A0A5K4F8H4_SCHMA Loading...

DUF4258 domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4F8H4, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 80 aa.

						>A0A5K4F8H4_SCHMA|A0A5K4F8H4
MIAQESWLIKYPCHLHDEPIPQLITSTTDHITTKGIISQTENVTHPILTVQDVYRIGNETKQTTLKIIQSYDKKSFLEEY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.6	Very low	38.8	Very low	240 Å²	240	157.5 Å²	157.5	100%	1.182	77%	0.77	S	S	*	*				0	112.8	0	-129.4	-179	-32	0	0	105.7	A3	M1-A3 PolarHBondContact O-N 2.98Å
2	I	38.6	Very low	39.1	Very low	165 Å²	165	150.8 Å²	150.8	85%	0.846	75%	0.747	S	S	*	*			trans	-64	122.8	-157.8	-65	164.7	0	0	0	108.9	Q4	I2-Q4 VanDerWaalsContact C-N 3.26Å; I2-Q4 PolarHBondContact O-N 3.47Å
3	A	38.6	Very low	39.3	Very low	79 Å²	79	147.8 Å²	147.8	65%	0.653	75%	0.748	S	S	*	*			trans	-60	96.7	168.1	0	0	0	0	0	106.4	M1 E5	M1-A3 PolarHBondContact O-N 2.98Å; A3-E5 HydrophobicContact CB-CG 4.45Å; A3-E5 PolarHBondContact O-N 3.28Å
4	Q	39.2	Very low	39.7	Very low	186 Å²	186	146.3 Å²	146.3	87%	0.869	74%	0.736	S	S	*	*			trans	-73	75.7	169	-159.5	154.5	7.7	0	0	105.2	I2 S6	I2-Q4 VanDerWaalsContact C-N 3.26Å; I2-Q4 PolarHBondContact O-N 3.47Å; Q4-S6 PolarHBondContact O-N 3.31Å
5	E	41.2	Very low	40.2	Very low	144 Å²	144	146.1 Å²	146.1	67%	0.673	74%	0.737	S	S	*	*			trans	-46.3	111.6	168.5	-69.6	-179.9	160.8	0	0	105.3	A3 W7	A3-E5 HydrophobicContact CB-CG 4.45Å; A3-E5 PolarHBondContact O-N 3.28Å; E5-W7 VanDerWaalsContact C-N 3.26Å; E5-W7 PolarHBondContact O-N 2.86Å
6	S	40.1	Very low	40.5	Very low	92 Å²	92	145.8 Å²	145.8	64%	0.643	73%	0.732	S	S	*	*			trans	-66.5	97.1	-178.7	68.2	0	0	0	0	106.4	Q4 L8	Q4-S6 PolarHBondContact O-N 3.31Å; S6-L8 CarbonylContact O-C 3.4Å; S6-L8 PolarHBondContact O-N 2.7Å
7	W	33.2	Very low	41.1	Very low	207 Å²	207	146 Å²	146	78%	0.784	74%	0.736	S	S	*	*			trans	-62.2	17.9	166.2	-77.4	79.1	0	0	0	112.7	E5 I9	E5-W7 VanDerWaalsContact C-N 3.26Å; E5-W7 PolarHBondContact O-N 2.86Å; W7-I9 HydrophobicContact CD2-CD1 4.36Å; W7-I9 HydrophobicContact CE3-CD1 3.52Å; W7-I9 HydrophobicContact CE3-CG1 4.4Å; W7-I9 HydrophobicContact CZ3-CD1 3.82Å; W7-I9 PolarHBondContact O-N 3.11Å
8	L	36.5	Very low	41.5	Very low	151 Å²	151	143.3 Å²	143.3	79%	0.791	72%	0.72	S	S	*	*			trans	-64.8	58.5	142.7	-61.4	175.5	0	0	0	108.6	S6 K10	S6-L8 CarbonylContact O-C 3.4Å; S6-L8 PolarHBondContact O-N 2.7Å; L8-K10 PolarHBondContact O-N 2.94Å
9	I	41.3	Very low	42	Very low	89 Å²	89	141.6 Å²	141.6	46%	0.456	72%	0.72	S	S	.	*			trans	-49.7	95.4	145.9	-63.7	173.5	0	0	0	102.8	W7 Y11	W7-I9 HydrophobicContact CD2-CD1 4.36Å; W7-I9 HydrophobicContact CE3-CD1 3.52Å; W7-I9 HydrophobicContact CE3-CG1 4.4Å; W7-I9 HydrophobicContact CZ3-CD1 3.82Å; W7-I9 PolarHBondContact O-N 3.11Å; I9-Y11 HydrophobicContact CB-CE2 4.46Å; I9-Y11 HydrophobicContact CG2-CD2 4.35Å; I9-Y11 HydrophobicContact CG2-CE2 4.24Å; I9-Y11 VanDerWaalsContact O-CD2 3.25Å; I9-Y11 WeakPolarHBondContact O-CD2 3.23Å; I9-Y11 PolarHBondContact O-N 2.72Å
10	K	39.9	Very low	42.5	Very low	187 Å²	187	141.8 Å²	141.8	81%	0.813	72%	0.722	S	S	*	*			trans	-19	84.6	140.8	-144.7	176.5	-170.5	-179.8	0	106.7	L8 P12	L8-K10 PolarHBondContact O-N 2.94Å; K10-P12 VanDerWaalsContact C-N 3.25Å; K10-P12 WeakPolarHBondContact O-CD 3.44Å
11	Y	39.4	Very low	43	Very low	193 Å²	193	137.7 Å²	137.7	76%	0.757	70%	0.704	S	S	*	*			trans	-80.2	90.5	150.7	-77.5	-85.4	0	0	0	101.7	I9 C13	I9-Y11 HydrophobicContact CB-CE2 4.46Å; I9-Y11 HydrophobicContact CG2-CD2 4.35Å; I9-Y11 HydrophobicContact CG2-CE2 4.24Å; I9-Y11 VanDerWaalsContact O-CD2 3.25Å; I9-Y11 WeakPolarHBondContact O-CD2 3.23Å; I9-Y11 PolarHBondContact O-N 2.72Å; Y11-C13 PolarHBondContact O-N 3.02Å
