O-NE2 3.48Å; T39-Q43 PolarHBondContact O-N 3.27Å; P40-Q43 PolarHBondContact O-N 3.21Å; Q41-Q43 VanDerWaalsContact C-N 3.31Å; Q41-Q43 PolarHBondContact O-N 3.2Å; Q43-R46 PolarHBondContact O-N 3.21Å; Q43-T47 PolarHBondContact O-N 3.41Å; Q43-T47 PolarHBondContact O-OG1 2.85Å; Q43-T47 VanDerWaalsContact O-OG1 3.05Å
44	Q	93.8	Very high	91.6	Very high	124 Å²	124	95.1 Å²	95.1	58%	0.579	48%	0.482	S	S	*	.	H	α-helix	trans	-60.7	-46.7	175.3	-73.6	175.8	-4.2	0	0	112.3	P40 Q41 Y42 T47 K48	P40-Q44 WeakPolarHBondContact O-CG 3.45Å; P40-Q44 PolarHBondContact O-N 2.95Å; Q41-Q44 PolarHBondContact O-N 3.28Å; Y42-Q44 PolarHBondContact O-N 3.44Å; Q44-T47 PolarHBondContact O-N 2.91Å; Q44-K48 WeakPolarHBondContact O-CG 3.33Å; Q44-K48 PolarHBondContact O-N 3.29Å; Q44-K48 VanDerWaalsContact O-N 3.09Å
45	V	93.2	Very high	91.6	Very high	90 Å²	90	94.2 Å²	94.2	55%	0.545	48%	0.481	S	S	.	.	H	α-helix	trans	-64.3	-44.8	177.6	174.3	0	0	0	0	110.6	Q41 Y42 T47 K48 V49	Q41-V45 WeakPolarHBondContact O-CG2 3.33Å; Q41-V45 PolarHBondContact O-N 3.09Å; Y42-V45 PolarHBondContact O-N 3.01Å; V45-T47 VanDerWaalsContact C-N 3.35Å; V45-T47 PolarHBondContact O-N 3.35Å; V45-K48 PolarHBondContact O-N 3.31Å; V45-V49 HydrophobicContact CG1-CG2 4.39Å; V45-V49 WeakPolarHBondContact O-CG2 3.5Å; V45-V49 PolarHBondContact O-N 3.05Å
46	R	91.7	Very high	91.8	Very high	126 Å²	126	95.2 Å²	95.2	48%	0.475	48%	0.484	S	S	.	.	H	α-helix	trans	-57.4	-46.7	177.6	179.2	174.4	179.9	-101.8	-2.7	111.6	Y42 Q43 V49 I50	Y42-R46 HydrophobicContact CD1-CB 4.44Å; Y42-R46 HydrophobicContact CE1-CB 4.2Å; Y42-R46 VanDerWaalsContact O-CB 3.24Å; Y42-R46 WeakPolarHBondContact O-CB 3.36Å; Y42-R46 PolarHBondContact O-N 3.32Å; Q43-R46 PolarHBondContact O-N 3.21Å; R46-V49 PolarHBondContact O-N 3.48Å; R46-I50 HydrophobicContact CG-CD1 3.81Å; R46-I50 HydrophobicContact CG-CG1 4.47Å; R46-I50 VanDerWaalsContact O-CG1 3.31Å; R46-I50 WeakPolarHBondContact O-CG1 3.45Å; R46-I50 PolarHBondContact O-N 3.41Å
47	T	93.8	Very high	92	Very high	68 Å²	68	96.6 Å²	96.6	42%	0.417	49%	0.49	S	S	.	.	H	α-helix	trans	-62.6	-43.3	177.6	-61	0	0	0	0	111.7	Q43 Q44 V45 V49 I50 N51	Q43-T47 PolarHBondContact O-N 3.41Å; Q43-T47 PolarHBondContact O-OG1 2.85Å; Q43-T47 VanDerWaalsContact O-OG1 3.05Å; Q44-T47 PolarHBondContact O-N 2.91Å; V45-T47 VanDerWaalsContact C-N 3.35Å; V45-T47 PolarHBondContact O-N 3.35Å; T47-V49 VanDerWaalsContact C-N 3.33Å; T47-V49 PolarHBondContact O-N 3.21Å; T47-I50 PolarHBondContact O-N 3.48Å; T47-N51 WeakPolarHBondContact O-CB 3.47Å; T47-N51 VanDerWaalsContact O-CG 3.24Å; T47-N51 PolarHBondContact O-N 2.93Å; T47-N51 PolarHBondContact O-OD1 3.37Å
