A0A5K4F8K2_SCHMA Loading...

Serine palmitoyltransferase small subunit B

Component of the serine palmitoyltransferase multisubunit enzyme (SPT) that catalyzes the initial and rate-limiting step in sphingolipid biosynthesis by condensing L-serine and activated acyl-CoA (most commonly palmitoyl-CoA) to form long-chain bases. The SPT complex is composed of SPTLC1, SPTLC2 or SPTLC3 and SPTSSA or SPTSSB. Within this complex, the heterodimer consisting of SPTLC1 and SPTLC2/SPTLC3 forms the catalytic core. Within the SPT complex, SPTSSB stimulates the catalytic activity and plays a role in substrate specificity. SPT complexes with this subunit showing a preference for longer acyl-CoAs. The SPTLC1-SPTLC2-SPTSSB complex shows a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3-SPTSSB isozyme displays an ability to use a broader range of acyl-CoAs, without apparent preference.

AlphaFold DB , UniProt , Accession A0A5K4F8K2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 72 aa.

						>A0A5K4F8K2_SCHMA|A0A5K4F8K2
MIASPCRTLRSMFNKYCLCLAIYICEPWEKVILHCITLAIICALTYTAVLIVPSHLSTLIIFVWKCLNGDKH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	55.8	Low	84.5	Confident	245 Å²	245	119 Å²	119	100%	1.207	63%	0.626	S	S	*	*				0	99.4	0	-71.8	175.2	-169	0	0	108.4	A3	M1-A3 PolarHBondContact O-N 3.1Å
2	I	69.9	Low	85.4	Confident	173 Å²	173	117.4 Å²	117.4	89%	0.887	62%	0.615	S	S	*	*			trans	-69.3	112.9	169.5	-69.5	159.6	0	0	0	105.6	S4	I2-S4 PolarHBondContact O-N 3.03Å
3	A	75.2	Confident	86.3	Confident	54 Å²	54	118.2 Å²	118.2	45%	0.446	61%	0.611	S	S	.	*			trans	-55.4	142.5	174.6	0	0	0	0	0	108.8	M1	M1-A3 PolarHBondContact O-N 3.1Å
4	S	85.3	Confident	87	Confident	60 Å²	60	115.4 Å²	115.4	42%	0.42	60%	0.597	S	S	.	*			trans	-48.5	130.7	174.3	168.7	0	0	0	0	109.2	I2 C6 R7 T8	I2-S4 PolarHBondContact O-N 3.03Å; S4-C6 PolarHBondContact O-N 3.49Å; S4-C6 VanDerWaalsContact O-N 3.08Å; S4-R7 WeakPolarHBondContact O-CB 3.17Å; S4-R7 PolarHBondContact O-N 3.06Å; S4-T8 PolarHBondContact O-N 2.95Å
5	P	87	Confident	87.6	Confident	90 Å²	90	115.5 Å²	115.5	58%	0.584	59%	0.591	S	S	*	*	H	α-helix	trans	-54.1	-36	-174.6	20.4	-32.9	0	0	0	111.8	R7 T8 L9	P5-R7 PolarHBondContact O-N 2.85Å; P5-T8 PolarHBondContact O-N 3.32Å; P5-L9 WeakPolarHBondContact O-CG 3.22Å; P5-L9 PolarHBondContact O-N 3.45Å
6	C	89	Confident	88.2	Confident	89 Å²	89	117.3 Å²	117.3	60%	0.601	59%	0.59	S	S	*	*	H	α-helix	trans	-62.2	-37.4	176.1	-58.7	0	0	0	0	113.2	S4 R10	S4-C6 PolarHBondContact O-N 3.49Å; S4-C6 VanDerWaalsContact O-N 3.08Å; C6-R10 WeakPolarHBondContact O-CB 3.44Å; C6-R10 PolarHBondContact O-N 3.04Å
7	R	91.9	Very high	88.7	Confident	193 Å²	193	113.4 Å²	113.4	73%	0.728	58%	0.575	S	S	*	*	H	α-helix	trans	-66.8	-41	176	-69.3	-173.3	-172.6	-175	2.5	110.9	S4 P5 S11	S4-R7 WeakPolarHBondContact O-CB 3.17Å; S4-R7 PolarHBondContact O-N 3.06Å; P5-R7 PolarHBondContact O-N 2.85Å; R7-S11 WeakPolarHBondContact O-CB 3.48Å; R7-S11 PolarHBondContact O-N 2.93Å
8	T	91.9	Very high	89.1	Confident	61 Å²	61	113.3 Å²	113.3	37%	0.374	58%	0.576	S	S	.	*	H	α-helix	trans	-65.1	-47.8	176.7	-53.4	0	0	0	0	110.9	S4 P5 R10 S11 M12	S4-T8 PolarHBondContact O-N 2.95Å; P5-T8 PolarHBondContact O-N 3.32Å; T8-R10 VanDerWaalsContact C-N 3.35Å; T8-R10 PolarHBondContact O-N 3.45Å; T8-S11 WeakPolarHBondContact O-CB 3.28Å; T8-S11 PolarHBondContact O-N 2.92Å; T8-S11 VanDerWaalsContact O-N 3.13Å; T8-M12 HydrophobicContact CG2-CE 4.17Å; T8-M12 WeakPolarHBondContact O-CG 3.42Å; T8-M12 PolarHBondContact O-N 3.42Å
9	L	94	Very high	89.3	Confident	123 Å²	123	111.7 Å²	111.7	64%	0.644	58%	0.575	S	S	*	*	H	α-helix	trans	-58	-45.1	176.4	-71.6	172.7	0	0	0	111.9	P5 S11 M12 F13	P5-L9 WeakPolarHBondContact O-CG 3.22Å; P5-L9 PolarHBondContact O-N 3.45Å; L9-S11 VanDerWaalsContact C-N 3.34Å; L9-S11 PolarHBondContact O-N 3.25Å; L9-M12 PolarHBondContact O-N 3.47Å; L9-F13 WeakPolarHBondContact O-CB 3.41Å; L9-F13 PolarHBondContact O-N 3.29Å
10	R	95	Very high	89.7	Confident	171 Å²	171	110.4 Å²	110.4	65%	0.645	57%	0.569	S	S	*	*	H	α-helix	trans	-62	-40.8	175.3	-175.1	172.7	-175.4	-95.7	0.3	112.3	C6 T8 M12 F13 N14	C6-R10 WeakPolarHBondContact O-CB 3.44Å; C6-R10 PolarHBondContact O-N 3.04Å; T8-R10 VanDerWaalsContact C-N 3.35Å; T8-R10 PolarHBondContact O-N 3.45Å; R10-M12 VanDerWaalsContact C-N 3.34Å; R10-F13 PolarHBondContact O-N 3.47Å; R10-N14 WeakPolarHBondContact O-CB 3.19Å; R10-N14 VanDerWaalsContact O-CG 3.31Å; R10-N14 PolarHBondContact O-N 2.84Å