12	P	42.1	Very low	43.6	Very low	77 Å²	77	134.2 Å²	134.2	50%	0.5	69%	0.685	S	S	.	*			trans	-59.4	105.9	152.5	32.4	-32.5	0	0	0	102.2	K10 H14	K10-P12 VanDerWaalsContact C-N 3.25Å; K10-P12 WeakPolarHBondContact O-CD 3.44Å; P12-H14 WeakPolarHBondContact CB-ND1 3.47Å; P12-H14 PolarHBondContact O-N 3.14Å; P12-H14 PolarHBondContact O-ND1 3.32Å
13	C	42.8	Very low	44.3	Very low	111 Å²	111	131.9 Å²	131.9	75%	0.75	67%	0.674	S	S	*	*			trans	-61.3	81.5	164.9	-61.3	0	0	0	0	104.5	Y11 L15	Y11-C13 PolarHBondContact O-N 3.02Å; C13-L15 VanDerWaalsContact C-N 3.28Å; C13-L15 PolarHBondContact O-N 3.36Å
14	H	44.3	Very low	45	Very low	127 Å²	127	134.1 Å²	134.1	59%	0.588	67%	0.673	S	S	*	*			trans	-59.1	107.8	162.1	-76.1	19.5	0	0	0	102.1	P12 H16	P12-H14 WeakPolarHBondContact CB-ND1 3.47Å; P12-H14 PolarHBondContact O-N 3.14Å; P12-H14 PolarHBondContact O-ND1 3.32Å; H14-H16 WeakPolarHBondContact CB-CD2 3.21Å; H14-H16 WeakPolarHBondContact CB-NE2 3.43Å; H14-H16 AromaticContact CD2-NE2 3.74Å; H14-H16 AromaticContact CG-NE2 3.99Å; H14-H16 PolarHBondContact O-N 2.87Å
15	L	47.1	Very low	45.5	Very low	144 Å²	144	128.9 Å²	128.9	75%	0.754	66%	0.655	S	S	*	*			trans	-58.7	72	163.7	-84.9	104.3	0	0	0	106.7	C13 D17	C13-L15 VanDerWaalsContact C-N 3.28Å; C13-L15 PolarHBondContact O-N 3.36Å; L15-D17 PolarHBondContact O-N 3.03Å
16	H	45.5	Very low	45.8	Very low	140 Å²	140	124.5 Å²	124.5	65%	0.648	64%	0.639	S	S	*	*			trans	-73.2	105.6	165.6	-80.9	-71.7	0	0	0	104.7	H14 E18	H14-H16 WeakPolarHBondContact CB-CD2 3.21Å; H14-H16 WeakPolarHBondContact CB-NE2 3.43Å; H14-H16 AromaticContact CD2-NE2 3.74Å; H14-H16 AromaticContact CG-NE2 3.99Å; H14-H16 PolarHBondContact O-N 2.87Å; H16-E18 VanDerWaalsContact C-N 3.33Å; H16-E18 PolarHBondContact O-N 3.25Å
17	D	50.9	Low	46.5	Very low	150 Å²	150	124.4 Å²	124.4	80%	0.802	64%	0.635	S	S	*	*			trans	44	56.9	154.6	-54.6	-48.1	0	0	0	113.3	L15 P19	L15-D17 PolarHBondContact O-N 3.03Å; D17-P19 WeakPolarHBondContact O-CD 3.45Å; D17-P19 VanDerWaalsContact O-N 3.11Å
18	E	48.2	Very low	47.6	Very low	98 Å²	98	116.8 Å²	116.8	46%	0.458	61%	0.612	S	S	.	*	P	Polyproline II helix	trans	-54.3	118.8	-175.7	-165.2	165.1	-154.4	0	0	109	H16 I20 V50	H16-E18 VanDerWaalsContact C-N 3.33Å; H16-E18 PolarHBondContact O-N 3.25Å; E18-I20 PolarHBondContact O-N 3.26Å; E18-V50 HydrophobicContact CG-CG1 4.08Å; E18-V50 WeakPolarHBondContact OE1-CG1 3.39Å; E18-V50 WeakPolarHBondContact OE2-CG1 3.46Å
19	P	50.9	Low	48.5	Very low	110 Å²	110	114.3 Å²	114.3	71%	0.714	60%	0.599	S	S	*	*	P	Polyproline II helix	trans	-61.8	119.3	-174.4	21.7	-30.9	0	0	0	108.8	D17 P21	D17-P19 WeakPolarHBondContact O-CD 3.45Å; D17-P19 VanDerWaalsContact O-N 3.11Å; P19-P21 WeakPolarHBondContact O-CD 3.34Å
20	I	52.1	Low	49	Very low	146 Å²	146	114.1 Å²	114.1	75%	0.749	60%	0.596	S	S	*	*	P	Polyproline II helix	trans	-58.7	121.9	173.4	-58.8	172.5	0	0	0	106.9	E18 Q22	E18-I20 PolarHBondContact O-N 3.26Å; I20-Q22 PolarHBondContact O-N 3.19Å
21	P	51.8	Low	49.6	Very low	56 Å²	56	111.5 Å²	111.5	36%	0.364	59%	0.59	S	S	.	*			trans	-57.2	112.2	177.9	-22.4	31.4	0	0	0	108.8	P19 I47 V50	P19-P21 WeakPolarHBondContact O-CD 3.34Å; P21-I47 HydrophobicContact CB-CG2 3.8Å; P21-V50 HydrophobicContact CG-CG2 3.46Å; P21-V50 VanDerWaalsContact CG-CG2 3.46Å
22	Q	52.9	Low	50.4	Low	166 Å²	166	104.7 Å²	104.7	78%	0.776	57%	0.568	S	S	*	*			trans	-77.3	136.6	176.5	-65.7	-175	28.4	0	0	109.1	I20 I24 I47	I20-Q22 PolarHBondContact O-N 3.19Å; Q22-I24 PolarHBondContact O-N 3.39Å; Q22-I47 WeakPolarHBondContact O-CD1 3.39Å
23	L	52.3	Low	51.2	Low	117 Å²	117	108.6 Å²	108.6	61%	0.613	59%	0.591	S	S	*	*			trans	-64.8	100	173.4	-171.1	71.6	0	0	0	110.1	T25 T44 I47	L23-T25 HydrophobicContact CD2-CG2 4.35Å; L23-T25 HydrophobicContact CG-CG2 4.44Å; L23-T25 PolarHBondContact O-N 3.23Å; L23-T44 HydrophobicContact CD1-CG2 4.32Å; L23-I47 VanDerWaalsContact CA-CD1 3.44Å; L23-I47 HydrophobicContact CB-CD1 4.43Å; L23-I47 HydrophobicContact CD1-CD1 3.87Å
