A0A5K4F8L8_SCHMA Loading...

Ovule protein

AlphaFold DB , UniProt , Accession A0A5K4F8L8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 72 aa.

						>A0A5K4F8L8_SCHMA|A0A5K4F8L8
MLYTNYVNITIEVLSLKWLILLTYSNTVTISFVFSFHYLNFYLWFTTLVIKVALFSNQVVTVNLNQSYHNLI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	81.9	Confident	91.8	Very high	186 Å²	186	111.9 Å²	111.9	92%	0.916	56%	0.556	S	S	*	*				0	-47	0	-161.2	174.4	-177	0	113	T4 N5	M1-T4 PolarHBondContact O-OG1 3.31Å; M1-N5 VanDerWaalsContact O-CG 3.31Å; M1-N5 PolarHBondContact O-N 3.22Å; M1-N5 PolarHBondContact O-OD1 2.91Å
2	L	85.8	Confident	92	Very high	153 Å²	153	113.5 Å²	113.5	80%	0.801	56%	0.56	S	S	*	*	H	α-helix	trans	-62.9	-44	178.1	-68.1	173.9	0	0	113.5	T4 N5 Y6	L2-T4 PolarHBondContact O-N 3.29Å; L2-N5 PolarHBondContact O-N 3.48Å; L2-Y6 PolarHBondContact O-N 3.22Å
3	Y	91.7	Very high	92.1	Very high	180 Å²	180	110.4 Å²	110.4	71%	0.706	55%	0.551	S	S	*	*	H	α-helix	trans	-61.5	-42.3	179.6	-176.2	-104.9	0	0	112.8	N5 Y6 V7	Y3-N5 PolarHBondContact O-N 3.46Å; Y3-Y6 PolarHBondContact O-N 3.38Å; Y3-V7 HydrophobicContact CD1-CG2 4.36Å; Y3-V7 HydrophobicContact CE1-CG2 3.96Å; Y3-V7 HydrophobicContact CE2-CG2 4.29Å; Y3-V7 WeakPolarHBondContact O-CG2 3.32Å; Y3-V7 PolarHBondContact O-N 3.49Å
4	T	92.7	Very high	92.3	Very high	74 Å²	74	109.4 Å²	109.4	45%	0.454	55%	0.548	S	S	.	.	H	α-helix	trans	-64.5	-40.6	178	48.6	0	0	0	111.6	M1 L2 V7 N8	M1-T4 PolarHBondContact O-OG1 3.31Å; L2-T4 PolarHBondContact O-N 3.29Å; T4-V7 PolarHBondContact O-N 3.43Å; T4-N8 WeakPolarHBondContact O-CB 2.97Å; T4-N8 PolarHBondContact O-N 2.97Å; T4-N8 PolarHBondContact O-ND2 3.4Å; T4-N8 PolarHBondContact O-OD1 2.94Å
5	N	92.4	Very high	92.4	Very high	72 Å²	72	106.7 Å²	106.7	39%	0.385	54%	0.543	S	S	.	.	H	α-helix	trans	-65.7	-41.2	177	-66.6	-3	0	0	111.5	M1 L2 Y3 N8 I9	M1-N5 VanDerWaalsContact O-CG 3.31Å; M1-N5 PolarHBondContact O-N 3.22Å; M1-N5 PolarHBondContact O-OD1 2.91Å; L2-N5 PolarHBondContact O-N 3.48Å; Y3-N5 PolarHBondContact O-N 3.46Å; N5-N8 PolarHBondContact O-N 2.85Å; N5-I9 WeakPolarHBondContact O-CD1 3.44Å; N5-I9 VanDerWaalsContact O-CG1 3.26Å; N5-I9 WeakPolarHBondContact O-CG1 3.39Å; N5-I9 PolarHBondContact O-N 3.17Å
6	Y	93.8	Very high	92.6	Very high	155 Å²	155	106.2 Å²	106.2	61%	0.608	54%	0.542	S	S	*	.	H	α-helix	trans	-62.4	-44.6	177.2	178.2	-99.3	0	0	112.6	L2 Y3 I9 T10	L2-Y6 PolarHBondContact O-N 3.22Å; Y3-Y6 PolarHBondContact O-N 3.38Å; Y6-I9 PolarHBondContact O-N 2.96Å; Y6-T10 WeakPolarHBondContact O-CB 3.5Å; Y6-T10 PolarHBondContact O-N 3.33Å; Y6-T10 PolarHBondContact O-OG1 3.39Å
7	V	94.3	Very high	92.6	Very high	49 Å²	49	108.4 Å²	108.4	30%	0.297	55%	0.547	S	S	.	.	H	α-helix	trans	-62.8	-43.8	176.4	173.2	0	0	0	110.9	Y3 T4 T10 I11	Y3-V7 HydrophobicContact CD1-CG2 4.36Å; Y3-V7 HydrophobicContact CE1-CG2 3.96Å; Y3-V7 HydrophobicContact CE2-CG2 4.29Å; Y3-V7 WeakPolarHBondContact O-CG2 3.32Å; Y3-V7 PolarHBondContact O-N 3.49Å; T4-V7 PolarHBondContact O-N 3.43Å; V7-T10 PolarHBondContact O-N 3.02Å; V7-I11 HydrophobicContact CG1-CD1 3.79Å; V7-I11 HydrophobicContact CG1-CG1 4.46Å; V7-I11 WeakPolarHBondContact O-CG1 3.34Å; V7-I11 PolarHBondContact O-N 2.9Å