48	K	92.9	Very high	92.2	Very high	154 Å²	154	96.6 Å²	96.6	67%	0.67	49%	0.494	S	S	*	.	H	α-helix	trans	-58.7	-44.3	175.5	-73.8	178.1	179.4	-177.3	0	112.1	Q44 V45 N51 A52	Q44-K48 WeakPolarHBondContact O-CG 3.33Å; Q44-K48 PolarHBondContact O-N 3.29Å; Q44-K48 VanDerWaalsContact O-N 3.09Å; V45-K48 PolarHBondContact O-N 3.31Å; K48-N51 PolarHBondContact O-N 2.96Å; K48-A52 WeakPolarHBondContact O-CB 3.42Å; K48-A52 PolarHBondContact O-N 3.41Å
49	V	93	Very high	92.2	Very high	78 Å²	78	93 Å²	93	47%	0.473	48%	0.484	S	S	.	.	H	α-helix	trans	-65.3	-44.1	178.2	172.3	0	0	0	0	111.2	V45 R46 T47 A52 L53	V45-V49 HydrophobicContact CG1-CG2 4.39Å; V45-V49 WeakPolarHBondContact O-CG2 3.5Å; V45-V49 PolarHBondContact O-N 3.05Å; R46-V49 PolarHBondContact O-N 3.48Å; T47-V49 VanDerWaalsContact C-N 3.33Å; T47-V49 PolarHBondContact O-N 3.21Å; V49-A52 PolarHBondContact O-N 3.09Å; V49-L53 HydrophobicContact CG1-CD1 3.82Å; V49-L53 HydrophobicContact CG1-CG 4.4Å; V49-L53 WeakPolarHBondContact O-CB 3.31Å; V49-L53 VanDerWaalsContact O-CG 3.31Å; V49-L53 WeakPolarHBondContact O-CG 3.46Å; V49-L53 PolarHBondContact O-N 3.05Å
50	I	94	Very high	92.2	Very high	78 Å²	78	97.9 Å²	97.9	40%	0.4	50%	0.498	S	S	.	.	H	α-helix	trans	-61.1	-46.2	177.5	-71.5	169.1	0	0	0	110.6	R46 T47 A52 L53 S54	R46-I50 HydrophobicContact CG-CD1 3.81Å; R46-I50 HydrophobicContact CG-CG1 4.47Å; R46-I50 VanDerWaalsContact O-CG1 3.31Å; R46-I50 WeakPolarHBondContact O-CG1 3.45Å; R46-I50 PolarHBondContact O-N 3.41Å; T47-I50 PolarHBondContact O-N 3.48Å; I50-A52 PolarHBondContact O-N 2.92Å; I50-L53 PolarHBondContact O-N 3.28Å; I50-S54 WeakPolarHBondContact O-CB 3.22Å; I50-S54 PolarHBondContact O-N 3.23Å
51	N	93	Very high	92.1	Very high	92 Å²	92	97 Å²	97	49%	0.492	49%	0.491	S	S	.	.	H	α-helix	trans	-62	-45.7	179.6	-68.3	-4	0	0	0	111.3	T47 K48 L53 S54 D55	T47-N51 WeakPolarHBondContact O-CB 3.47Å; T47-N51 VanDerWaalsContact O-CG 3.24Å; T47-N51 PolarHBondContact O-N 2.93Å; T47-N51 PolarHBondContact O-OD1 3.37Å; K48-N51 PolarHBondContact O-N 2.96Å; N51-L53 VanDerWaalsContact C-N 3.29Å; N51-L53 PolarHBondContact O-N 3.49Å; N51-S54 WeakPolarHBondContact O-CB 3.31Å; N51-S54 PolarHBondContact O-N 3.07Å; N51-S54 VanDerWaalsContact O-N 3.17Å; N51-D55 PolarHBondContact O-N 3.22Å