24	I	53.4	Low	52.2	Low	125 Å²	125	112.2 Å²	112.2	64%	0.641	59%	0.594	S	S	*	*			trans	-78.2	104.6	171	-52.3	177.7	0	0	0	107.3	Q22	Q22-I24 PolarHBondContact O-N 3.39Å
25	T	49	Very low	52.6	Low	77 Å²	77	109 Å²	109	47%	0.472	60%	0.596	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-80.9	121.7	164.9	50.1	0	0	0	0	107.3	L23	L23-T25 HydrophobicContact CD2-CG2 4.35Å; L23-T25 HydrophobicContact CG-CG2 4.44Å; L23-T25 PolarHBondContact O-N 3.23Å
26	S	48.6	Very low	53.2	Low	51 Å²	51	107.5 Å²	107.5	36%	0.357	59%	0.587	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-110.3	124	175.1	-177	0	0	0	0	108.7	T28	S26-T28 PolarHBondContact O-N 2.98Å
27	T	54.9	Low	53.7	Low	90 Å²	90	106.5 Å²	106.5	55%	0.552	59%	0.585	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-73	105.4	171.2	-44.6	0	0	0	0	108	T40	T27-T40 HydrophobicContact CG2-CG2 3.1Å
28	T	55.2	Low	53.9	Low	48 Å²	48	101.1 Å²	101.1	29%	0.294	56%	0.559	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-98.5	110.6	171.4	-58.6	0	0	0	0	108	S26 H30	S26-T28 PolarHBondContact O-N 2.98Å; T28-H30 PolarHBondContact O-N 2.99Å; T28-H30 VanDerWaalsContact O-N 3.14Å
29	D	55.2	Low	54.3	Low	99 Å²	99	104.9 Å²	104.9	53%	0.529	58%	0.577	S	S	.	*			trans	-72.5	106.4	172	-67.6	-34.5	0	0	0	108.7	I31	D29-I31 PolarHBondContact O-N 3.1Å
30	H	52.5	Low	54.4	Low	85 Å²	85	103.6 Å²	103.6	39%	0.394	57%	0.567	S	S	.	*			trans	-77.5	113.6	169.8	-85.7	-57.9	0	0	0	109.2	T28 S38 E41	T28-H30 PolarHBondContact O-N 2.99Å; T28-H30 VanDerWaalsContact O-N 3.14Å; H30-S38 WeakPolarHBondContact CB-OG 3.17Å; H30-S38 PolarHBondContact O-N 3.14Å; H30-S38 PolarHBondContact O-OG 3.05Å; H30-E41 IonicContact CD2-OE2 3.74Å
31	I	53.5	Low	54.6	Low	131 Å²	131	102 Å²	102	67%	0.672	56%	0.556	S	S	*	*	B	Isolated β-bridge	trans	-86.6	114.1	169.7	-56	174.2	0	0	0	107.3	D29	D29-I31 PolarHBondContact O-N 3.1Å
32	T	55.3	Low	54.8	Low	50 Å²	50	104.2 Å²	104.2	31%	0.307	57%	0.565	S	S	.	*			trans	-67.4	156.3	173.5	63.7	0	0	0	0	110.7	K34 G35 I36 S38	T32-K34 PolarHBondContact O-N 2.76Å; T32-G35 PolarHBondContact O-N 2.86Å; T32-I36 WeakPolarHBondContact CB-O 3.4Å; T32-I36 PolarHBondContact N-O 3.15Å; T32-I36 VanDerWaalsContact N-O 3.11Å; T32-I36 PolarHBondContact OG1-N 2.67Å; T32-I36 PolarHBondContact OG1-O 3.47Å; T32-S38 VanDerWaalsContact CG2-OG 3.23Å; T32-S38 WeakPolarHBondContact CG2-OG 3.28Å
33	T	58.8	Low	54.9	Low	159 Å²	159	98.4 Å²	98.4	98%	0.975	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.8	-19.1	175.5	-33	0	0	0	0	113	G35	T33-G35 VanDerWaalsContact C-N 3.26Å; T33-G35 PolarHBondContact O-N 2.97Å
34	K	63.8	Low	55.1	Low	188 Å²	188	97.5 Å²	97.5	82%	0.817	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.3	2.4	175.1	-65.2	-173.6	179.3	-179	0	113.6	T32 I36	T32-K34 PolarHBondContact O-N 2.76Å; K34-I36 HydrophobicContact CB-CD1 4.39Å; K34-I36 HydrophobicContact CB-CG1 4.36Å; K34-I36 PolarHBondContact O-N 2.96Å
35	G	53.4	Low	55.5	Low	60 Å²	60	96 Å²	96	62%	0.619	53%	0.53	S	S	*	.	S	Bend	trans	72.5	7.3	-177.3	0	0	0	0	0	114	T32 T33	T32-G35 PolarHBondContact O-N 2.86Å; T33-G35 VanDerWaalsContact C-N 3.26Å; T33-G35 PolarHBondContact O-N 2.97Å
36	I	58.8	Low	56.3	Low	112 Å²	112	98.4 Å²	98.4	57%	0.574	55%	0.547	S	S	*	.			trans	-86.1	123.4	173.7	-55.4	173.2	0	0	0	106.4	T32 K34 S38	T32-I36 WeakPolarHBondContact CB-O 3.4Å; T32-I36 PolarHBondContact N-O 3.15Å; T32-I36 VanDerWaalsContact N-O 3.11Å; T32-I36 PolarHBondContact OG1-N 2.67Å; T32-I36 PolarHBondContact OG1-O 3.47Å; K34-I36 HydrophobicContact CB-CD1 4.39Å; K34-I36 HydrophobicContact CB-CG1 4.36Å; K34-I36 PolarHBondContact O-N 2.96Å; I36-S38 PolarHBondContact O-N 2.94Å
37	I	56	Low	57.3	Low	119 Å²	119	98.9 Å²	98.9	61%	0.61	55%	0.545	S	S	*	.	B	Isolated β-bridge	trans	-61.5	103.1	168.6	-59.9	169.9	0	0	0	105.7