8	N	94.3	Very high	92.6	Very high	98 Å²	98	110.7 Å²	110.7	52%	0.524	55%	0.548	S	S	.	.	H	α-helix	trans	-60.5	-47.5	177.9	-70.9	-8.7	0	0	112.2	T4 N5 T10 I11 E12	T4-N8 WeakPolarHBondContact O-CB 2.97Å; T4-N8 PolarHBondContact O-N 2.97Å; T4-N8 PolarHBondContact O-ND2 3.4Å; T4-N8 PolarHBondContact O-OD1 2.94Å; N5-N8 PolarHBondContact O-N 2.85Å; N8-T10 VanDerWaalsContact C-N 3.29Å; N8-T10 PolarHBondContact O-N 3.46Å; N8-I11 PolarHBondContact O-N 3.01Å; N8-E12 WeakPolarHBondContact O-CB 3.39Å; N8-E12 PolarHBondContact O-N 3.05Å
9	I	93.2	Very high	92.6	Very high	98 Å²	98	110.4 Å²	110.4	50%	0.503	55%	0.548	S	S	.	.	H	α-helix	trans	-61.4	-40.5	177	-66.1	163	0	0	110.6	N5 Y6 I11 E12 V13	N5-I9 WeakPolarHBondContact O-CD1 3.44Å; N5-I9 VanDerWaalsContact O-CG1 3.26Å; N5-I9 WeakPolarHBondContact O-CG1 3.39Å; N5-I9 PolarHBondContact O-N 3.17Å; Y6-I9 PolarHBondContact O-N 2.96Å; I9-I11 PolarHBondContact O-N 3.48Å; I9-E12 PolarHBondContact O-N 3.3Å; I9-V13 HydrophobicContact CG2-CG2 4.33Å; I9-V13 VanDerWaalsContact O-CG2 3.32Å; I9-V13 WeakPolarHBondContact O-CG2 3.37Å; I9-V13 PolarHBondContact O-N 3.46Å
10	T	94.3	Very high	92.7	Very high	66 Å²	66	109.9 Å²	109.9	41%	0.405	55%	0.546	S	S	.	.	H	α-helix	trans	-63.1	-42	178.3	-56.7	0	0	0	111.6	Y6 V7 N8 L14	Y6-T10 WeakPolarHBondContact O-CB 3.5Å; Y6-T10 PolarHBondContact O-N 3.33Å; Y6-T10 PolarHBondContact O-OG1 3.39Å; V7-T10 PolarHBondContact O-N 3.02Å; N8-T10 VanDerWaalsContact C-N 3.29Å; N8-T10 PolarHBondContact O-N 3.46Å; T10-L14 WeakPolarHBondContact O-CB 3.33Å; T10-L14 PolarHBondContact O-N 2.96Å
11	I	95.1	Very high	92.8	Very high	100 Å²	100	109.2 Å²	109.2	51%	0.513	54%	0.544	S	S	.	.	H	α-helix	trans	-66.2	-42.2	176.3	-67.6	167.1	0	0	111	V7 N8 I9 L14 S15	V7-I11 HydrophobicContact CG1-CD1 3.79Å; V7-I11 HydrophobicContact CG1-CG1 4.46Å; V7-I11 WeakPolarHBondContact O-CG1 3.34Å; V7-I11 PolarHBondContact O-N 2.9Å; N8-I11 PolarHBondContact O-N 3.01Å; I9-I11 PolarHBondContact O-N 3.48Å; I11-L14 PolarHBondContact O-N 3.46Å; I11-S15 WeakPolarHBondContact O-CB 3.31Å; I11-S15 PolarHBondContact O-N 3.26Å; I11-S15 PolarHBondContact O-OG 2.74Å
12	E	94.1	Very high	93.3	Very high	131 Å²	131	104.8 Å²	104.8	61%	0.612	52%	0.524	S	S	*	.	H	α-helix	trans	-63.5	-43.9	178.6	-173.4	178.2	177.2	0	112.3	N8 I9 L14 S15 L16	N8-E12 WeakPolarHBondContact O-CB 3.39Å; N8-E12 PolarHBondContact O-N 3.05Å; I9-E12 PolarHBondContact O-N 3.3Å; E12-L14 VanDerWaalsContact C-N 3.34Å; E12-L14 PolarHBondContact O-N 3.23Å; E12-S15 PolarHBondContact O-N 3.03Å; E12-S15 PolarHBondContact O-OG 2.87Å; E12-L16 WeakPolarHBondContact O-CB 3.45Å; E12-L16 PolarHBondContact O-N 3.31Å
13	V	93.7	Very high	93.7	Very high	73 Å²	73	101.1 Å²	101.1	44%	0.442	51%	0.508	S	S	.	.	H	α-helix	trans	-66.5	-38.7	176.3	172.8	0	0	0	111.1	I9 K17	I9-V13 HydrophobicContact CG2-CG2 4.33Å; I9-V13 VanDerWaalsContact O-CG2 3.32Å; I9-V13 WeakPolarHBondContact O-CG2 3.37Å; I9-V13 PolarHBondContact O-N 3.46Å; V13-K17 WeakPolarHBondContact O-CG 3.3Å; V13-K17 PolarHBondContact O-N 3.26Å; V13-K17 VanDerWaalsContact O-N 3.12Å