52	A	90.9	Very high	92.1	Very high	65 Å²	65	94.8 Å²	94.8	54%	0.537	48%	0.482	S	S	.	.	H	α-helix	trans	-62.9	-34.8	177	0	0	0	0	0	113	K48 V49 I50	K48-A52 WeakPolarHBondContact O-CB 3.42Å; K48-A52 PolarHBondContact O-N 3.41Å; V49-A52 PolarHBondContact O-N 3.09Å; I50-A52 PolarHBondContact O-N 2.92Å
53	L	92.6	Very high	92.1	Very high	90 Å²	90	95 Å²	95	47%	0.471	49%	0.489	S	S	.	.	H	α-helix	trans	-74.5	-34.6	174.9	-73.2	171.7	0	0	0	112.2	V49 I50 N51 K56 I57	V49-L53 HydrophobicContact CG1-CD1 3.82Å; V49-L53 HydrophobicContact CG1-CG 4.4Å; V49-L53 WeakPolarHBondContact O-CB 3.31Å; V49-L53 VanDerWaalsContact O-CG 3.31Å; V49-L53 WeakPolarHBondContact O-CG 3.46Å; V49-L53 PolarHBondContact O-N 3.05Å; I50-L53 PolarHBondContact O-N 3.28Å; N51-L53 VanDerWaalsContact C-N 3.29Å; N51-L53 PolarHBondContact O-N 3.49Å; L53-K56 PolarHBondContact O-N 2.81Å; L53-I57 WeakPolarHBondContact O-CB 3.32Å; L53-I57 WeakPolarHBondContact O-CD1 3.39Å; L53-I57 VanDerWaalsContact O-CG1 3.22Å; L53-I57 WeakPolarHBondContact O-CG1 3.48Å; L53-I57 PolarHBondContact O-N 2.99Å
54	S	91.4	Very high	92.1	Very high	51 Å²	51	95.6 Å²	95.6	36%	0.357	49%	0.491	S	S	.	.	H	α-helix	trans	-57.5	-52.4	177.4	-163	0	0	0	0	110.3	I50 N51 K56 I57 D58	I50-S54 WeakPolarHBondContact O-CB 3.22Å; I50-S54 PolarHBondContact O-N 3.23Å; N51-S54 WeakPolarHBondContact O-CB 3.31Å; N51-S54 PolarHBondContact O-N 3.07Å; N51-S54 VanDerWaalsContact O-N 3.17Å; S54-K56 PolarHBondContact O-N 2.79Å; S54-I57 PolarHBondContact O-N 2.92Å; S54-I57 VanDerWaalsContact O-N 3.08Å; S54-D58 PolarHBondContact O-N 3.39Å
55	D	88.4	Confident	91.9	Very high	101 Å²	101	94.9 Å²	94.9	54%	0.54	49%	0.49	S	S	.	.	H	α-helix	trans	-59.1	-38.1	178.8	-64.1	-18.4	0	0	0	111.7	N51 N59	N51-D55 PolarHBondContact O-N 3.22Å; D55-N59 WeakPolarHBondContact O-CB 3.31Å; D55-N59 PolarHBondContact O-N 3.17Å; D55-N59 PolarHBondContact O-ND2 3.45Å