11	S	94.2	Very high	89.9	Confident	50 Å²	50	107.3 Å²	107.3	35%	0.35	56%	0.56	S	S	.	*	H	α-helix	trans	-62.1	-42.6	175.7	-177	0	0	0	0	111.6	R7 T8 L9 N14 K15	R7-S11 WeakPolarHBondContact O-CB 3.48Å; R7-S11 PolarHBondContact O-N 2.93Å; T8-S11 WeakPolarHBondContact O-CB 3.28Å; T8-S11 PolarHBondContact O-N 2.92Å; T8-S11 VanDerWaalsContact O-N 3.13Å; L9-S11 VanDerWaalsContact C-N 3.34Å; L9-S11 PolarHBondContact O-N 3.25Å; S11-N14 PolarHBondContact O-N 3.17Å; S11-K15 WeakPolarHBondContact O-CG 3.46Å; S11-K15 PolarHBondContact O-N 3.43Å
12	M	95.8	Very high	91.7	Very high	100 Å²	100	98.6 Å²	98.6	49%	0.493	52%	0.517	S	S	.	.	H	α-helix	trans	-67.4	-41.5	177.3	-63.2	-53.6	159.4	0	0	111.9	T8 L9 R10 N14 K15 Y16	T8-M12 HydrophobicContact CG2-CE 4.17Å; T8-M12 WeakPolarHBondContact O-CG 3.42Å; T8-M12 PolarHBondContact O-N 3.42Å; L9-M12 PolarHBondContact O-N 3.47Å; R10-M12 VanDerWaalsContact C-N 3.34Å; M12-N14 PolarHBondContact O-N 3.4Å; M12-K15 PolarHBondContact O-N 2.88Å; M12-K15 HydrophobicContact SD-CD 4.2Å; M12-Y16 WeakPolarHBondContact O-CB 3.35Å; M12-Y16 PolarHBondContact O-N 3.17Å
13	F	96.6	Very high	92.9	Very high	128 Å²	128	99.2 Å²	99.2	56%	0.561	51%	0.51	S	S	*	.	H	α-helix	trans	-60	-45.8	174.6	-177.2	-102.2	0	0	0	111.8	L9 R10 K15 Y16 C17	L9-F13 WeakPolarHBondContact O-CB 3.41Å; L9-F13 PolarHBondContact O-N 3.29Å; R10-F13 PolarHBondContact O-N 3.47Å; F13-K15 VanDerWaalsContact C-N 3.35Å; F13-K15 PolarHBondContact O-N 2.82Å; F13-Y16 WeakPolarHBondContact O-CB 3.48Å; F13-Y16 PolarHBondContact O-N 3.4Å; F13-C17 VanDerWaalsContact CE1-SG 3.56Å; F13-C17 VanDerWaalsContact CZ-SG 3.56Å; F13-C17 PolarHBondContact O-N 2.93Å; F13-C17 PolarHBondContact O-SG 2.93Å; F13-C17 VanDerWaalsContact O-SG 3.37Å
14	N	96.7	Very high	93.9	Very high	78 Å²	78	102.8 Å²	102.8	42%	0.417	52%	0.52	S	S	.	.	H	α-helix	trans	-61.8	-41.4	177	-73.3	-3.9	0	0	0	112.4	R10 S11 M12 C17 L18	R10-N14 WeakPolarHBondContact O-CB 3.19Å; R10-N14 VanDerWaalsContact O-CG 3.31Å; R10-N14 PolarHBondContact O-N 2.84Å; S11-N14 PolarHBondContact O-N 3.17Å; M12-N14 PolarHBondContact O-N 3.4Å; N14-C17 PolarHBondContact O-N 2.91Å; N14-L18 WeakPolarHBondContact O-CB 3.35Å; N14-L18 PolarHBondContact O-N 3.28Å
15	K	95.7	Very high	94.3	Very high	118 Å²	118	101.2 Å²	101.2	51%	0.513	51%	0.508	S	S	.	.	H	α-helix	trans	-62.5	-43.5	174.8	-71.8	171.8	-177.6	177.9	0	111.4	S11 M12 F13 L18 C19	S11-K15 WeakPolarHBondContact O-CG 3.46Å; S11-K15 PolarHBondContact O-N 3.43Å; M12-K15 PolarHBondContact O-N 2.88Å; M12-K15 HydrophobicContact SD-CD 4.2Å; F13-K15 VanDerWaalsContact C-N 3.35Å; F13-K15 PolarHBondContact O-N 2.82Å; K15-L18 PolarHBondContact O-N 3.41Å; K15-C19 PolarHBondContact O-N 3.38Å; K15-C19 PolarHBondContact O-SG 3.42Å
16	Y	97	Very high	94.7	Very high	144 Å²	144	102 Å²	102	57%	0.565	50%	0.504	S	S	*	.	H	α-helix	trans	-60.3	-48.2	176.2	173.9	-98.3	0	0	0	111.9	M12 F13 L18 C19 L20	M12-Y16 WeakPolarHBondContact O-CB 3.35Å; M12-Y16 PolarHBondContact O-N 3.17Å; F13-Y16 WeakPolarHBondContact O-CB 3.48Å; F13-Y16 PolarHBondContact O-N 3.4Å; Y16-L18 VanDerWaalsContact C-N 3.31Å; Y16-L18 PolarHBondContact O-N 3.45Å; Y16-C19 PolarHBondContact O-N 2.87Å; Y16-L20 HydrophobicContact CE1-CD1 4.32Å; Y16-L20 WeakPolarHBondContact O-CB 3.45Å; Y16-L20 PolarHBondContact O-N 2.87Å
17	C	97.3	Very high	95	Very high	51 Å²	51	102.6 Å²	102.6	35%	0.345	51%	0.507	S	S	.	.	H	α-helix	trans	-60.3	-40.4	177	-69.5	0	0	0	0	112.3	F13 N14 L20 A21	F13-C17 VanDerWaalsContact CE1-SG 3.56Å; F13-C17 VanDerWaalsContact CZ-SG 3.56Å; F13-C17 PolarHBondContact O-N 2.93Å; F13-C17 PolarHBondContact O-SG 2.93Å; F13-C17 VanDerWaalsContact O-SG 3.37Å; N14-C17 PolarHBondContact O-N 2.91Å; C17-L20 PolarHBondContact O-N 3.34Å; C17-A21 WeakPolarHBondContact O-CB 3.4Å; C17-A21 PolarHBondContact O-N 2.9Å
18	L	94.6	Very high	95.2	Very high	112 Å²	112	100 Å²	100	59%	0.586	50%	0.497	S	S	*	.	H	α-helix	trans	-63.9	-45.6	175.9	-174.7	68.9	0	0	0	111.4	N14 K15 Y16 L20 A21 I22	N14-L18 WeakPolarHBondContact O-CB 3.35Å; N14-L18 PolarHBondContact O-N 3.28Å; K15-L18 PolarHBondContact O-N 3.41Å; Y16-L18 VanDerWaalsContact C-N 3.31Å; Y16-L18 PolarHBondContact O-N 3.45Å; L18-L20 VanDerWaalsContact C-N 3.33Å; L18-L20 PolarHBondContact O-N 2.93Å; L18-A21 PolarHBondContact O-N 3.31Å; L18-I22 HydrophobicContact CG-CD1 4.13Å; L18-I22 WeakPolarHBondContact O-CG1 3.24Å; L18-I22 PolarHBondContact O-N 3.45Å
19	C	94.4	Very high	95.4	Very high	82 Å²	82	100.1 Å²	100.1	55%	0.554	49%	0.494	S	S	*	.	H	α-helix	trans	-60.8	-42.9	175.6	-70.7	0	0	0	0	111.7	K15 Y16 I22 Y23	K15-C19 PolarHBondContact O-N 3.38Å; K15-C19 PolarHBondContact O-SG 3.42Å; Y16-C19 PolarHBondContact O-N 2.87Å; C19-I22 PolarHBondContact O-N 3.05Å; C19-Y23 VanDerWaalsContact O-CB 3.28Å; C19-Y23 WeakPolarHBondContact O-CB 3.49Å; C19-Y23 PolarHBondContact O-N 3.23Å