14	L	95.1	Very high	93.8	Very high	96 Å²	96	100.2 Å²	100.2	50%	0.503	50%	0.504	S	S	.	.	H	α-helix	trans	-66.7	-44.7	177.6	-177.2	62.5	0	0	111.5	T10 I11 E12 L16 K17 W18	T10-L14 WeakPolarHBondContact O-CB 3.33Å; T10-L14 PolarHBondContact O-N 2.96Å; I11-L14 PolarHBondContact O-N 3.46Å; E12-L14 VanDerWaalsContact C-N 3.34Å; E12-L14 PolarHBondContact O-N 3.23Å; L14-L16 VanDerWaalsContact C-N 3.34Å; L14-L16 PolarHBondContact O-N 2.99Å; L14-K17 PolarHBondContact O-N 3.49Å; L14-W18 PolarHBondContact O-N 3.22Å; L14-W18 VanDerWaalsContact O-N 3.12Å
15	S	93.2	Very high	93.8	Very high	69 Å²	69	98.9 Å²	98.9	48%	0.483	50%	0.498	S	S	.	.	H	α-helix	trans	-65.3	-38.1	178.9	67	0	0	0	111.7	I11 E12 K17 W18 L19	I11-S15 WeakPolarHBondContact O-CB 3.31Å; I11-S15 PolarHBondContact O-N 3.26Å; I11-S15 PolarHBondContact O-OG 2.74Å; E12-S15 PolarHBondContact O-N 3.03Å; E12-S15 PolarHBondContact O-OG 2.87Å; S15-K17 PolarHBondContact O-N 2.95Å; S15-W18 PolarHBondContact O-N 2.94Å; S15-L19 PolarHBondContact O-N 3.39Å
16	L	95.3	Very high	93.7	Very high	99 Å²	99	99.9 Å²	99.9	52%	0.518	50%	0.503	S	S	.	.	H	α-helix	trans	-62.3	-41.8	174.1	-174.6	65	0	0	112	E12 L14 W18 L19 I20	E12-L16 WeakPolarHBondContact O-CB 3.45Å; E12-L16 PolarHBondContact O-N 3.31Å; L14-L16 VanDerWaalsContact C-N 3.34Å; L14-L16 PolarHBondContact O-N 2.99Å; L16-W18 PolarHBondContact O-N 3.19Å; L16-L19 PolarHBondContact O-N 3.31Å; L16-I20 HydrophobicContact CG-CD1 4.17Å; L16-I20 WeakPolarHBondContact O-CG1 3.36Å; L16-I20 PolarHBondContact O-N 3.32Å
17	K	92.6	Very high	93.8	Very high	143 Å²	143	96.4 Å²	96.4	62%	0.622	50%	0.498	S	S	*	.	H	α-helix	trans	-61	-42.9	175.5	-76.3	-179.3	178.5	-176.1	112.1	V13 L14 S15 L21	V13-K17 WeakPolarHBondContact O-CG 3.3Å; V13-K17 PolarHBondContact O-N 3.26Å; V13-K17 VanDerWaalsContact O-N 3.12Å; L14-K17 PolarHBondContact O-N 3.49Å; S15-K17 PolarHBondContact O-N 2.95Å; K17-L21 PolarHBondContact O-N 3.41Å; K17-L21 VanDerWaalsContact O-N 3.08Å
18	W	93.6	Very high	93.8	Very high	151 Å²	151	97.4 Å²	97.4	57%	0.572	50%	0.504	S	S	*	.	H	α-helix	trans	-65.3	-40.5	175.2	-79.3	107.5	0	0	112.3	L14 S15 L16 I20 L21 L22	L14-W18 PolarHBondContact O-N 3.22Å; L14-W18 VanDerWaalsContact O-N 3.12Å; S15-W18 PolarHBondContact O-N 2.94Å; L16-W18 PolarHBondContact O-N 3.19Å; W18-I20 PolarHBondContact O-N 2.99Å; W18-L21 HydrophobicContact CE3-CD2 4.04Å; W18-L21 HydrophobicContact CZ3-CD2 3.97Å; W18-L21 PolarHBondContact O-N 3.5Å; W18-L22 WeakPolarHBondContact O-CB 3.47Å; W18-L22 VanDerWaalsContact O-CG 3.29Å; W18-L22 WeakPolarHBondContact O-CG 3.35Å; W18-L22 PolarHBondContact O-N 2.93Å
19	L	93	Very high	93.8	Very high	104 Å²	104	96.7 Å²	96.7	55%	0.545	50%	0.504	S	S	.	.	H	α-helix	trans	-61.1	-43.9	177.4	-178.1	64.5	0	0	112	S15 L16 L22 T23	S15-L19 PolarHBondContact O-N 3.39Å; L16-L19 PolarHBondContact O-N 3.31Å; L19-L22 PolarHBondContact O-N 3.47Å; L19-T23 PolarHBondContact O-N 3.43Å; L19-T23 PolarHBondContact O-OG1 2.99Å
20	I	94.3	Very high	93.9	Very high	100 Å²	100	96.4 Å²	96.4	51%	0.513	50%	0.502	S	S	.	.	H	α-helix	trans	-63.6	-43.7	176.7	-67	166.8	0	0	110.6	L16 W18 L22 T23 Y24	L16-I20 HydrophobicContact CG-CD1 4.17Å; L16-I20 WeakPolarHBondContact O-CG1 3.36Å; L16-I20 PolarHBondContact O-N 3.32Å; W18-I20 PolarHBondContact O-N 2.99Å; I20-L22 VanDerWaalsContact C-N 3.32Å; I20-L22 PolarHBondContact O-N 2.91Å; I20-T23 VanDerWaalsContact CA-OG1 3.31Å; I20-T23 WeakPolarHBondContact CA-OG1 3.29Å; I20-T23 PolarHBondContact O-N 2.94Å; I20-T23 PolarHBondContact O-OG1 3.39Å; I20-T23 VanDerWaalsContact O-OG1 3.09Å; I20-Y24 WeakPolarHBondContact O-CB 3.49Å; I20-Y24 PolarHBondContact O-N 3.29Å