56	K	92.6	Very high	91.6	Very high	153 Å²	153	99.4 Å²	99.4	67%	0.665	50%	0.497	S	S	*	.	H	α-helix	trans	-70.1	-38.4	178.7	-167.9	172.7	-176.1	178.6	0	112	L53 S54 Y60	L53-K56 PolarHBondContact O-N 2.81Å; S54-K56 PolarHBondContact O-N 2.79Å; K56-Y60 WeakPolarHBondContact O-CB 3.34Å; K56-Y60 PolarHBondContact O-N 3.48Å
57	I	92.4	Very high	90.9	Very high	99 Å²	99	100.6 Å²	100.6	51%	0.508	51%	0.506	S	S	.	.	H	α-helix	trans	-66.1	-46.2	175.9	-70.7	163.6	0	0	0	109.6	L53 S54 N59 Y60 V61	L53-I57 WeakPolarHBondContact O-CB 3.32Å; L53-I57 WeakPolarHBondContact O-CD1 3.39Å; L53-I57 VanDerWaalsContact O-CG1 3.22Å; L53-I57 WeakPolarHBondContact O-CG1 3.48Å; L53-I57 PolarHBondContact O-N 2.99Å; S54-I57 PolarHBondContact O-N 2.92Å; S54-I57 VanDerWaalsContact O-N 3.08Å; I57-N59 PolarHBondContact O-N 3Å; I57-Y60 WeakPolarHBondContact O-CB 3.4Å; I57-Y60 PolarHBondContact O-N 3.5Å; I57-Y60 VanDerWaalsContact O-N 3.15Å; I57-V61 HydrophobicContact CG2-CG2 4.16Å; I57-V61 WeakPolarHBondContact O-CB 3.39Å; I57-V61 VanDerWaalsContact O-CG2 3.3Å; I57-V61 WeakPolarHBondContact O-CG2 3.49Å; I57-V61 PolarHBondContact O-N 2.95Å
58	D	91.7	Very high	89.3	Confident	85 Å²	85	105.3 Å²	105.3	46%	0.455	52%	0.521	S	S	.	.	H	α-helix	trans	-60.6	-45.7	180	-69	-23.7	0	0	0	111.2	S54 Y60 V61 L62	S54-D58 PolarHBondContact O-N 3.39Å; D58-Y60 PolarHBondContact O-N 3.19Å; D58-V61 PolarHBondContact O-N 3.43Å; D58-L62 WeakPolarHBondContact O-CB 3.45Å; D58-L62 VanDerWaalsContact O-CG 3.24Å; D58-L62 WeakPolarHBondContact O-CG 3.22Å; D58-L62 PolarHBondContact O-N 2.9Å
59	N	90.5	Very high	87.4	Confident	95 Å²	95	107.1 Å²	107.1	51%	0.508	55%	0.548	S	S	.	.	H	α-helix	trans	-62.1	-43	174.6	-76.2	-52.9	0	0	0	112.3	D55 I57 L62 D63	D55-N59 WeakPolarHBondContact O-CB 3.31Å; D55-N59 PolarHBondContact O-N 3.17Å; D55-N59 PolarHBondContact O-ND2 3.45Å; I57-N59 PolarHBondContact O-N 3Å; N59-L62 PolarHBondContact O-N 3.43Å; N59-D63 WeakPolarHBondContact O-CB 3.24Å; N59-D63 PolarHBondContact O-N 2.97Å
60	Y	92.1	Very high	87.2	Confident	147 Å²	147	108.6 Å²	108.6	58%	0.576	55%	0.552	S	S	*	*	H	α-helix	trans	-61.1	-47	176.2	177.8	-96.8	0	0	0	111.4	K56 I57 D58 D63 Q64	K56-Y60 WeakPolarHBondContact O-CB 3.34Å; K56-Y60 PolarHBondContact O-N 3.48Å; I57-Y60 WeakPolarHBondContact O-CB 3.4Å; I57-Y60 PolarHBondContact O-N 3.5Å; I57-Y60 VanDerWaalsContact O-N 3.15Å; D58-Y60 PolarHBondContact O-N 3.19Å; Y60-D63 PolarHBondContact O-N 3.34Å; Y60-Q64 HydrophobicContact CD1-CG 4.16Å; Y60-Q64 HydrophobicContact CE1-CG 3.75Å; Y60-Q64 HydrophobicContact CE2-CG 4.4Å; Y60-Q64 VanDerWaalsContact CE2-NE2 3.33Å; Y60-Q64 VanDerWaalsContact O-CG 3.32Å; Y60-Q64 WeakPolarHBondContact O-CG 3.34Å; Y60-Q64 PolarHBondContact O-N 3.15Å; Y60-Q64 PolarHBondContact OH-NE2 2.87Å