20	L	96.4	Very high	95.5	Very high	86 Å²	86	97.2 Å²	97.2	45%	0.45	48%	0.476	S	S	.	.	H	α-helix	trans	-63.6	-44.3	177.5	-169.4	112.7	0	0	0	111.2	Y16 C17 L18 I22 Y23 I24	Y16-L20 HydrophobicContact CE1-CD1 4.32Å; Y16-L20 WeakPolarHBondContact O-CB 3.45Å; Y16-L20 PolarHBondContact O-N 2.87Å; C17-L20 PolarHBondContact O-N 3.34Å; L18-L20 VanDerWaalsContact C-N 3.33Å; L18-L20 PolarHBondContact O-N 2.93Å; L20-I22 VanDerWaalsContact C-N 3.35Å; L20-I22 PolarHBondContact O-N 2.84Å; L20-Y23 WeakPolarHBondContact O-CB 3.35Å; L20-Y23 PolarHBondContact O-N 2.96Å; L20-Y23 VanDerWaalsContact O-N 3.11Å; L20-I24 PolarHBondContact O-N 3.15Å
21	A	93.6	Very high	95.5	Very high	46 Å²	46	93.4 Å²	93.4	38%	0.38	47%	0.472	S	S	.	.	H	α-helix	trans	-59.1	-45.2	175.7	0	0	0	0	0	111.6	C17 L18 Y23 I24 C25	C17-A21 WeakPolarHBondContact O-CB 3.4Å; C17-A21 PolarHBondContact O-N 2.9Å; L18-A21 PolarHBondContact O-N 3.31Å; A21-Y23 VanDerWaalsContact C-N 3.31Å; A21-Y23 PolarHBondContact O-N 3.47Å; A21-I24 WeakPolarHBondContact O-CG1 3.46Å; A21-C25 PolarHBondContact O-N 2.94Å; A21-C25 PolarHBondContact O-SG 3.41Å
22	I	94	Very high	95.6	Very high	61 Å²	61	95 Å²	95	31%	0.313	48%	0.475	S	S	.	.	H	α-helix	trans	-66	-36.5	175	-64.9	165.3	0	0	0	110.7	L18 C19 L20 C25 K30	L18-I22 HydrophobicContact CG-CD1 4.13Å; L18-I22 WeakPolarHBondContact O-CG1 3.24Å; L18-I22 PolarHBondContact O-N 3.45Å; C19-I22 PolarHBondContact O-N 3.05Å; L20-I22 VanDerWaalsContact C-N 3.35Å; L20-I22 PolarHBondContact O-N 2.84Å; I22-C25 WeakPolarHBondContact O-CB 3.46Å; I22-C25 PolarHBondContact O-N 2.75Å; I22-K30 HydrophobicContact CG2-CG 4.42Å; I22-K30 WeakPolarHBondContact O-CE 3.38Å
23	Y	94.3	Very high	95.6	Very high	186 Å²	186	93.6 Å²	93.6	73%	0.729	47%	0.469	S	S	*	.	H	α-helix	trans	-64.8	-41.7	-178.2	-178.7	-98.7	0	0	0	112.5	C19 L20 A21 C25 K30	C19-Y23 VanDerWaalsContact O-CB 3.28Å; C19-Y23 WeakPolarHBondContact O-CB 3.49Å; C19-Y23 PolarHBondContact O-N 3.23Å; L20-Y23 WeakPolarHBondContact O-CB 3.35Å; L20-Y23 PolarHBondContact O-N 2.96Å; L20-Y23 VanDerWaalsContact O-N 3.11Å; A21-Y23 VanDerWaalsContact C-N 3.31Å; A21-Y23 PolarHBondContact O-N 3.47Å; Y23-C25 VanDerWaalsContact C-N 3.27Å; Y23-C25 PolarHBondContact O-N 2.88Å; Y23-K30 PolarHBondContact O-NZ 3.48Å
24	I	96.7	Very high	95.5	Very high	129 Å²	129	92.7 Å²	92.7	66%	0.662	47%	0.467	S	S	*	.	H	α-helix	trans	-71.4	-18.8	179.1	62.8	159.8	0	0	0	113.6	L20 A21	L20-I24 PolarHBondContact O-N 3.15Å; A21-I24 WeakPolarHBondContact O-CG1 3.46Å
25	C	94.5	Very high	95.5	Very high	27 Å²	27	92.7 Å²	92.7	18%	0.182	47%	0.472	C	S	.	.	S	Bend	trans	-61.8	148.1	177.7	-73.8	0	0	0	0	112.2	A21 I22 Y23 E29 K30	A21-C25 PolarHBondContact O-N 2.94Å; A21-C25 PolarHBondContact O-SG 3.41Å; I22-C25 WeakPolarHBondContact O-CB 3.46Å; I22-C25 PolarHBondContact O-N 2.75Å; Y23-C25 VanDerWaalsContact C-N 3.27Å; Y23-C25 PolarHBondContact O-N 2.88Å; C25-E29 VanDerWaalsContact CA-OE2 3.25Å; C25-E29 WeakPolarHBondContact CA-OE2 3.41Å; C25-E29 HydrophobicContact CB-CB 3.93Å; C25-E29 WeakPolarHBondContact CB-OE2 3.4Å; C25-K30 HydrophobicContact CB-CG 3.96Å; C25-K30 WeakPolarHBondContact O-CE 3.33Å; C25-K30 PolarHBondContact O-NZ 2.95Å
26	E	95.4	Very high	95.6	Very high	107 Å²	107	91.2 Å²	91.2	50%	0.5	47%	0.468	S	S	.	.			trans	-63.1	156.5	171	-69.7	-168.6	79.8	0	0	111.2	W28 E29 K30	E26-W28 HydrophobicContact CB-CG 4.37Å; E26-W28 VanDerWaalsContact CB-NE1 3.35Å; E26-W28 PolarHBondContact O-N 2.95Å; E26-W28 PolarHBondContact OE1-NE1 3.48Å; E26-W28 WeakPolarHBondContact OE2-CZ2 3.3Å; E26-W28 PolarHBondContact OE2-NE1 3.24Å; E26-E29 HydrophobicContact CB-CG 4.15Å; E26-E29 PolarHBondContact N-OE2 3.5Å; E26-E29 PolarHBondContact O-N 2.84Å; E26-E29 VanDerWaalsContact O-N 3.17Å; E26-K30 WeakPolarHBondContact O-CG 3.43Å; E26-K30 PolarHBondContact O-N 2.95Å
27	P	94.8	Very high	95.6	Very high	101 Å²	101	87.8 Å²	87.8	66%	0.656	46%	0.463	S	S	*	.	H	α-helix	trans	-58.4	-35.8	-178.9	22.4	-34	0	0	0	113	V31	P27-V31 WeakPolarHBondContact O-CG2 3.33Å; P27-V31 PolarHBondContact O-N 3.49Å
28	W	95.7	Very high	95.6	Very high	138 Å²	138	90.6 Å²	90.6	52%	0.523	47%	0.474	S	S	.	.	H	α-helix	trans	-70.5	-38.7	178	64.5	-94.2	0	0	0	112	E26 K30 V31 I32	E26-W28 HydrophobicContact CB-CG 4.37Å; E26-W28 VanDerWaalsContact CB-NE1 3.35Å; E26-W28 PolarHBondContact O-N 2.95Å; E26-W28 PolarHBondContact OE1-NE1 3.48Å; E26-W28 WeakPolarHBondContact OE2-CZ2 3.3Å; E26-W28 PolarHBondContact OE2-NE1 3.24Å; W28-K30 VanDerWaalsContact C-N 3.35Å; W28-K30 PolarHBondContact O-N 2.87Å; W28-V31 PolarHBondContact O-N 3.21Å; W28-I32 HydrophobicContact CE3-CD1 3.64Å; W28-I32 HydrophobicContact CZ3-CD1 3.82Å; W28-I32 WeakPolarHBondContact O-CG1 3.22Å; W28-I32 PolarHBondContact O-N 3.46Å; W28-I32 VanDerWaalsContact O-N 3.12Å