21	L	93.6	Very high	93.9	Very high	96 Å²	96	96.2 Å²	96.2	50%	0.503	50%	0.504	S	S	.	.	H	α-helix	trans	-60.9	-42.6	177.6	-176.5	64.3	0	0	111.6	K17 W18 Y24 S25	K17-L21 PolarHBondContact O-N 3.41Å; K17-L21 VanDerWaalsContact O-N 3.08Å; W18-L21 HydrophobicContact CE3-CD2 4.04Å; W18-L21 HydrophobicContact CZ3-CD2 3.97Å; W18-L21 PolarHBondContact O-N 3.5Å; L21-Y24 PolarHBondContact O-N 3.03Å; L21-S25 WeakPolarHBondContact O-CB 3.32Å; L21-S25 PolarHBondContact O-N 3.32Å; L21-S25 PolarHBondContact O-OG 2.97Å
22	L	93	Very high	93.9	Very high	94 Å²	94	98.6 Å²	98.6	49%	0.492	51%	0.51	S	S	.	.	H	α-helix	trans	-66.6	-39.8	176.9	-71.3	171.1	0	0	112.5	W18 L19 I20 S25 N26	W18-L22 WeakPolarHBondContact O-CB 3.47Å; W18-L22 VanDerWaalsContact O-CG 3.29Å; W18-L22 WeakPolarHBondContact O-CG 3.35Å; W18-L22 PolarHBondContact O-N 2.93Å; L19-L22 PolarHBondContact O-N 3.47Å; I20-L22 VanDerWaalsContact C-N 3.32Å; I20-L22 PolarHBondContact O-N 2.91Å; L22-S25 WeakPolarHBondContact CA-OG 3.4Å; L22-S25 PolarHBondContact O-OG 2.8Å; L22-N26 VanDerWaalsContact O-CB 3.27Å; L22-N26 WeakPolarHBondContact O-CB 3.4Å; L22-N26 PolarHBondContact O-N 2.89Å; L22-N26 PolarHBondContact O-ND2 3.3Å
23	T	94.4	Very high	94	Very high	75 Å²	75	95.6 Å²	95.6	46%	0.46	50%	0.501	S	S	.	.	H	α-helix	trans	-68.8	-39.9	176.5	26.3	0	0	0	111.7	L19 I20 T27	L19-T23 PolarHBondContact O-N 3.43Å; L19-T23 PolarHBondContact O-OG1 2.99Å; I20-T23 VanDerWaalsContact CA-OG1 3.31Å; I20-T23 WeakPolarHBondContact CA-OG1 3.29Å; I20-T23 PolarHBondContact O-N 2.94Å; I20-T23 PolarHBondContact O-OG1 3.39Å; I20-T23 VanDerWaalsContact O-OG1 3.09Å; T23-T27 WeakPolarHBondContact O-CB 3.31Å; T23-T27 PolarHBondContact O-N 2.93Å; T23-T27 PolarHBondContact O-OG1 3.12Å
24	Y	93.2	Very high	94.1	Very high	162 Å²	162	99 Å²	99	64%	0.635	51%	0.51	S	S	*	.	H	α-helix	trans	-63.8	-47.4	175.1	-175	-101.5	0	0	111.6	I20 L21 N26 T27 V28	I20-Y24 WeakPolarHBondContact O-CB 3.49Å; I20-Y24 PolarHBondContact O-N 3.29Å; L21-Y24 PolarHBondContact O-N 3.03Å; Y24-N26 PolarHBondContact O-N 3.41Å; Y24-T27 PolarHBondContact O-N 3.07Å; Y24-V28 HydrophobicContact CD1-CG2 4.32Å; Y24-V28 HydrophobicContact CE1-CG2 3.95Å; Y24-V28 HydrophobicContact CE2-CG2 4.42Å; Y24-V28 WeakPolarHBondContact O-CG2 3.34Å; Y24-V28 PolarHBondContact O-N 3.47Å
25	S	92.5	Very high	94.2	Very high	46 Å²	46	98.1 Å²	98.1	32%	0.322	51%	0.511	S	S	.	.	H	α-helix	trans	-63.2	-40.1	178.4	65.7	0	0	0	112.4	L21 L22 V28 T29	L21-S25 WeakPolarHBondContact O-CB 3.32Å; L21-S25 PolarHBondContact O-N 3.32Å; L21-S25 PolarHBondContact O-OG 2.97Å; L22-S25 WeakPolarHBondContact CA-OG 3.4Å; L22-S25 PolarHBondContact O-OG 2.8Å; S25-V28 PolarHBondContact O-N 2.87Å; S25-T29 WeakPolarHBondContact O-CB 3.33Å; S25-T29 PolarHBondContact O-N 3.19Å; S25-T29 PolarHBondContact O-OG1 3.12Å