38	S	55	Low	58	Low	37 Å²	37	99.4 Å²	99.4	26%	0.259	54%	0.544	S	S	.	.			trans	-67.4	143.6	170.6	32.2	0	0	0	0	107.5	H30 T32 I36 T40	H30-S38 WeakPolarHBondContact CB-OG 3.17Å; H30-S38 PolarHBondContact O-N 3.14Å; H30-S38 PolarHBondContact O-OG 3.05Å; T32-S38 VanDerWaalsContact CG2-OG 3.23Å; T32-S38 WeakPolarHBondContact CG2-OG 3.28Å; I36-S38 PolarHBondContact O-N 2.94Å; S38-T40 PolarHBondContact O-N 3.11Å
39	Q	56.4	Low	59	Low	176 Å²	176	100.1 Å²	100.1	82%	0.822	55%	0.549	S	S	*	.			trans	-33.9	129.9	179.6	-74	169	-27.1	0	0	111.5	E41	Q39-E41 PolarHBondContact O-N 2.92Å
40	T	53.3	Low	59.9	Low	83 Å²	83	97.4 Å²	97.4	51%	0.509	54%	0.536	S	S	.	.			trans	-43.3	101.4	170	-62.8	0	0	0	0	110.7	T27 S38	T27-T40 HydrophobicContact CG2-CG2 3.1Å; S38-T40 PolarHBondContact O-N 3.11Å
41	E	56.6	Low	61.1	Low	113 Å²	113	100.9 Å²	100.9	53%	0.528	55%	0.552	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-84.2	124.3	173.9	-77.5	-177.6	-173.3	0	0	107.7	H30 Q39 V43	H30-E41 IonicContact CD2-OE2 3.74Å; Q39-E41 PolarHBondContact O-N 2.92Å; E41-V43 PolarHBondContact O-N 2.89Å
42	N	56.4	Low	62.2	Low	103 Å²	103	96.3 Å²	96.3	55%	0.551	53%	0.529	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.1	94.6	176.5	-156.6	0.2	0	0	0	107.9	T44	N42-T44 PolarHBondContact O-N 3.45Å
43	V	54.6	Low	63.3	Low	44 Å²	44	97.9 Å²	97.9	27%	0.267	54%	0.538	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79	108.7	-178.9	-177.3	0	0	0	0	108.4	E41 H45	E41-V43 PolarHBondContact O-N 2.89Å; V43-H45 PolarHBondContact O-N 3.49Å; V43-H45 PolarHBondContact O-ND1 2.88Å
44	T	57	Low	64.4	Low	98 Å²	98	98.4 Å²	98.4	60%	0.601	52%	0.524	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.8	111.3	172.8	-55.6	0	0	0	0	108.4	L23 N42	L23-T44 HydrophobicContact CD1-CG2 4.32Å; N42-T44 PolarHBondContact O-N 3.45Å
45	H	61.4	Low	65.3	Low	92 Å²	92	95.2 Å²	95.2	43%	0.426	51%	0.506	S	S	.	.			trans	-82.4	134.4	173.5	-62	75.5	0	0	0	108.2	V43 I47	V43-H45 PolarHBondContact O-N 3.49Å; V43-H45 PolarHBondContact O-ND1 2.88Å; H45-I47 PolarHBondContact O-N 2.89Å
46	P	66.3	Low	66.8	Low	128 Å²	128	95.9 Å²	95.9	83%	0.831	50%	0.495	S	S	*	.			trans	-62.1	111.6	172.6	24.5	-30.4	0	0	0	108.1
47	I	68.9	Low	68	Low	61 Å²	61	92.6 Å²	92.6	31%	0.313	49%	0.489	S	S	.	.	P	Polyproline II helix	trans	-82.3	127.5	173.9	-62.7	-177.6	0	0	0	106.7	P21 Q22 L23 H45 T49	P21-I47 HydrophobicContact CB-CG2 3.8Å; Q22-I47 WeakPolarHBondContact O-CD1 3.39Å; L23-I47 VanDerWaalsContact CA-CD1 3.44Å; L23-I47 HydrophobicContact CB-CD1 4.43Å; L23-I47 HydrophobicContact CD1-CD1 3.87Å; H45-I47 PolarHBondContact O-N 2.89Å; I47-T49 PolarHBondContact O-N 3.29Å; I47-T49 VanDerWaalsContact O-N 3.1Å
48	L	69.3	Low	69.4	Low	102 Å²	102	90.5 Å²	90.5	53%	0.534	48%	0.479	S	S	.	.	P	Polyproline II helix	trans	-56.7	120.8	169.6	-67.7	177.2	0	0	0	107.8	D52 V53 I56	L48-D52 HydrophobicContact CB-CB 4.22Å; L48-D52 HydrophobicContact CD2-CB 3.98Å; L48-V53 HydrophobicContact CB-CG2 4.13Å; L48-I56 HydrophobicContact CD1-CD1 4.46Å
49	T	76.7	Confident	71	Confident	63 Å²	63	93.8 Å²	93.8	39%	0.387	49%	0.49	S	S	.	.	P	Polyproline II helix	trans	-66.3	159	172.9	66.9	0	0	0	0	108.8	I47 Q51 D52 V53	I47-T49 PolarHBondContact O-N 3.29Å; I47-T49 VanDerWaalsContact O-N 3.1Å; T49-Q51 PolarHBondContact O-N 3.35Å; T49-Q51 VanDerWaalsContact O-N 3.14Å; T49-Q51 PolarHBondContact OG1-N 2.82Å; T49-D52 WeakPolarHBondContact CB-OD2 3.3Å; T49-D52 PolarHBondContact N-OD2 2.92Å; T49-D52 WeakPolarHBondContact O-CB 3.48Å; T49-D52 PolarHBondContact O-N 3.46Å; T49-D52 VanDerWaalsContact OG1-CG 3.24Å; T49-D52 PolarHBondContact OG1-N 3.22Å; T49-D52 VanDerWaalsContact OG1-N 3.15Å; T49-D52 PolarHBondContact OG1-OD2 3.49Å; T49-V53 PolarHBondContact O-N 3.04Å; T49-V53 VanDerWaalsContact O-N 3.11Å