29	E	96.4	Very high	95.8	Very high	64 Å²	64	88.1 Å²	88.1	30%	0.299	47%	0.469	S	S	.	.	H	α-helix	trans	-62.3	-42.4	175	-67.2	-179	136.3	0	0	111.4	C25 E26 V31 I32 L33	C25-E29 VanDerWaalsContact CA-OE2 3.25Å; C25-E29 WeakPolarHBondContact CA-OE2 3.41Å; C25-E29 HydrophobicContact CB-CB 3.93Å; C25-E29 WeakPolarHBondContact CB-OE2 3.4Å; E26-E29 HydrophobicContact CB-CG 4.15Å; E26-E29 PolarHBondContact N-OE2 3.5Å; E26-E29 PolarHBondContact O-N 2.84Å; E26-E29 VanDerWaalsContact O-N 3.17Å; E29-V31 VanDerWaalsContact C-N 3.3Å; E29-V31 PolarHBondContact O-N 3.31Å; E29-I32 PolarHBondContact O-N 3.4Å; E29-L33 WeakPolarHBondContact O-CB 3.32Å; E29-L33 WeakPolarHBondContact O-CG 3.28Å; E29-L33 PolarHBondContact O-N 3.38Å
30	K	95.4	Very high	96	Very high	63 Å²	63	88.6 Å²	88.6	27%	0.274	47%	0.465	S	S	.	.	H	α-helix	trans	-57.7	-43	176.3	-72.7	166.2	174.3	148	0	111.8	I22 Y23 C25 E26 W28 L33 H34	I22-K30 HydrophobicContact CG2-CG 4.42Å; I22-K30 WeakPolarHBondContact O-CE 3.38Å; Y23-K30 PolarHBondContact O-NZ 3.48Å; C25-K30 HydrophobicContact CB-CG 3.96Å; C25-K30 WeakPolarHBondContact O-CE 3.33Å; C25-K30 PolarHBondContact O-NZ 2.95Å; E26-K30 WeakPolarHBondContact O-CG 3.43Å; E26-K30 PolarHBondContact O-N 2.95Å; W28-K30 VanDerWaalsContact C-N 3.35Å; W28-K30 PolarHBondContact O-N 2.87Å; K30-L33 PolarHBondContact O-N 2.92Å; K30-H34 WeakPolarHBondContact O-CB 3.41Å; K30-H34 VanDerWaalsContact O-CG 3.28Å; K30-H34 PolarHBondContact O-N 2.86Å
31	V	96	Very high	96.1	Very high	91 Å²	91	88.7 Å²	88.7	55%	0.552	47%	0.465	S	S	*	.	H	α-helix	trans	-62.8	-46.6	177.1	174.2	0	0	0	0	110.8	P27 W28 E29 L33 H34 C35	P27-V31 WeakPolarHBondContact O-CG2 3.33Å; P27-V31 PolarHBondContact O-N 3.49Å; W28-V31 PolarHBondContact O-N 3.21Å; E29-V31 VanDerWaalsContact C-N 3.3Å; E29-V31 PolarHBondContact O-N 3.31Å; V31-L33 PolarHBondContact O-N 2.79Å; V31-H34 PolarHBondContact O-N 2.88Å; V31-C35 PolarHBondContact O-N 3.2Å; V31-C35 PolarHBondContact O-SG 2.88Å; V31-C35 VanDerWaalsContact O-SG 3.32Å
32	I	96.4	Very high	96.3	Very high	83 Å²	83	90.3 Å²	90.3	43%	0.426	47%	0.473	S	S	.	.	H	α-helix	trans	-61	-46.2	177.9	-65.4	171.7	0	0	0	110.8	W28 E29 H34 C35 I36	W28-I32 HydrophobicContact CE3-CD1 3.64Å; W28-I32 HydrophobicContact CZ3-CD1 3.82Å; W28-I32 WeakPolarHBondContact O-CG1 3.22Å; W28-I32 PolarHBondContact O-N 3.46Å; W28-I32 VanDerWaalsContact O-N 3.12Å; E29-I32 PolarHBondContact O-N 3.4Å; I32-H34 VanDerWaalsContact C-N 3.3Å; I32-H34 PolarHBondContact O-N 2.83Å; I32-C35 PolarHBondContact O-N 3.23Å; I32-I36 HydrophobicContact CG2-CD1 3.73Å; I32-I36 HydrophobicContact CG2-CG1 4.33Å; I32-I36 WeakPolarHBondContact O-CG1 3.17Å; I32-I36 PolarHBondContact O-N 3.23Å
33	L	95.4	Very high	96.4	Very high	71 Å²	71	89.9 Å²	89.9	37%	0.372	48%	0.479	S	S	.	.	H	α-helix	trans	-59.3	-41.1	177	-73.3	174.3	0	0	0	111.9	E29 K30 V31 T37	E29-L33 WeakPolarHBondContact O-CB 3.32Å; E29-L33 WeakPolarHBondContact O-CG 3.28Å; E29-L33 PolarHBondContact O-N 3.38Å; K30-L33 PolarHBondContact O-N 2.92Å; V31-L33 PolarHBondContact O-N 2.79Å; L33-T37 WeakPolarHBondContact O-CB 3.31Å; L33-T37 PolarHBondContact O-N 3.46Å; L33-T37 PolarHBondContact O-OG1 3.37Å
34	H	94.3	Very high	96.6	Very high	109 Å²	109	86.2 Å²	86.2	51%	0.505	47%	0.471	S	S	.	.	H	α-helix	trans	-65.2	-44.1	174.2	-71.2	-8.8	0	0	0	112.4	K30 V31 I32 I36 T37 L38	K30-H34 WeakPolarHBondContact O-CB 3.41Å; K30-H34 VanDerWaalsContact O-CG 3.28Å; K30-H34 PolarHBondContact O-N 2.86Å; V31-H34 PolarHBondContact O-N 2.88Å; I32-H34 VanDerWaalsContact C-N 3.3Å; I32-H34 PolarHBondContact O-N 2.83Å; H34-I36 PolarHBondContact O-N 3.42Å; H34-T37 PolarHBondContact O-N 3.45Å; H34-L38 WeakPolarHBondContact O-CB 3.42Å; H34-L38 WeakPolarHBondContact O-CG 3.47Å; H34-L38 PolarHBondContact O-N 2.89Å
35	C	97.8	Very high	96.7	Very high	77 Å²	77	83.6 Å²	83.6	52%	0.52	46%	0.462	S	S	.	.	H	α-helix	trans	-59	-45.8	175	-70.1	0	0	0	0	111.7	V31 I32 L38 A39	V31-C35 PolarHBondContact O-N 3.2Å; V31-C35 PolarHBondContact O-SG 2.88Å; V31-C35 VanDerWaalsContact O-SG 3.32Å; I32-C35 PolarHBondContact O-N 3.23Å; C35-L38 PolarHBondContact O-N 3.48Å; C35-A39 WeakPolarHBondContact O-CB 3.43Å; C35-A39 PolarHBondContact O-N 3.47Å
36	I	97.6	Very high	96.7	Very high	87 Å²	87	88.9 Å²	88.9	45%	0.446	48%	0.479	S	S	.	.	H	α-helix	trans	-63.5	-44.9	177.6	-68	170	0	0	0	110.6	I32 H34 L38 A39 I40	I32-I36 HydrophobicContact CG2-CD1 3.73Å; I32-I36 HydrophobicContact CG2-CG1 4.33Å; I32-I36 WeakPolarHBondContact O-CG1 3.17Å; I32-I36 PolarHBondContact O-N 3.23Å; H34-I36 PolarHBondContact O-N 3.42Å; I36-L38 PolarHBondContact O-N 3.32Å; I36-A39 PolarHBondContact O-N 3.23Å; I36-I40 HydrophobicContact CG2-CD1 3.74Å; I36-I40 HydrophobicContact CG2-CG1 4.37Å; I36-I40 VanDerWaalsContact O-CG1 3.28Å; I36-I40 WeakPolarHBondContact O-CG1 3.18Å; I36-I40 PolarHBondContact O-N 3.29Å