26	N	92	Very high	94.4	Very high	92 Å²	92	100.1 Å²	100.1	49%	0.492	51%	0.512	S	S	.	.	H	α-helix	trans	-63.6	-43.9	174.8	-73.9	-19.5	0	0	111.5	L22 Y24 V28 T29 I30	L22-N26 VanDerWaalsContact O-CB 3.27Å; L22-N26 WeakPolarHBondContact O-CB 3.4Å; L22-N26 PolarHBondContact O-N 2.89Å; L22-N26 PolarHBondContact O-ND2 3.3Å; Y24-N26 PolarHBondContact O-N 3.41Å; N26-V28 PolarHBondContact O-N 3.47Å; N26-T29 PolarHBondContact O-N 3.29Å; N26-I30 WeakPolarHBondContact O-CB 3.44Å; N26-I30 WeakPolarHBondContact O-CD1 3.28Å; N26-I30 WeakPolarHBondContact O-CG1 3.49Å; N26-I30 PolarHBondContact O-N 3.38Å
27	T	94.8	Very high	94.5	Very high	82 Å²	82	101 Å²	101	50%	0.503	51%	0.513	S	S	.	.	H	α-helix	trans	-62	-43.2	179	-56.4	0	0	0	111.6	T23 Y24 S31	T23-T27 WeakPolarHBondContact O-CB 3.31Å; T23-T27 PolarHBondContact O-N 2.93Å; T23-T27 PolarHBondContact O-OG1 3.12Å; Y24-T27 PolarHBondContact O-N 3.07Å; T27-S31 WeakPolarHBondContact O-CB 3.38Å; T27-S31 PolarHBondContact O-N 3.07Å; T27-S31 PolarHBondContact O-OG 2.84Å
28	V	94.6	Very high	94.7	Very high	71 Å²	71	102.1 Å²	102.1	43%	0.43	51%	0.514	S	S	.	.	H	α-helix	trans	-64.5	-45.5	176.1	173.9	0	0	0	111	Y24 S25 N26 I30 S31 F32	Y24-V28 HydrophobicContact CD1-CG2 4.32Å; Y24-V28 HydrophobicContact CE1-CG2 3.95Å; Y24-V28 HydrophobicContact CE2-CG2 4.42Å; Y24-V28 WeakPolarHBondContact O-CG2 3.34Å; Y24-V28 PolarHBondContact O-N 3.47Å; S25-V28 PolarHBondContact O-N 2.87Å; N26-V28 PolarHBondContact O-N 3.47Å; V28-I30 PolarHBondContact O-N 3.22Å; V28-S31 PolarHBondContact O-N 2.97Å; V28-F32 WeakPolarHBondContact O-CB 3.37Å; V28-F32 PolarHBondContact O-N 3.4Å
29	T	94	Very high	94.9	Very high	83 Å²	83	99.4 Å²	99.4	51%	0.509	51%	0.511	S	S	.	.	H	α-helix	trans	-61.5	-46.5	179.2	-56.5	0	0	0	111.2	S25 N26 S31 F32 V33	S25-T29 WeakPolarHBondContact O-CB 3.33Å; S25-T29 PolarHBondContact O-N 3.19Å; S25-T29 PolarHBondContact O-OG1 3.12Å; N26-T29 PolarHBondContact O-N 3.29Å; T29-S31 PolarHBondContact O-N 2.9Å; T29-F32 PolarHBondContact O-N 2.93Å; T29-V33 VanDerWaalsContact O-CG2 3.31Å; T29-V33 WeakPolarHBondContact O-CG2 3.33Å; T29-V33 PolarHBondContact O-N 3Å
30	I	95	Very high	94.9	Very high	92 Å²	92	97.9 Å²	97.9	47%	0.472	50%	0.503	S	S	.	.	H	α-helix	trans	-60.2	-46.7	176.8	-68.9	165.6	0	0	110.2	N26 V28 F32 V33 F34	N26-I30 WeakPolarHBondContact O-CB 3.44Å; N26-I30 WeakPolarHBondContact O-CD1 3.28Å; N26-I30 WeakPolarHBondContact O-CG1 3.49Å; N26-I30 PolarHBondContact O-N 3.38Å; V28-I30 PolarHBondContact O-N 3.22Å; I30-F32 VanDerWaalsContact C-N 3.33Å; I30-F32 PolarHBondContact O-N 2.82Å; I30-V33 PolarHBondContact O-N 3.45Å; I30-F34 HydrophobicContact CG2-CD2 3.61Å; I30-F34 HydrophobicContact CG2-CE2 3.57Å; I30-F34 VanDerWaalsContact O-CD2 3.29Å; I30-F34 WeakPolarHBondContact O-CD2 3.43Å; I30-F34 PolarHBondContact O-N 3.37Å
31	S	95.3	Very high	95.1	Very high	62 Å²	62	98.9 Å²	98.9	43%	0.434	50%	0.504	S	S	.	.	H	α-helix	trans	-61.8	-39.9	179.4	-58.9	0	0	0	112.5	T27 V28 T29 S35	T27-S31 WeakPolarHBondContact O-CB 3.38Å; T27-S31 PolarHBondContact O-N 3.07Å; T27-S31 PolarHBondContact O-OG 2.84Å; V28-S31 PolarHBondContact O-N 2.97Å; T29-S31 PolarHBondContact O-N 2.9Å; S31-S35 WeakPolarHBondContact O-CB 3.29Å; S31-S35 PolarHBondContact O-N 3.05Å; S31-S35 PolarHBondContact O-OG 3.3Å