50	V	73.6	Confident	72.4	Confident	42 Å²	42	89.1 Å²	89.1	26%	0.255	47%	0.474	S	S	.	.	H	α-helix	trans	-51.2	-38	170.8	179.4	0	0	0	0	111	E18 P21 D52 V53 Y54	E18-V50 HydrophobicContact CG-CG1 4.08Å; E18-V50 WeakPolarHBondContact OE1-CG1 3.39Å; E18-V50 WeakPolarHBondContact OE2-CG1 3.46Å; P21-V50 HydrophobicContact CG-CG2 3.46Å; P21-V50 VanDerWaalsContact CG-CG2 3.46Å; V50-D52 PolarHBondContact O-N 3.4Å; V50-V53 PolarHBondContact O-N 3.48Å; V50-Y54 WeakPolarHBondContact O-CB 3.18Å; V50-Y54 PolarHBondContact O-N 3.38Å
51	Q	77.3	Confident	74	Confident	158 Å²	158	91.7 Å²	91.7	74%	0.738	48%	0.478	S	S	*	.	H	α-helix	trans	-64.2	-37.5	177.5	-68	-177.2	-20.1	0	0	112.7	T49 R55	T49-Q51 PolarHBondContact O-N 3.35Å; T49-Q51 VanDerWaalsContact O-N 3.14Å; T49-Q51 PolarHBondContact OG1-N 2.82Å; Q51-R55 VanDerWaalsContact O-CB 3.28Å; Q51-R55 WeakPolarHBondContact O-CB 3.39Å; Q51-R55 PolarHBondContact O-N 2.88Å
52	D	78.4	Confident	75.4	Confident	34 Å²	34	90.6 Å²	90.6	18%	0.182	47%	0.473	C	S	.	.	H	α-helix	trans	-65.5	-44.5	174.8	-62.5	-53.7	0	0	0	111.1	L48 T49 V50 Y54 R55 I56	L48-D52 HydrophobicContact CB-CB 4.22Å; L48-D52 HydrophobicContact CD2-CB 3.98Å; T49-D52 WeakPolarHBondContact CB-OD2 3.3Å; T49-D52 PolarHBondContact N-OD2 2.92Å; T49-D52 WeakPolarHBondContact O-CB 3.48Å; T49-D52 PolarHBondContact O-N 3.46Å; T49-D52 VanDerWaalsContact OG1-CG 3.24Å; T49-D52 PolarHBondContact OG1-N 3.22Å; T49-D52 VanDerWaalsContact OG1-N 3.15Å; T49-D52 PolarHBondContact OG1-OD2 3.49Å; V50-D52 PolarHBondContact O-N 3.4Å; D52-Y54 PolarHBondContact O-N 2.92Å; D52-R55 PolarHBondContact O-N 2.93Å; D52-R55 IonicContact OD1-CZ 3.25Å; D52-R55 VanDerWaalsContact OD1-CZ 3.25Å; D52-R55 IonicContact OD1-NH1 2.86Å; D52-R55 PolarHBondContact OD1-NH1 3.39Å; D52-R55 IonicContact OD1-NH2 2.76Å; D52-R55 PolarHBondContact OD1-NH2 2.75Å; D52-I56 WeakPolarHBondContact O-CB 3.47Å; D52-I56 WeakPolarHBondContact O-CD1 3.29Å; D52-I56 WeakPolarHBondContact O-CG1 3.39Å; D52-I56 PolarHBondContact O-N 2.99Å
53	V	78.6	Confident	76.8	Confident	83 Å²	83	89.2 Å²	89.2	50%	0.503	47%	0.468	S	S	.	.	H	α-helix	trans	-61.7	-45.1	177.3	178.8	0	0	0	0	110.9	L48 T49 V50 I56 G57	L48-V53 HydrophobicContact CB-CG2 4.13Å; T49-V53 PolarHBondContact O-N 3.04Å; T49-V53 VanDerWaalsContact O-N 3.11Å; V50-V53 PolarHBondContact O-N 3.48Å; V53-I56 PolarHBondContact O-N 3.48Å; V53-G57 PolarHBondContact O-N 2.95Å
54	Y	80.4	Confident	78.1	Confident	171 Å²	171	90.5 Å²	90.5	67%	0.671	48%	0.476	S	S	*	.	H	α-helix	trans	-63.5	-43.9	177.8	-172	-93.5	0	0	0	112.1	V50 D52 G57 N58	V50-Y54 WeakPolarHBondContact O-CB 3.18Å; V50-Y54 PolarHBondContact O-N 3.38Å; D52-Y54 PolarHBondContact O-N 2.92Å; Y54-G57 PolarHBondContact O-N 3Å; Y54-N58 WeakPolarHBondContact O-CB 3.44Å; Y54-N58 PolarHBondContact O-N 3.21Å
55	R	84.2	Confident	79.4	Confident	120 Å²	120	89.4 Å²	89.4	45%	0.453	47%	0.466	S	S	.	.	H	α-helix	trans	-60.2	-51.5	176.3	-177.1	177.4	70	-112.7	-3	111	Q51 D52 G57 N58 E59	Q51-R55 VanDerWaalsContact O-CB 3.28Å; Q51-R55 WeakPolarHBondContact O-CB 3.39Å; Q51-R55 PolarHBondContact O-N 2.88Å; D52-R55 PolarHBondContact O-N 2.93Å; D52-R55 IonicContact OD1-CZ 3.25Å; D52-R55 VanDerWaalsContact OD1-CZ 3.25Å; D52-R55 IonicContact OD1-NH1 2.86Å; D52-R55 PolarHBondContact OD1-NH1 3.39Å; D52-R55 IonicContact OD1-NH2 2.76Å; D52-R55 PolarHBondContact OD1-NH2 2.75Å; R55-G57 VanDerWaalsContact C-N 3.31Å; R55-G57 PolarHBondContact O-N 3.21Å; R55-N58 PolarHBondContact O-N 2.68Å; R55-E59 HydrophobicContact CG-CG 4.44Å; R55-E59 VanDerWaalsContact CG-OE1 3.3Å; R55-E59 WeakPolarHBondContact CG-OE1 3.34Å; R55-E59 WeakPolarHBondContact O-CB 3.28Å; R55-E59 WeakPolarHBondContact O-CG 3.49Å; R55-E59 PolarHBondContact O-N 3.27Å