61	V	91.1	Very high	86.8	Confident	68 Å²	68	110.2 Å²	110.2	41%	0.412	56%	0.56	S	S	.	*	H	α-helix	trans	-62.7	-45.1	178.6	171.2	0	0	0	0	110.7	I57 D58 D63 Q64 I65	I57-V61 HydrophobicContact CG2-CG2 4.16Å; I57-V61 WeakPolarHBondContact O-CB 3.39Å; I57-V61 VanDerWaalsContact O-CG2 3.3Å; I57-V61 WeakPolarHBondContact O-CG2 3.49Å; I57-V61 PolarHBondContact O-N 2.95Å; D58-V61 PolarHBondContact O-N 3.43Å; V61-D63 VanDerWaalsContact C-N 3.32Å; V61-D63 PolarHBondContact O-N 2.8Å; V61-Q64 PolarHBondContact O-N 3.43Å; V61-I65 HydrophobicContact CG1-CD1 3.84Å; V61-I65 WeakPolarHBondContact O-CG1 3.32Å; V61-I65 PolarHBondContact O-N 3.28Å
62	L	91.6	Very high	86.5	Confident	76 Å²	76	111.2 Å²	111.2	40%	0.398	56%	0.564	S	S	.	*	H	α-helix	trans	-59.3	-42.7	175.3	-74.9	171.8	0	0	0	111.9	D58 N59 I65 R66	D58-L62 WeakPolarHBondContact O-CB 3.45Å; D58-L62 VanDerWaalsContact O-CG 3.24Å; D58-L62 WeakPolarHBondContact O-CG 3.22Å; D58-L62 PolarHBondContact O-N 2.9Å; N59-L62 PolarHBondContact O-N 3.43Å; L62-I65 PolarHBondContact O-N 2.85Å; L62-R66 WeakPolarHBondContact O-CB 3.3Å; L62-R66 VanDerWaalsContact O-CG 3.29Å; L62-R66 WeakPolarHBondContact O-CG 3.47Å; L62-R66 PolarHBondContact O-N 3.08Å
63	D	92.3	Very high	86.2	Confident	75 Å²	75	113.9 Å²	113.9	40%	0.401	57%	0.565	S	S	.	*	H	α-helix	trans	-63.6	-40.2	175.8	-86.4	4.4	0	0	0	112.2	N59 Y60 V61 I65 R66 K67	N59-D63 WeakPolarHBondContact O-CB 3.24Å; N59-D63 PolarHBondContact O-N 2.97Å; Y60-D63 PolarHBondContact O-N 3.34Å; V61-D63 VanDerWaalsContact C-N 3.32Å; V61-D63 PolarHBondContact O-N 2.8Å; D63-I65 VanDerWaalsContact C-N 3.33Å; D63-R66 PolarHBondContact O-N 3.48Å; D63-K67 VanDerWaalsContact O-CB 3.31Å; D63-K67 WeakPolarHBondContact O-CB 3.49Å; D63-K67 VanDerWaalsContact O-CG 3.22Å; D63-K67 WeakPolarHBondContact O-CG 3.21Å; D63-K67 PolarHBondContact O-N 3.12Å