32	F	95.5	Very high	95.3	Very high	149 Å²	149	100.4 Å²	100.4	65%	0.654	50%	0.504	S	S	*	.	H	α-helix	trans	-64.1	-46	175.4	-178.9	-98.1	0	0	111.7	V28 T29 I30 F34 S35 F36	V28-F32 WeakPolarHBondContact O-CB 3.37Å; V28-F32 PolarHBondContact O-N 3.4Å; T29-F32 PolarHBondContact O-N 2.93Å; I30-F32 VanDerWaalsContact C-N 3.33Å; I30-F32 PolarHBondContact O-N 2.82Å; F32-F34 PolarHBondContact O-N 3.48Å; F32-S35 PolarHBondContact O-N 3.42Å; F32-F36 PolarHBondContact O-N 3.05Å
33	V	95.7	Very high	95.6	Very high	68 Å²	68	100.2 Å²	100.2	41%	0.412	50%	0.503	S	S	.	.	H	α-helix	trans	-59.5	-46.4	176.9	172.2	0	0	0	111	T29 I30 F36 H37	T29-V33 VanDerWaalsContact O-CG2 3.31Å; T29-V33 WeakPolarHBondContact O-CG2 3.33Å; T29-V33 PolarHBondContact O-N 3Å; I30-V33 PolarHBondContact O-N 3.45Å; V33-F36 PolarHBondContact O-N 3.16Å; V33-H37 PolarHBondContact O-N 3.4Å; V33-H37 PolarHBondContact O-ND1 3.28Å
34	F	96.3	Very high	95.8	Very high	146 Å²	146	103.3 Å²	103.3	64%	0.64	51%	0.506	S	S	*	.	H	α-helix	trans	-62.3	-43.3	176.9	-87.1	-71.6	0	0	112.7	I30 F32 F36 H37 Y38	I30-F34 HydrophobicContact CG2-CD2 3.61Å; I30-F34 HydrophobicContact CG2-CE2 3.57Å; I30-F34 VanDerWaalsContact O-CD2 3.29Å; I30-F34 WeakPolarHBondContact O-CD2 3.43Å; I30-F34 PolarHBondContact O-N 3.37Å; F32-F34 PolarHBondContact O-N 3.48Å; F34-F36 VanDerWaalsContact C-N 3.32Å; F34-F36 PolarHBondContact O-N 2.91Å; F34-H37 PolarHBondContact O-N 2.99Å; F34-Y38 WeakPolarHBondContact O-CB 3.34Å; F34-Y38 PolarHBondContact O-N 3.35Å
35	S	96.6	Very high	96	Very high	76 Å²	76	100.7 Å²	100.7	53%	0.531	50%	0.498	S	S	.	.	H	α-helix	trans	-62.3	-40.5	179.2	-58.5	0	0	0	111.8	S31 F32 Y38 L39	S31-S35 WeakPolarHBondContact O-CB 3.29Å; S31-S35 PolarHBondContact O-N 3.05Å; S31-S35 PolarHBondContact O-OG 3.3Å; F32-S35 PolarHBondContact O-N 3.42Å; S35-Y38 PolarHBondContact O-N 3.49Å; S35-L39 WeakPolarHBondContact O-CB 3.35Å; S35-L39 PolarHBondContact O-N 2.86Å
36	F	97.5	Very high	96.2	Very high	112 Å²	112	100.3 Å²	100.3	49%	0.491	49%	0.494	S	S	.	.	H	α-helix	trans	-64.6	-45.6	175.5	-177.6	-103.4	0	0	112.3	F32 V33 F34 L39 N40	F32-F36 PolarHBondContact O-N 3.05Å; V33-F36 PolarHBondContact O-N 3.16Å; F34-F36 VanDerWaalsContact C-N 3.32Å; F34-F36 PolarHBondContact O-N 2.91Å; F36-L39 PolarHBondContact O-N 3Å; F36-N40 VanDerWaalsContact CD1-ND2 3.34Å; F36-N40 WeakPolarHBondContact CD1-ND2 3.36Å; F36-N40 WeakPolarHBondContact CE1-ND2 3.01Å; F36-N40 VanDerWaalsContact CZ-ND2 3.26Å; F36-N40 WeakPolarHBondContact CZ-ND2 3.26Å; F36-N40 PolarHBondContact O-N 3.42Å; F36-N40 PolarHBondContact O-ND2 3.32Å; F36-N40 VanDerWaalsContact O-ND2 3.16Å
37	H	96.7	Very high	96.5	Very high	117 Å²	117	99 Å²	99	54%	0.542	49%	0.49	S	S	.	.	H	α-helix	trans	-63.7	-41.8	176.6	-75.7	79.5	0	0	112	V33 F34 N40 F41	V33-H37 PolarHBondContact O-N 3.4Å; V33-H37 PolarHBondContact O-ND1 3.28Å; F34-H37 PolarHBondContact O-N 2.99Å; H37-N40 PolarHBondContact O-N 3.46Å; H37-F41 WeakPolarHBondContact O-CB 3.38Å; H37-F41 PolarHBondContact O-N 2.96Å