56	I	83.8	Confident	80.4	Confident	74 Å²	74	91.7 Å²	91.7	38%	0.379	48%	0.475	S	S	.	.	H	α-helix	trans	-58.3	-44.6	178.2	-68.6	163.9	0	0	0	110.5	L48 D52 V53 E59 T60	L48-I56 HydrophobicContact CD1-CD1 4.46Å; D52-I56 WeakPolarHBondContact O-CB 3.47Å; D52-I56 WeakPolarHBondContact O-CD1 3.29Å; D52-I56 WeakPolarHBondContact O-CG1 3.39Å; D52-I56 PolarHBondContact O-N 2.99Å; V53-I56 PolarHBondContact O-N 3.48Å; I56-E59 PolarHBondContact O-N 3.39Å; I56-T60 VanDerWaalsContact O-CB 3.29Å; I56-T60 WeakPolarHBondContact O-CB 3.35Å; I56-T60 PolarHBondContact O-N 3.45Å; I56-T60 PolarHBondContact O-OG1 3.04Å
57	G	83.2	Confident	81.2	Confident	43 Å²	43	89.5 Å²	89.5	44%	0.443	46%	0.456	S	S	.	.	H	α-helix	trans	-60.9	-45	177.4	0	0	0	0	0	112.6	V53 Y54 R55 K61	V53-G57 PolarHBondContact O-N 2.95Å; Y54-G57 PolarHBondContact O-N 3Å; R55-G57 VanDerWaalsContact C-N 3.31Å; R55-G57 PolarHBondContact O-N 3.21Å; G57-K61 WeakPolarHBondContact O-CB 3.33Å; G57-K61 PolarHBondContact O-N 3.48Å
58	N	86.5	Confident	81.7	Confident	76 Å²	76	90.6 Å²	90.6	41%	0.406	46%	0.461	S	S	.	.	H	α-helix	trans	-68.3	-43.4	178.3	-177	62.2	0	0	0	112.4	Y54 R55 T60 K61 Q62	Y54-N58 WeakPolarHBondContact O-CB 3.44Å; Y54-N58 PolarHBondContact O-N 3.21Å; R55-N58 PolarHBondContact O-N 2.68Å; N58-T60 VanDerWaalsContact C-N 3.35Å; N58-T60 PolarHBondContact O-N 2.92Å; N58-K61 PolarHBondContact O-N 3.05Å; N58-Q62 WeakPolarHBondContact O-CB 3.45Å; N58-Q62 VanDerWaalsContact O-CG 3.28Å; N58-Q62 WeakPolarHBondContact O-CG 3.3Å; N58-Q62 PolarHBondContact O-N 3.42Å
59	E	88.6	Confident	82.2	Confident	105 Å²	105	91 Å²	91	49%	0.491	46%	0.46	S	S	.	.	H	α-helix	trans	-61	-43.9	176	-74.8	175.4	-171.7	0	0	111.8	R55 I56 Q62 T63	R55-E59 HydrophobicContact CG-CG 4.44Å; R55-E59 VanDerWaalsContact CG-OE1 3.3Å; R55-E59 WeakPolarHBondContact CG-OE1 3.34Å; R55-E59 WeakPolarHBondContact O-CB 3.28Å; R55-E59 WeakPolarHBondContact O-CG 3.49Å; R55-E59 PolarHBondContact O-N 3.27Å; I56-E59 PolarHBondContact O-N 3.39Å; E59-Q62 PolarHBondContact O-N 3.47Å; E59-T63 WeakPolarHBondContact O-CB 3.48Å; E59-T63 PolarHBondContact O-N 3Å; E59-T63 PolarHBondContact O-OG1 3.5Å
60	T	85.8	Confident	82.2	Confident	78 Å²	78	90.9 Å²	90.9	48%	0.479	46%	0.462	S	S	.	.	H	α-helix	trans	-61.4	-47.9	175.7	-57.6	0	0	0	0	110.5	I56 N58 Q62 T63 T64	I56-T60 VanDerWaalsContact O-CB 3.29Å; I56-T60 WeakPolarHBondContact O-CB 3.35Å; I56-T60 PolarHBondContact O-N 3.45Å; I56-T60 PolarHBondContact O-OG1 3.04Å; N58-T60 VanDerWaalsContact C-N 3.35Å; N58-T60 PolarHBondContact O-N 2.92Å; T60-Q62 PolarHBondContact O-N 3.48Å; T60-T63 PolarHBondContact O-N 3.31Å; T60-T64 PolarHBondContact O-N 3.04Å; T60-T64 PolarHBondContact O-OG1 3.24Å; T60-T64 VanDerWaalsContact O-OG1 3.05Å
61	K	86.2	Confident	82.2	Confident	137 Å²	137	96.1 Å²	96.1	60%	0.596	48%	0.478	S	S	*	.	H	α-helix	trans	-57.3	-47.7	176.9	-179.1	179.8	177.7	179.5	0	112.1	G57 N58 T63 T64 L65	G57-K61 WeakPolarHBondContact O-CB 3.33Å; G57-K61 PolarHBondContact O-N 3.48Å; N58-K61 PolarHBondContact O-N 3.05Å; K61-T63 VanDerWaalsContact C-N 3.33Å; K61-T63 PolarHBondContact O-N 2.63Å; K61-T64 PolarHBondContact O-N 3.06Å; K61-L65 HydrophobicContact CG-CD1 4.16Å; K61-L65 WeakPolarHBondContact O-CB 3.3Å; K61-L65 VanDerWaalsContact O-CG 3.3Å; K61-L65 WeakPolarHBondContact O-CG 3.5Å; K61-L65 PolarHBondContact O-N 3.5Å
62	Q	86.3	Confident	81.8	Confident	90 Å²	90	93.5 Å²	93.5	42%	0.421	47%	0.469	S	S	.	.	H	α-helix	trans	-63.5	-39.9	179.2	-71.2	-66	-16.6	0	0	112	N58 E59 T60 L65 K66	N58-Q62 WeakPolarHBondContact O-CB 3.45Å; N58-Q62 VanDerWaalsContact O-CG 3.28Å; N58-Q62 WeakPolarHBondContact O-CG 3.3Å; N58-Q62 PolarHBondContact O-N 3.42Å; E59-Q62 PolarHBondContact O-N 3.47Å; T60-Q62 PolarHBondContact O-N 3.48Å; Q62-L65 PolarHBondContact O-N 3.2Å; Q62-K66 WeakPolarHBondContact O-CG 3.25Å; Q62-K66 PolarHBondContact O-N 2.91Å