37	T	96.1	Very high	96.8	Very high	73 Å²	73	86.4 Å²	86.4	45%	0.448	47%	0.471	S	S	.	.	H	α-helix	trans	-61.2	-45.4	179.6	-58.7	0	0	0	0	111	L33 H34 I40 I41	L33-T37 WeakPolarHBondContact O-CB 3.31Å; L33-T37 PolarHBondContact O-N 3.46Å; L33-T37 PolarHBondContact O-OG1 3.37Å; H34-T37 PolarHBondContact O-N 3.45Å; T37-I40 PolarHBondContact O-N 2.9Å; T37-I41 HydrophobicContact CG2-CD1 4Å; T37-I41 VanDerWaalsContact O-CG1 3.28Å; T37-I41 WeakPolarHBondContact O-CG1 3.31Å; T37-I41 PolarHBondContact O-N 2.98Å
38	L	98	Very high	96.8	Very high	110 Å²	110	84.4 Å²	84.4	58%	0.576	46%	0.462	S	S	*	.	H	α-helix	trans	-63.6	-42.7	175.3	-71.3	175.3	0	0	0	111.7	H34 C35 I36 I40 I41 C42	H34-L38 WeakPolarHBondContact O-CB 3.42Å; H34-L38 WeakPolarHBondContact O-CG 3.47Å; H34-L38 PolarHBondContact O-N 2.89Å; C35-L38 PolarHBondContact O-N 3.48Å; I36-L38 PolarHBondContact O-N 3.32Å; L38-I40 VanDerWaalsContact C-N 3.33Å; L38-I40 PolarHBondContact O-N 2.88Å; L38-I41 PolarHBondContact O-N 3.19Å; L38-C42 WeakPolarHBondContact O-CB 3.34Å; L38-C42 PolarHBondContact O-N 3.46Å; L38-C42 PolarHBondContact O-SG 3.24Å
39	A	98.2	Very high	96.8	Very high	59 Å²	59	82.6 Å²	82.6	49%	0.488	47%	0.467	S	S	.	.	H	α-helix	trans	-60.3	-42.3	176.7	0	0	0	0	0	112	C35 I36 C42 A43	C35-A39 WeakPolarHBondContact O-CB 3.43Å; C35-A39 PolarHBondContact O-N 3.47Å; I36-A39 PolarHBondContact O-N 3.23Å; A39-C42 PolarHBondContact O-N 2.88Å; A39-A43 WeakPolarHBondContact O-CB 3.35Å; A39-A43 PolarHBondContact O-N 2.93Å
40	I	98.4	Very high	96.6	Very high	92 Å²	92	84.2 Å²	84.2	47%	0.472	48%	0.477	S	S	.	.	H	α-helix	trans	-63.6	-45.9	175.6	-67.7	166.1	0	0	0	110.5	I36 T37 L38 C42 A43 L44	I36-I40 HydrophobicContact CG2-CD1 3.74Å; I36-I40 HydrophobicContact CG2-CG1 4.37Å; I36-I40 VanDerWaalsContact O-CG1 3.28Å; I36-I40 WeakPolarHBondContact O-CG1 3.18Å; I36-I40 PolarHBondContact O-N 3.29Å; T37-I40 PolarHBondContact O-N 2.9Å; L38-I40 VanDerWaalsContact C-N 3.33Å; L38-I40 PolarHBondContact O-N 2.88Å; I40-C42 VanDerWaalsContact C-N 3.34Å; I40-C42 PolarHBondContact O-N 2.95Å; I40-A43 PolarHBondContact O-N 3.06Å; I40-L44 HydrophobicContact CG2-CD1 3.86Å; I40-L44 HydrophobicContact CG2-CG 4.25Å; I40-L44 WeakPolarHBondContact O-CB 3.45Å; I40-L44 VanDerWaalsContact O-CG 3.28Å; I40-L44 WeakPolarHBondContact O-CG 3.33Å; I40-L44 PolarHBondContact O-N 2.95Å
41	I	98.2	Very high	96.6	Very high	88 Å²	88	84.1 Å²	84.1	45%	0.451	48%	0.479	S	S	.	.	H	α-helix	trans	-60.9	-44.8	177.4	-67.9	166.5	0	0	0	110.6	T37 L38 A43 L44 T45	T37-I41 HydrophobicContact CG2-CD1 4Å; T37-I41 VanDerWaalsContact O-CG1 3.28Å; T37-I41 WeakPolarHBondContact O-CG1 3.31Å; T37-I41 PolarHBondContact O-N 2.98Å; L38-I41 PolarHBondContact O-N 3.19Å; I41-A43 PolarHBondContact O-N 3.46Å; I41-L44 PolarHBondContact O-N 2.9Å; I41-T45 HydrophobicContact CG2-CG2 4.36Å; I41-T45 WeakPolarHBondContact O-CB 3.28Å; I41-T45 VanDerWaalsContact O-CG2 3.31Å; I41-T45 WeakPolarHBondContact O-CG2 3.28Å; I41-T45 PolarHBondContact O-N 3.45Å; I41-T45 PolarHBondContact O-OG1 2.88Å
42	C	98	Very high	96.5	Very high	80 Å²	80	83.9 Å²	83.9	54%	0.541	48%	0.477	S	S	.	.	H	α-helix	trans	-61	-43.2	175.1	-72.2	0	0	0	0	111.9	L38 A39 I40 T45 Y46	L38-C42 WeakPolarHBondContact O-CB 3.34Å; L38-C42 PolarHBondContact O-N 3.46Å; L38-C42 PolarHBondContact O-SG 3.24Å; A39-C42 PolarHBondContact O-N 2.88Å; I40-C42 VanDerWaalsContact C-N 3.34Å; I40-C42 PolarHBondContact O-N 2.95Å; C42-T45 VanDerWaalsContact CA-OG1 3.31Å; C42-T45 WeakPolarHBondContact CA-OG1 3.28Å; C42-T45 PolarHBondContact O-N 2.72Å; C42-T45 PolarHBondContact O-OG1 3.32Å; C42-Y46 WeakPolarHBondContact O-CB 3.49Å; C42-Y46 PolarHBondContact O-N 3.41Å
43	A	97.9	Very high	96.4	Very high	53 Å²	53	82.9 Å²	82.9	44%	0.438	48%	0.476	S	S	.	.	H	α-helix	trans	-64.4	-43.2	177.4	0	0	0	0	0	112	A39 I40 I41 Y46 T47	A39-A43 WeakPolarHBondContact O-CB 3.35Å; A39-A43 PolarHBondContact O-N 2.93Å; I40-A43 PolarHBondContact O-N 3.06Å; I41-A43 PolarHBondContact O-N 3.46Å; A43-Y46 PolarHBondContact O-N 3.22Å; A43-T47 WeakPolarHBondContact O-CG2 3.41Å; A43-T47 PolarHBondContact O-N 3.27Å; A43-T47 PolarHBondContact O-OG1 3.13Å