38	Y	97.7	Very high	96.6	Very high	166 Å²	166	98.3 Å²	98.3	65%	0.651	48%	0.483	S	S	*	.	H	α-helix	trans	-61.6	-45.1	177.6	-176.4	-99.2	0	0	111.7	F34 S35 F41 Y42	F34-Y38 WeakPolarHBondContact O-CB 3.34Å; F34-Y38 PolarHBondContact O-N 3.35Å; S35-Y38 PolarHBondContact O-N 3.49Å; Y38-F41 PolarHBondContact O-N 2.75Å; Y38-Y42 WeakPolarHBondContact O-CB 3.47Å; Y38-Y42 PolarHBondContact O-N 3.47Å
39	L	97.4	Very high	96.7	Very high	95 Å²	95	98.6 Å²	98.6	50%	0.497	48%	0.484	S	S	.	.	H	α-helix	trans	-60.7	-46.7	176.3	-178.6	64.6	0	0	111.7	S35 F36 F41 Y42 L43	S35-L39 WeakPolarHBondContact O-CB 3.35Å; S35-L39 PolarHBondContact O-N 2.86Å; F36-L39 PolarHBondContact O-N 3Å; L39-F41 PolarHBondContact O-N 3.39Å; L39-Y42 PolarHBondContact O-N 2.96Å; L39-L43 HydrophobicContact CD1-CD1 4.48Å; L39-L43 HydrophobicContact CG-CD1 4.31Å; L39-L43 WeakPolarHBondContact O-CG 3.4Å; L39-L43 PolarHBondContact O-N 2.77Å
40	N	93.7	Very high	96.9	Very high	72 Å²	72	99.4 Å²	99.4	39%	0.385	48%	0.484	S	S	.	.	H	α-helix	trans	-63	-43.1	178.6	-72.1	-33	0	0	112.2	F36 H37 Y42 L43 W44	F36-N40 VanDerWaalsContact CD1-ND2 3.34Å; F36-N40 WeakPolarHBondContact CD1-ND2 3.36Å; F36-N40 WeakPolarHBondContact CE1-ND2 3.01Å; F36-N40 VanDerWaalsContact CZ-ND2 3.26Å; F36-N40 WeakPolarHBondContact CZ-ND2 3.26Å; F36-N40 PolarHBondContact O-N 3.42Å; F36-N40 PolarHBondContact O-ND2 3.32Å; F36-N40 VanDerWaalsContact O-ND2 3.16Å; H37-N40 PolarHBondContact O-N 3.46Å; N40-Y42 VanDerWaalsContact C-N 3.34Å; N40-L43 PolarHBondContact O-N 3Å; N40-W44 WeakPolarHBondContact O-CB 3.43Å; N40-W44 PolarHBondContact O-N 3.44Å
41	F	98.1	Very high	97	Very high	120 Å²	120	101.6 Å²	101.6	53%	0.526	49%	0.491	S	S	.	.	H	α-helix	trans	-62.8	-42.1	176.1	-179.4	-100.1	0	0	111.6	H37 Y38 L39 W44 F45	H37-F41 WeakPolarHBondContact O-CB 3.38Å; H37-F41 PolarHBondContact O-N 2.96Å; Y38-F41 PolarHBondContact O-N 2.75Å; L39-F41 PolarHBondContact O-N 3.39Å; F41-W44 AromaticContact CD2-CE3 3.94Å; F41-W44 HydrophobicContact CD2-CE3 3.94Å; F41-W44 HydrophobicContact CD2-CZ3 4.14Å; F41-W44 AromaticContact CE2-CE3 3.85Å; F41-W44 HydrophobicContact CE2-CE3 3.85Å; F41-W44 AromaticContact CE2-CZ3 3.59Å; F41-W44 HydrophobicContact CE2-CZ3 3.59Å; F41-W44 HydrophobicContact CZ-CZ3 4.25Å; F41-W44 PolarHBondContact O-N 3.49Å; F41-F45 VanDerWaalsContact O-CB 3.29Å; F41-F45 WeakPolarHBondContact O-CB 3.16Å; F41-F45 PolarHBondContact O-N 3.48Å
42	Y	98.3	Very high	97	Very high	128 Å²	128	103.5 Å²	103.5	50%	0.502	50%	0.5	S	S	.	.	H	α-helix	trans	-62.7	-45.3	177.4	179.8	-98.7	0	0	112.4	Y38 L39 N40 F45 T46	Y38-Y42 WeakPolarHBondContact O-CB 3.47Å; Y38-Y42 PolarHBondContact O-N 3.47Å; L39-Y42 PolarHBondContact O-N 2.96Å; N40-Y42 VanDerWaalsContact C-N 3.34Å; Y42-F45 PolarHBondContact O-N 3.25Å; Y42-T46 HydrophobicContact CD1-CG2 4.42Å; Y42-T46 HydrophobicContact CD2-CG2 4.46Å; Y42-T46 HydrophobicContact CE1-CG2 4Å; Y42-T46 HydrophobicContact CE2-CG2 4.04Å; Y42-T46 WeakPolarHBondContact O-CG2 3.31Å; Y42-T46 PolarHBondContact O-N 2.74Å; Y42-T46 PolarHBondContact O-OG1 3.45Å