63	T	85.8	Confident	81	Confident	75 Å²	75	99 Å²	99	46%	0.46	49%	0.492	S	S	.	.	H	α-helix	trans	-65.2	-48.1	177.7	-58	0	0	0	0	111.1	E59 T60 K61 L65 K66 I67	E59-T63 WeakPolarHBondContact O-CB 3.48Å; E59-T63 PolarHBondContact O-N 3Å; E59-T63 PolarHBondContact O-OG1 3.5Å; T60-T63 PolarHBondContact O-N 3.31Å; K61-T63 VanDerWaalsContact C-N 3.33Å; K61-T63 PolarHBondContact O-N 2.63Å; T63-L65 VanDerWaalsContact C-N 3.33Å; T63-L65 PolarHBondContact O-N 2.97Å; T63-K66 PolarHBondContact O-N 2.88Å; T63-I67 HydrophobicContact CG2-CD1 4.01Å; T63-I67 WeakPolarHBondContact O-CG1 3.44Å; T63-I67 PolarHBondContact O-N 3.08Å
64	T	82.8	Confident	80.4	Confident	71 Å²	71	101.1 Å²	101.1	44%	0.436	49%	0.494	S	S	.	.	H	α-helix	trans	-58.9	-43.3	176.4	-57.7	0	0	0	0	111.8	T60 K61 K66 I67 I68	T60-T64 PolarHBondContact O-N 3.04Å; T60-T64 PolarHBondContact O-OG1 3.24Å; T60-T64 VanDerWaalsContact O-OG1 3.05Å; K61-T64 PolarHBondContact O-N 3.06Å; T64-K66 PolarHBondContact O-N 2.64Å; T64-I67 PolarHBondContact O-N 2.96Å; T64-I68 HydrophobicContact CG2-CD1 3.96Å; T64-I68 WeakPolarHBondContact O-CG1 3.45Å; T64-I68 PolarHBondContact O-N 3.03Å
65	L	83.7	Confident	79.2	Confident	75 Å²	75	96 Å²	96	39%	0.393	48%	0.483	S	S	.	.	H	α-helix	trans	-62	-42.7	176.8	-73.6	171.9	0	0	0	112.4	K61 Q62 T63 I67 I68 Q69	K61-L65 HydrophobicContact CG-CD1 4.16Å; K61-L65 WeakPolarHBondContact O-CB 3.3Å; K61-L65 VanDerWaalsContact O-CG 3.3Å; K61-L65 WeakPolarHBondContact O-CG 3.5Å; K61-L65 PolarHBondContact O-N 3.5Å; Q62-L65 PolarHBondContact O-N 3.2Å; T63-L65 VanDerWaalsContact C-N 3.33Å; T63-L65 PolarHBondContact O-N 2.97Å; L65-I67 VanDerWaalsContact C-N 3.34Å; L65-I67 PolarHBondContact O-N 3.44Å; L65-I68 PolarHBondContact O-N 3.47Å; L65-Q69 WeakPolarHBondContact O-CB 3.38Å; L65-Q69 VanDerWaalsContact O-CG 3.25Å; L65-Q69 WeakPolarHBondContact O-CG 3.2Å; L65-Q69 PolarHBondContact O-N 2.94Å
66	K	82.9	Confident	77.6	Confident	139 Å²	139	96.8 Å²	96.8	60%	0.604	49%	0.49	S	S	*	.	H	α-helix	trans	-62.1	-41.3	175.4	-75.3	175.6	-178.1	177.6	0	112.1	Q62 T63 T64 Q69 S70	Q62-K66 WeakPolarHBondContact O-CG 3.25Å; Q62-K66 PolarHBondContact O-N 2.91Å; T63-K66 PolarHBondContact O-N 2.88Å; T64-K66 PolarHBondContact O-N 2.64Å; K66-Q69 PolarHBondContact O-N 3.41Å; K66-S70 WeakPolarHBondContact O-CB 3.25Å; K66-S70 PolarHBondContact O-N 2.73Å
67	I	82	Confident	76.3	Confident	83 Å²	83	99.6 Å²	99.6	43%	0.426	51%	0.505	S	S	.	.	H	α-helix	trans	-61.8	-50.1	177.9	-69.9	168.2	0	0	0	109.9	T63 T64 L65 Q69 S70 Y71	T63-I67 HydrophobicContact CG2-CD1 4.01Å; T63-I67 WeakPolarHBondContact O-CG1 3.44Å; T63-I67 PolarHBondContact O-N 3.08Å; T64-I67 PolarHBondContact O-N 2.96Å; L65-I67 VanDerWaalsContact C-N 3.34Å; L65-I67 PolarHBondContact O-N 3.44Å; I67-Q69 PolarHBondContact O-N 2.7Å; I67-S70 WeakPolarHBondContact O-CB 2.79Å; I67-S70 PolarHBondContact O-N 2.78Å; I67-S70 VanDerWaalsContact O-N 3.08Å; I67-S70 PolarHBondContact O-OG 3Å; I67-Y71 HydrophobicContact CG2-CD2 3.71Å; I67-Y71 HydrophobicContact CG2-CE2 3.39Å; I67-Y71 WeakPolarHBondContact O-CD2 3.44Å; I67-Y71 PolarHBondContact O-N 3.31Å
68	I	79.7	Confident	75.2	Confident	83 Å²	83	104.9 Å²	104.9	43%	0.426	52%	0.518	S	S	.	.	H	α-helix	trans	-58.4	-48.9	178.3	-66.2	165.2	0	0	0	110.7	T64 L65 S70 Y71 D72	T64-I68 HydrophobicContact CG2-CD1 3.96Å; T64-I68 WeakPolarHBondContact O-CG1 3.45Å; T64-I68 PolarHBondContact O-N 3.03Å; L65-I68 PolarHBondContact O-N 3.47Å; I68-S70 PolarHBondContact O-N 3.39Å; I68-Y71 PolarHBondContact O-N 3.02Å; I68-D72 PolarHBondContact O-N 2.98Å
69	Q	79.4	Confident	73.8	Confident	112 Å²	112	109.1 Å²	109.1	52%	0.523	54%	0.536	S	S	.	.	H	α-helix	trans	-59.7	-31.2	177	-72.9	174.8	-12.2	0	0	113.3	L65 K66 I67 K73	L65-Q69 WeakPolarHBondContact O-CB 3.38Å; L65-Q69 VanDerWaalsContact O-CG 3.25Å; L65-Q69 WeakPolarHBondContact O-CG 3.2Å; L65-Q69 PolarHBondContact O-N 2.94Å; K66-Q69 PolarHBondContact O-N 3.41Å; I67-Q69 PolarHBondContact O-N 2.7Å; Q69-K73 WeakPolarHBondContact O-CG 3.32Å; Q69-K73 PolarHBondContact O-N 3.13Å