64	Q	90.8	Very high	85.8	Confident	92 Å²	92	115.4 Å²	115.4	43%	0.43	57%	0.571	S	S	.	*	H	α-helix	trans	-65	-37.8	175.9	-65.7	-52.7	-46.2	0	0	111.9	Y60 V61	Y60-Q64 HydrophobicContact CD1-CG 4.16Å; Y60-Q64 HydrophobicContact CE1-CG 3.75Å; Y60-Q64 HydrophobicContact CE2-CG 4.4Å; Y60-Q64 VanDerWaalsContact CE2-NE2 3.33Å; Y60-Q64 VanDerWaalsContact O-CG 3.32Å; Y60-Q64 WeakPolarHBondContact O-CG 3.34Å; Y60-Q64 PolarHBondContact O-N 3.15Å; Y60-Q64 PolarHBondContact OH-NE2 2.87Å; V61-Q64 PolarHBondContact O-N 3.43Å
65	I	89.8	Confident	85.4	Confident	110 Å²	110	119.7 Å²	119.7	56%	0.564	59%	0.585	S	S	*	*	H	α-helix	trans	-70.9	-44.5	177.7	-65.2	166.6	0	0	0	110.7	V61 L62 D63 K67 K68	V61-I65 HydrophobicContact CG1-CD1 3.84Å; V61-I65 WeakPolarHBondContact O-CG1 3.32Å; V61-I65 PolarHBondContact O-N 3.28Å; L62-I65 PolarHBondContact O-N 2.85Å; D63-I65 VanDerWaalsContact C-N 3.33Å; I65-K67 VanDerWaalsContact C-N 3.33Å; I65-K67 PolarHBondContact O-N 2.88Å; I65-K68 WeakPolarHBondContact O-CB 3.29Å; I65-K68 PolarHBondContact O-N 3.3Å; I65-K68 VanDerWaalsContact O-N 3.12Å
66	R	86.9	Confident	85.2	Confident	184 Å²	184	121 Å²	121	69%	0.694	59%	0.588	S	S	*	*	H	α-helix	trans	-67.9	-29.7	-179.8	-73.6	173.8	-179.4	166	0.3	113.5	L62 D63	L62-R66 WeakPolarHBondContact O-CB 3.3Å; L62-R66 VanDerWaalsContact O-CG 3.29Å; L62-R66 WeakPolarHBondContact O-CG 3.47Å; L62-R66 PolarHBondContact O-N 3.08Å; D63-R66 PolarHBondContact O-N 3.48Å
67	K	76.6	Confident	84.6	Confident	152 Å²	152	118.5 Å²	118.5	66%	0.661	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.9	-9.4	173.9	-74.6	175.2	-177.9	175.6	0	113.1	D63 I65 P69	D63-K67 VanDerWaalsContact O-CB 3.31Å; D63-K67 WeakPolarHBondContact O-CB 3.49Å; D63-K67 VanDerWaalsContact O-CG 3.22Å; D63-K67 WeakPolarHBondContact O-CG 3.21Å; D63-K67 PolarHBondContact O-N 3.12Å; I65-K67 VanDerWaalsContact C-N 3.33Å; I65-K67 PolarHBondContact O-N 2.88Å; K67-P69 WeakPolarHBondContact O-CD 3.4Å
68	K	60.3	Low	84	Confident	167 Å²	167	120.2 Å²	120.2	73%	0.726	59%	0.589	S	S	*	*			trans	-68.6	121.9	175.1	-159.8	174.1	-178.5	180	0	107.9	I65	I65-K68 WeakPolarHBondContact O-CB 3.29Å; I65-K68 PolarHBondContact O-N 3.3Å; I65-K68 VanDerWaalsContact O-N 3.12Å
69	P	54.3	Low	83.3	Confident	191 Å²	191	123.4 Å²	123.4	100%	1.24	60%	0.601	S	S	*	*			trans	-63.8	0	-176.1	27.9	-36	0	0	0	112.8	K67	K67-P69 WeakPolarHBondContact O-CD 3.4Å

Retrieved 69 of 69 residues in 57.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).