44	L	97.8	Very high	96.4	Very high	109 Å²	109	82.2 Å²	82.2	57%	0.571	48%	0.477	S	S	*	.	H	α-helix	trans	-67.4	-39.5	177.9	-70.7	175.6	0	0	0	112.4	I40 I41 T47 A48	I40-L44 HydrophobicContact CG2-CD1 3.86Å; I40-L44 HydrophobicContact CG2-CG 4.25Å; I40-L44 WeakPolarHBondContact O-CB 3.45Å; I40-L44 VanDerWaalsContact O-CG 3.28Å; I40-L44 WeakPolarHBondContact O-CG 3.33Å; I40-L44 PolarHBondContact O-N 2.95Å; I41-L44 PolarHBondContact O-N 2.9Å; L44-T47 WeakPolarHBondContact CA-OG1 3.45Å; L44-T47 PolarHBondContact O-OG1 3.08Å; L44-A48 WeakPolarHBondContact O-CB 3.36Å; L44-A48 PolarHBondContact O-N 3.42Å
45	T	97.6	Very high	96.3	Very high	74 Å²	74	83 Å²	83	45%	0.454	48%	0.481	S	S	.	.	H	α-helix	trans	-69.5	-40.9	176.1	48.7	0	0	0	0	111.2	I41 C42 T47 A48 V49	I41-T45 HydrophobicContact CG2-CG2 4.36Å; I41-T45 WeakPolarHBondContact O-CB 3.28Å; I41-T45 VanDerWaalsContact O-CG2 3.31Å; I41-T45 WeakPolarHBondContact O-CG2 3.28Å; I41-T45 PolarHBondContact O-N 3.45Å; I41-T45 PolarHBondContact O-OG1 2.88Å; C42-T45 VanDerWaalsContact CA-OG1 3.31Å; C42-T45 WeakPolarHBondContact CA-OG1 3.28Å; C42-T45 PolarHBondContact O-N 2.72Å; C42-T45 PolarHBondContact O-OG1 3.32Å; T45-T47 PolarHBondContact O-N 2.95Å; T45-A48 PolarHBondContact O-N 2.88Å; T45-V49 WeakPolarHBondContact O-CB 3.35Å; T45-V49 WeakPolarHBondContact O-CG2 3.43Å; T45-V49 PolarHBondContact O-N 3.12Å
46	Y	96.2	Very high	96.2	Very high	138 Å²	138	84 Å²	84	54%	0.541	48%	0.481	S	S	.	.	H	α-helix	trans	-58.2	-47.8	173.1	179	-97.3	0	0	0	111.8	C42 A43 L50 I51	C42-Y46 WeakPolarHBondContact O-CB 3.49Å; C42-Y46 PolarHBondContact O-N 3.41Å; A43-Y46 PolarHBondContact O-N 3.22Å; Y46-L50 HydrophobicContact CD2-CD1 3.51Å; Y46-L50 HydrophobicContact CE2-CB 4.46Å; Y46-L50 HydrophobicContact CE2-CD1 3.35Å; Y46-L50 HydrophobicContact CE2-CG 4.49Å; Y46-L50 HydrophobicContact CG-CD1 4.49Å; Y46-L50 WeakPolarHBondContact O-CB 3.46Å; Y46-L50 PolarHBondContact O-N 3.21Å; Y46-I51 HydrophobicContact CD1-CD1 4.08Å; Y46-I51 HydrophobicContact CD1-CG1 4.31Å; Y46-I51 HydrophobicContact CE1-CD1 3.78Å; Y46-I51 HydrophobicContact CE1-CG1 3.96Å
47	T	95.9	Very high	96.1	Very high	55 Å²	55	82.5 Å²	82.5	34%	0.337	48%	0.478	S	S	.	.	I	π-helix	trans	-65.9	-44.7	179.1	59.2	0	0	0	0	111.3	A43 L44 T45 V49 I51 V52	A43-T47 WeakPolarHBondContact O-CG2 3.41Å; A43-T47 PolarHBondContact O-N 3.27Å; A43-T47 PolarHBondContact O-OG1 3.13Å; L44-T47 WeakPolarHBondContact CA-OG1 3.45Å; L44-T47 PolarHBondContact O-OG1 3.08Å; T45-T47 PolarHBondContact O-N 2.95Å; T47-V49 PolarHBondContact O-N 2.85Å; T47-I51 HydrophobicContact CG2-CD1 3.93Å; T47-I51 WeakPolarHBondContact O-CB 3.32Å; T47-I51 PolarHBondContact O-N 3.28Å; T47-V52 WeakPolarHBondContact O-CG2 3.34Å; T47-V52 PolarHBondContact O-N 3.41Å
48	A	96.5	Very high	96	Very high	58 Å²	58	83.4 Å²	83.4	48%	0.479	48%	0.483	S	S	.	.	I	π-helix	trans	-66	-36.3	-179	0	0	0	0	0	113.6	L44 T45 P53	L44-A48 WeakPolarHBondContact O-CB 3.36Å; L44-A48 PolarHBondContact O-N 3.42Å; T45-A48 PolarHBondContact O-N 2.88Å; A48-P53 WeakPolarHBondContact O-CD 3.34Å
49	V	95.1	Very high	95.9	Very high	101 Å²	101	83.1 Å²	83.1	61%	0.612	48%	0.482	S	S	*	.	I	π-helix	trans	-93.4	-35.3	-173.8	176.9	0	0	0	0	112.9	T45 T47 P53	T45-V49 WeakPolarHBondContact O-CB 3.35Å; T45-V49 WeakPolarHBondContact O-CG2 3.43Å; T45-V49 PolarHBondContact O-N 3.12Å; T47-V49 PolarHBondContact O-N 2.85Å; V49-P53 WeakPolarHBondContact O-CD 3.37Å; V49-P53 VanDerWaalsContact O-CG 3.24Å; V49-P53 WeakPolarHBondContact O-CG 3.42Å
50	L	92.2	Very high	95.8	Very high	98 Å²	98	84.9 Å²	84.9	51%	0.513	48%	0.482	S	S	.	.	I	π-helix	trans	-106.8	-49.4	-174.1	-64.5	173.4	0	0	0	112.3	Y46 S54	Y46-L50 HydrophobicContact CD2-CD1 3.51Å; Y46-L50 HydrophobicContact CE2-CB 4.46Å; Y46-L50 HydrophobicContact CE2-CD1 3.35Å; Y46-L50 HydrophobicContact CE2-CG 4.49Å; Y46-L50 HydrophobicContact CG-CD1 4.49Å; Y46-L50 WeakPolarHBondContact O-CB 3.46Å; Y46-L50 PolarHBondContact O-N 3.21Å; L50-S54 WeakPolarHBondContact O-CB 3.49Å; L50-S54 PolarHBondContact O-N 3.39Å; L50-S54 PolarHBondContact O-OG 3.11Å
51	I	94	Very high	95.7	Very high	61 Å²	61	86 Å²	86	31%	0.313	49%	0.488	S	S	.	.	I	π-helix	trans	-72.5	-51.1	-175.5	-60.7	-174	0	0	0	110.7	Y46 T47 S54 H55	Y46-I51 HydrophobicContact CD1-CD1 4.08Å; Y46-I51 HydrophobicContact CD1-CG1 4.31Å; Y46-I51 HydrophobicContact CE1-CD1 3.78Å; Y46-I51 HydrophobicContact CE1-CG1 3.96Å; T47-I51 HydrophobicContact CG2-CD1 3.93Å; T47-I51 WeakPolarHBondContact O-CB 3.32Å; T47-I51 PolarHBondContact O-N 3.28Å; I51-S54 PolarHBondContact O-N 3.06Å; I51-S54 PolarHBondContact O-OG 2.82Å; I51-H55 WeakPolarHBondContact CG2-CD2 3.49Å; I51-H55 PolarHBondContact O-CD2 3.38Å; I51-H55 PolarHBondContact O-N 3.34Å