70	S	77	Confident	71.9	Confident	60 Å²	60	116.4 Å²	116.4	42%	0.42	56%	0.56	S	S	.	*	H	α-helix	trans	-72.9	-35.2	176	76.5	0	0	0	0	112.3	K66 I67 I68 K73 K74	K66-S70 WeakPolarHBondContact O-CB 3.25Å; K66-S70 PolarHBondContact O-N 2.73Å; I67-S70 WeakPolarHBondContact O-CB 2.79Å; I67-S70 PolarHBondContact O-N 2.78Å; I67-S70 VanDerWaalsContact O-N 3.08Å; I67-S70 PolarHBondContact O-OG 3Å; I68-S70 PolarHBondContact O-N 3.39Å; S70-K73 PolarHBondContact O-N 3.08Å; S70-K74 PolarHBondContact O-N 2.87Å
71	Y	73.4	Confident	71.3	Confident	152 Å²	152	118.3 Å²	118.3	60%	0.596	56%	0.564	S	S	*	*	H	α-helix	trans	-70.4	-42.7	174.3	-77	-67.1	0	0	0	111.7	I67 I68 K73 K74 S75	I67-Y71 HydrophobicContact CG2-CD2 3.71Å; I67-Y71 HydrophobicContact CG2-CE2 3.39Å; I67-Y71 WeakPolarHBondContact O-CD2 3.44Å; I67-Y71 PolarHBondContact O-N 3.31Å; I68-Y71 PolarHBondContact O-N 3.02Å; Y71-K73 PolarHBondContact O-N 3.45Å; Y71-K74 PolarHBondContact O-N 2.83Å; Y71-S75 PolarHBondContact O-N 3.42Å; Y71-S75 PolarHBondContact O-OG 3.31Å
72	D	68.6	Low	70.5	Confident	102 Å²	102	117.3 Å²	117.3	55%	0.545	56%	0.563	S	S	.	*	H	α-helix	trans	-59.6	-34.4	175.7	-70.5	-19.3	0	0	0	111.9	I68 S75 F76	I68-D72 PolarHBondContact O-N 2.98Å; D72-S75 PolarHBondContact O-OG 3.27Å; D72-S75 VanDerWaalsContact O-OG 3.13Å; D72-F76 PolarHBondContact O-N 3.25Å
73	K	62.9	Low	69.6	Low	151 Å²	151	118.8 Å²	118.8	66%	0.657	57%	0.571	S	S	*	*	H	α-helix	trans	-74.1	-35.2	173.7	-73	177.5	-176	-177.5	0	112.8	Q69 S70 Y71 L77	Q69-K73 WeakPolarHBondContact O-CG 3.32Å; Q69-K73 PolarHBondContact O-N 3.13Å; S70-K73 PolarHBondContact O-N 3.08Å; Y71-K73 PolarHBondContact O-N 3.45Å; K73-L77 WeakPolarHBondContact O-CG 3.34Å; K73-L77 PolarHBondContact O-N 3.18Å
74	K	64.6	Low	68.6	Low	127 Å²	127	121.4 Å²	121.4	55%	0.552	58%	0.577	S	S	*	*	H	α-helix	trans	-70.9	-45.6	179.1	-107	-171	173	-168.9	0	111.9	S70 Y71 F76 L77 E78	S70-K74 PolarHBondContact O-N 2.87Å; Y71-K74 PolarHBondContact O-N 2.83Å; K74-F76 PolarHBondContact O-N 2.78Å; K74-L77 PolarHBondContact O-N 2.95Å; K74-E78 PolarHBondContact O-N 2.78Å; K74-E78 VanDerWaalsContact O-N 3.08Å
75	S	56.8	Low	67.7	Low	63 Å²	63	124.6 Å²	124.6	44%	0.441	59%	0.586	S	S	.	*	H	α-helix	trans	-59.7	-36.4	176.7	54.8	0	0	0	0	111.4	Y71 D72 L77 E78	Y71-S75 PolarHBondContact O-N 3.42Å; Y71-S75 PolarHBondContact O-OG 3.31Å; D72-S75 PolarHBondContact O-OG 3.27Å; D72-S75 VanDerWaalsContact O-OG 3.13Å; S75-L77 VanDerWaalsContact C-N 3.3Å; S75-L77 PolarHBondContact O-N 2.84Å; S75-E78 PolarHBondContact O-N 3.28Å
76	F	50.5	Low	66.7	Low	137 Å²	137	127.9 Å²	127.9	60%	0.601	60%	0.599	S	S	*	*	H	α-helix	trans	-68.1	-26.2	175.1	-147.9	-87.7	0	0	0	113.9	D72 K74 Y80	D72-F76 PolarHBondContact O-N 3.25Å; K74-F76 PolarHBondContact O-N 2.78Å; F76-Y80 HydrophobicContact CE1-CE2 4.5Å
77	L	55.4	Low	65.5	Low	132 Å²	132	127.1 Å²	127.1	69%	0.691	60%	0.599	S	S	*	*	H	α-helix	trans	-87.1	-20.1	177.8	-71.3	169.5	0	0	0	113	K73 K74 S75	K73-L77 WeakPolarHBondContact O-CG 3.34Å; K73-L77 PolarHBondContact O-N 3.18Å; K74-L77 PolarHBondContact O-N 2.95Å; S75-L77 VanDerWaalsContact C-N 3.3Å; S75-L77 PolarHBondContact O-N 2.84Å
78	E	60.4	Low	64.3	Low	154 Å²	154	130.5 Å²	130.5	72%	0.72	61%	0.612	S	S	*	*	H	α-helix	trans	-86	-8.4	177	-71.5	175.1	-171	0	0	112.9	K74 S75	K74-E78 PolarHBondContact O-N 2.78Å; K74-E78 VanDerWaalsContact O-N 3.08Å; S75-E78 PolarHBondContact O-N 3.28Å
79	E	57.1	Low	63	Low	165 Å²	165	134.4 Å²	134.4	77%	0.771	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.9	1.2	175.5	-82	-172.3	176.2	0	0	114.8
80	Y	49.7	Very low	61.5	Low	258 Å²	258	136.5 Å²	136.5	100%	1.012	64%	0.637	S	S	*	*			trans	-120.4	0	178.5	-84.8	-83.2	0	0	0	112.5	F76	F76-Y80 HydrophobicContact CE1-CE2 4.5Å

Retrieved 80 of 80 residues in 98.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).