52	V	94.3	Very high	95.5	Very high	86 Å²	86	88.2 Å²	88.2	52%	0.521	50%	0.495	S	S	.	.	H	α-helix	trans	-59.6	-47.9	-176.2	171.6	0	0	0	0	112.3	T47 S54 H55 L56	T47-V52 WeakPolarHBondContact O-CG2 3.34Å; T47-V52 PolarHBondContact O-N 3.41Å; V52-S54 PolarHBondContact O-N 3.47Å; V52-H55 PolarHBondContact O-N 2.96Å; V52-L56 VanDerWaalsContact O-CB 3.3Å; V52-L56 WeakPolarHBondContact O-CB 3.12Å; V52-L56 PolarHBondContact O-N 3.38Å
53	P	94.8	Very high	95.4	Very high	62 Å²	62	87.5 Å²	87.5	40%	0.403	49%	0.487	S	S	.	.	H	α-helix	trans	-68.6	-32.7	-179.6	-25.2	39.4	0	0	0	113.7	A48 V49 L56 S57	A48-P53 WeakPolarHBondContact O-CD 3.34Å; V49-P53 WeakPolarHBondContact O-CD 3.37Å; V49-P53 VanDerWaalsContact O-CG 3.24Å; V49-P53 WeakPolarHBondContact O-CG 3.42Å; P53-L56 PolarHBondContact O-N 3.29Å; P53-S57 WeakPolarHBondContact O-CB 3.34Å; P53-S57 PolarHBondContact O-N 3.48Å; P53-S57 PolarHBondContact O-OG 3.33Å
54	S	94.7	Very high	95.2	Very high	57 Å²	57	93.4 Å²	93.4	40%	0.399	50%	0.498	S	S	.	.	H	α-helix	trans	-69.6	-39.1	177.4	55.8	0	0	0	0	112.5	L50 I51 V52 S57 T58	L50-S54 WeakPolarHBondContact O-CB 3.49Å; L50-S54 PolarHBondContact O-N 3.39Å; L50-S54 PolarHBondContact O-OG 3.11Å; I51-S54 PolarHBondContact O-N 3.06Å; I51-S54 PolarHBondContact O-OG 2.82Å; V52-S54 PolarHBondContact O-N 3.47Å; S54-S57 PolarHBondContact O-OG 3.39Å; S54-T58 WeakPolarHBondContact O-CB 3.28Å; S54-T58 PolarHBondContact O-N 3.34Å; S54-T58 VanDerWaalsContact O-N 3.17Å; S54-T58 PolarHBondContact O-OG1 2.88Å
55	H	93.5	Very high	95	Very high	126 Å²	126	95.7 Å²	95.7	58%	0.583	50%	0.504	S	S	*	.	H	α-helix	trans	-69.5	-39.4	171.7	-74.8	-71.6	0	0	0	111.9	I51 V52 T58 L59	I51-H55 WeakPolarHBondContact CG2-CD2 3.49Å; I51-H55 PolarHBondContact O-CD2 3.38Å; I51-H55 PolarHBondContact O-N 3.34Å; V52-H55 PolarHBondContact O-N 2.96Å; H55-T58 PolarHBondContact O-N 3Å; H55-L59 VanDerWaalsContact O-CB 3.32Å; H55-L59 WeakPolarHBondContact O-CB 3.36Å; H55-L59 PolarHBondContact O-N 3.47Å
56	L	96.1	Very high	94.8	Very high	98 Å²	98	96 Å²	96	51%	0.513	51%	0.508	S	S	.	.	H	α-helix	trans	-64.1	-42.8	178.2	-170.9	65.8	0	0	0	111.4	V52 P53 L59 I60	V52-L56 VanDerWaalsContact O-CB 3.3Å; V52-L56 WeakPolarHBondContact O-CB 3.12Å; V52-L56 PolarHBondContact O-N 3.38Å; P53-L56 PolarHBondContact O-N 3.29Å; L56-L59 PolarHBondContact O-N 3.47Å; L56-I60 HydrophobicContact CG-CD1 3.95Å; L56-I60 WeakPolarHBondContact O-CB 3.43Å; L56-I60 WeakPolarHBondContact O-CD1 2.81Å; L56-I60 WeakPolarHBondContact O-CG1 3.45Å; L56-I60 PolarHBondContact O-N 2.86Å
57	S	94.6	Very high	94.7	Very high	55 Å²	55	96 Å²	96	39%	0.385	52%	0.516	S	S	.	.	H	α-helix	trans	-63.6	-43.2	176.6	66.4	0	0	0	0	111.9	P53 S54 L59 I60 I61	P53-S57 WeakPolarHBondContact O-CB 3.34Å; P53-S57 PolarHBondContact O-N 3.48Å; P53-S57 PolarHBondContact O-OG 3.33Å; S54-S57 PolarHBondContact O-OG 3.39Å; S57-L59 VanDerWaalsContact C-N 3.34Å; S57-L59 PolarHBondContact O-N 3.39Å; S57-I60 PolarHBondContact O-N 3.23Å; S57-I61 VanDerWaalsContact O-CG1 3.28Å; S57-I61 WeakPolarHBondContact O-CG1 3.49Å; S57-I61 PolarHBondContact O-N 2.95Å
58	T	95.1	Very high	94.5	Very high	91 Å²	91	96.9 Å²	96.9	56%	0.558	52%	0.519	S	S	*	.	H	α-helix	trans	-61.7	-43.2	176	-55.4	0	0	0	0	111.3	S54 H55 I61 F62	S54-T58 WeakPolarHBondContact O-CB 3.28Å; S54-T58 PolarHBondContact O-N 3.34Å; S54-T58 VanDerWaalsContact O-N 3.17Å; S54-T58 PolarHBondContact O-OG1 2.88Å; H55-T58 PolarHBondContact O-N 3Å; T58-I61 PolarHBondContact O-N 3.45Å; T58-F62 WeakPolarHBondContact O-CB 3.45Å; T58-F62 PolarHBondContact O-N 3.49Å
59	L	95.8	Very high	93.2	Very high	104 Å²	104	96.7 Å²	96.7	55%	0.545	52%	0.523	S	S	.	.	H	α-helix	trans	-64.7	-42.4	176.7	-173.7	147.1	0	0	0	111.5	H55 L56 S57 F62 V63	H55-L59 VanDerWaalsContact O-CB 3.32Å; H55-L59 WeakPolarHBondContact O-CB 3.36Å; H55-L59 PolarHBondContact O-N 3.47Å; L56-L59 PolarHBondContact O-N 3.47Å; S57-L59 VanDerWaalsContact C-N 3.34Å; S57-L59 PolarHBondContact O-N 3.39Å; L59-F62 PolarHBondContact O-N 2.95Å; L59-V63 HydrophobicContact CD2-CG2 4.01Å; L59-V63 WeakPolarHBondContact O-CB 3.37Å; L59-V63 VanDerWaalsContact O-CG2 3.28Å; L59-V63 WeakPolarHBondContact O-CG2 3.48Å; L59-V63 PolarHBondContact O-N 3.03Å
60	I	96.1	Very high	91.7	Very high	96 Å²	96	99.1 Å²	99.1	49%	0.492	53%	0.533	S	S	.	.	H	α-helix	trans	-61.4	-46.4	176.1	-70.6	163.8	0	0	0	110.6	L56 S57 F62 V63 W64	L56-I60 HydrophobicContact CG-CD1 3.95Å; L56-I60 WeakPolarHBondContact O-CB 3.43Å; L56-I60 WeakPolarHBondContact O-CD1 2.81Å; L56-I60 WeakPolarHBondContact O-CG1 3.45Å; L56-I60 PolarHBondContact O-N 2.86Å; S57-I60 PolarHBondContact O-N 3.23Å; I60-F62 VanDerWaalsContact C-N 3.32Å; I60-F62 PolarHBondContact O-N 3.37Å; I60-V63 PolarHBondContact O-N 3.2Å; I60-W64 WeakPolarHBondContact O-CB 3.08Å; I60-W64 PolarHBondContact O-N 2.9Å
61	I	95.4	Very high	90.1	Very high	116 Å²	116	102.7 Å²	102.7	60%	0.595	54%	0.544	S	S	*	.	H	α-helix	trans	-61.3	-42.9	177.7	-67.7	163.3	0	0	0	110.7	S57 T58 W64 K65	S57-I61 VanDerWaalsContact O-CG1 3.28Å; S57-I61 WeakPolarHBondContact O-CG1 3.49Å; S57-I61 PolarHBondContact O-N 2.95Å; T58-I61 PolarHBondContact O-N 3.45Å; I61-W64 PolarHBondContact O-N 3.42Å; I61-K65 WeakPolarHBondContact O-CB 3.45Å; I61-K65 PolarHBondContact O-N 3.3Å
62	F	93.9	Very high	88.1	Confident	135 Å²	135	111.7 Å²	111.7	59%	0.592	58%	0.584	S	S	*	*	H	α-helix	trans	-62.5	-50.2	177.5	178.4	-97.9	0	0	0	111.8	T58 L59 I60 W64 K65 C66	T58-F62 WeakPolarHBondContact O-CB 3.45Å; T58-F62 PolarHBondContact O-N 3.49Å; L59-F62 PolarHBondContact O-N 2.95Å; I60-F62 VanDerWaalsContact C-N 3.32Å; I60-F62 PolarHBondContact O-N 3.37Å; F62-W64 VanDerWaalsContact C-N 3.32Å; F62-W64 PolarHBondContact O-N 2.87Å; F62-K65 PolarHBondContact O-N 2.78Å; F62-K65 VanDerWaalsContact O-N 3.17Å; F62-C66 PolarHBondContact O-N 3.41Å; F62-C66 PolarHBondContact O-SG 3.42Å
63	V	95.2	Very high	87.8	Confident	64 Å²	64	113 Å²	113	39%	0.388	59%	0.587	S	S	.	*	H	α-helix	trans	-61.2	-42.4	177.7	170.9	0	0	0	0	110.9	L59 I60 K65 C66 L67	L59-V63 HydrophobicContact CD2-CG2 4.01Å; L59-V63 WeakPolarHBondContact O-CB 3.37Å; L59-V63 VanDerWaalsContact O-CG2 3.28Å; L59-V63 WeakPolarHBondContact O-CG2 3.48Å; L59-V63 PolarHBondContact O-N 3.03Å; I60-V63 PolarHBondContact O-N 3.2Å; V63-K65 VanDerWaalsContact C-N 3.32Å; V63-K65 PolarHBondContact O-N 2.88Å; V63-C66 PolarHBondContact O-N 3.5Å; V63-L67 HydrophobicContact CG1-CD1 3.82Å; V63-L67 HydrophobicContact CG1-CG 4.34Å; V63-L67 WeakPolarHBondContact O-CB 3.25Å; V63-L67 WeakPolarHBondContact O-CG 3.39Å; V63-L67 PolarHBondContact O-N 3.21Å
64	W	95.3	Very high	87.4	Confident	177 Å²	177	115.6 Å²	115.6	67%	0.67	60%	0.597	S	S	*	*	H	α-helix	trans	-60	-41.4	175.6	-177.1	-92.6	0	0	0	112.3	I60 I61 F62 L67 N68	I60-W64 WeakPolarHBondContact O-CB 3.08Å; I60-W64 PolarHBondContact O-N 2.9Å; I61-W64 PolarHBondContact O-N 3.42Å; F62-W64 VanDerWaalsContact C-N 3.32Å; F62-W64 PolarHBondContact O-N 2.87Å; W64-L67 PolarHBondContact O-N 3.25Å; W64-N68 WeakPolarHBondContact CZ2-ND2 3.44Å; W64-N68 PolarHBondContact NE1-ND2 3.27Å; W64-N68 WeakPolarHBondContact O-CB 3.34Å; W64-N68 PolarHBondContact O-N 3.17Å; W64-N68 PolarHBondContact O-ND2 2.88Å
65	K	93.8	Very high	87	Confident	158 Å²	158	118.9 Å²	118.9	69%	0.687	61%	0.608	S	S	*	*	H	α-helix	trans	-67.3	-40.5	175.8	-174.3	175.4	179.8	178	0	111.9	I61 F62 V63 G69	I61-K65 WeakPolarHBondContact O-CB 3.45Å; I61-K65 PolarHBondContact O-N 3.3Å; F62-K65 PolarHBondContact O-N 2.78Å; F62-K65 VanDerWaalsContact O-N 3.17Å; V63-K65 VanDerWaalsContact C-N 3.32Å; V63-K65 PolarHBondContact O-N 2.88Å; K65-G69 WeakPolarHBondContact O-CA 3.48Å; K65-G69 PolarHBondContact O-N 3.03Å
66	C	92.1	Very high	86.6	Confident	80 Å²	80	118.5 Å²	118.5	54%	0.541	61%	0.61	S	S	.	*	H	α-helix	trans	-65.1	-39.4	175.3	-71	0	0	0	0	112.4	F62 V63	F62-C66 PolarHBondContact O-N 3.41Å; F62-C66 PolarHBondContact O-SG 3.42Å; V63-C66 PolarHBondContact O-N 3.5Å
67	L	94.3	Very high	86	Confident	137 Å²	137	119.8 Å²	119.8	72%	0.717	62%	0.616	S	S	*	*	H	α-helix	trans	-72.6	-34.1	179.7	-72.1	171.4	0	0	0	113.2	V63 W64	V63-L67 HydrophobicContact CG1-CD1 3.82Å; V63-L67 HydrophobicContact CG1-CG 4.34Å; V63-L67 WeakPolarHBondContact O-CB 3.25Å; V63-L67 WeakPolarHBondContact O-CG 3.39Å; V63-L67 PolarHBondContact O-N 3.21Å; W64-L67 PolarHBondContact O-N 3.25Å
68	N	91.6	Very high	85.5	Confident	74 Å²	74	124.1 Å²	124.1	40%	0.396	63%	0.631	S	S	.	*	H	α-helix	trans	-93.6	-8.5	178.2	-68.8	-57.3	0	0	0	113.7	W64 D70	W64-N68 WeakPolarHBondContact CZ2-ND2 3.44Å; W64-N68 PolarHBondContact NE1-ND2 3.27Å; W64-N68 WeakPolarHBondContact O-CB 3.34Å; W64-N68 PolarHBondContact O-N 3.17Å; W64-N68 PolarHBondContact O-ND2 2.88Å; N68-D70 PolarHBondContact O-N 2.87Å
69	G	68.9	Low	84.8	Confident	55 Å²	55	126.4 Å²	126.4	57%	0.567	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.6	27.5	-168	0	0	0	0	0	116.3	K65	K65-G69 WeakPolarHBondContact O-CA 3.48Å; K65-G69 PolarHBondContact O-N 3.03Å
70	D	64.8	Low	83.9	Confident	151 Å²	151	128.2 Å²	128.2	81%	0.807	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-136.6	31.4	173.5	-153	8.5	0	0	0	111.9	N68	N68-D70 PolarHBondContact O-N 2.87Å
71	K	58	Low	82.9	Confident	173 Å²	173	130.8 Å²	130.8	75%	0.752	66%	0.656	S	S	*	*			trans	-113	5	177.7	-77	-171.7	178.4	169.3	0	115.4
72	H	51.6	Low	81.8	Confident	250 Å²	250	132.2 Å²	132.2	100%	1.157	66%	0.661	S	S	*	*			trans	-147.9	0	169.1	-74	-55.9	0	0	0	109.7

Retrieved 72 of 72 residues in 50.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).