43	L	98.2	Very high	97	Very high	91 Å²	91	98.6 Å²	98.6	48%	0.476	49%	0.486	S	S	.	.	H	α-helix	trans	-63.8	-44.6	175.7	-69	174.8	0	0	111.6	L39 N40 F45 T46 T47	L39-L43 HydrophobicContact CD1-CD1 4.48Å; L39-L43 HydrophobicContact CG-CD1 4.31Å; L39-L43 WeakPolarHBondContact O-CG 3.4Å; L39-L43 PolarHBondContact O-N 2.77Å; N40-L43 PolarHBondContact O-N 3Å; L43-F45 PolarHBondContact O-N 3Å; L43-T46 WeakPolarHBondContact CA-OG1 3.4Å; L43-T46 PolarHBondContact O-OG1 3.47Å; L43-T46 VanDerWaalsContact O-OG1 3.07Å; L43-T47 VanDerWaalsContact O-CG2 3.28Å; L43-T47 WeakPolarHBondContact O-CG2 3.31Å; L43-T47 PolarHBondContact O-N 2.86Å; L43-T47 PolarHBondContact O-OG1 3.24Å
44	W	98.2	Very high	97	Very high	139 Å²	139	100 Å²	100	53%	0.527	49%	0.491	S	S	.	.	H	α-helix	trans	-58.7	-47.1	174.3	172.9	79.7	0	0	111.7	N40 F41 T47 L48	N40-W44 WeakPolarHBondContact O-CB 3.43Å; N40-W44 PolarHBondContact O-N 3.44Å; F41-W44 AromaticContact CD2-CE3 3.94Å; F41-W44 HydrophobicContact CD2-CE3 3.94Å; F41-W44 HydrophobicContact CD2-CZ3 4.14Å; F41-W44 AromaticContact CE2-CE3 3.85Å; F41-W44 HydrophobicContact CE2-CE3 3.85Å; F41-W44 AromaticContact CE2-CZ3 3.59Å; F41-W44 HydrophobicContact CE2-CZ3 3.59Å; F41-W44 HydrophobicContact CZ-CZ3 4.25Å; F41-W44 PolarHBondContact O-N 3.49Å; W44-T47 PolarHBondContact O-N 3.29Å; W44-T47 PolarHBondContact O-OG1 3.28Å; W44-L48 HydrophobicContact CD2-CD1 3.98Å; W44-L48 HydrophobicContact CE3-CD1 4.21Å; W44-L48 HydrophobicContact CH2-CD1 3.65Å; W44-L48 HydrophobicContact CZ2-CD1 3.38Å; W44-L48 HydrophobicContact CZ3-CD1 4.05Å; W44-L48 WeakPolarHBondContact O-CG 3.47Å; W44-L48 PolarHBondContact O-N 2.77Å; W44-L48 VanDerWaalsContact O-N 3.12Å
45	F	98.2	Very high	96.9	Very high	107 Å²	107	99.5 Å²	99.5	47%	0.469	49%	0.489	S	S	.	.	H	α-helix	trans	-64	-48.1	-179.2	-176.7	-100.3	0	0	112.5	F41 Y42 L43 T47 L48 V49	F41-F45 VanDerWaalsContact O-CB 3.29Å; F41-F45 WeakPolarHBondContact O-CB 3.16Å; F41-F45 PolarHBondContact O-N 3.48Å; Y42-F45 PolarHBondContact O-N 3.25Å; L43-F45 PolarHBondContact O-N 3Å; F45-T47 VanDerWaalsContact C-N 3.32Å; F45-T47 PolarHBondContact O-N 2.9Å; F45-L48 WeakPolarHBondContact O-CB 3.39Å; F45-L48 PolarHBondContact O-N 3.09Å; F45-L48 VanDerWaalsContact O-N 3.12Å; F45-V49 HydrophobicContact CD1-CG2 4.15Å; F45-V49 HydrophobicContact CE1-CG2 3.75Å; F45-V49 HydrophobicContact CZ-CG2 3.99Å; F45-V49 WeakPolarHBondContact O-CG2 3.43Å; F45-V49 PolarHBondContact O-N 2.72Å
46	T	97.7	Very high	96.7	Very high	38 Å²	38	98.5 Å²	98.5	23%	0.233	48%	0.482	C	S	.	.	H	α-helix	trans	-62.1	-38.3	178.7	48.9	0	0	0	112.3	Y42 L43 L48 V49 I50	Y42-T46 HydrophobicContact CD1-CG2 4.42Å; Y42-T46 HydrophobicContact CD2-CG2 4.46Å; Y42-T46 HydrophobicContact CE1-CG2 4Å; Y42-T46 HydrophobicContact CE2-CG2 4.04Å; Y42-T46 WeakPolarHBondContact O-CG2 3.31Å; Y42-T46 PolarHBondContact O-N 2.74Å; Y42-T46 PolarHBondContact O-OG1 3.45Å; L43-T46 WeakPolarHBondContact CA-OG1 3.4Å; L43-T46 PolarHBondContact O-OG1 3.47Å; L43-T46 VanDerWaalsContact O-OG1 3.07Å; T46-L48 VanDerWaalsContact C-N 3.34Å; T46-L48 PolarHBondContact O-N 2.95Å; T46-V49 PolarHBondContact O-N 3.02Å; T46-I50 VanDerWaalsContact O-CG1 3.32Å; T46-I50 WeakPolarHBondContact O-CG1 3.27Å; T46-I50 PolarHBondContact O-N 3.3Å
47	T	97.9	Very high	96.4	Very high	66 Å²	66	97.8 Å²	97.8	41%	0.405	48%	0.483	S	S	.	.	H	α-helix	trans	-65.7	-34.5	174.1	61.3	0	0	0	112.9	L43 W44 F45 K51	L43-T47 VanDerWaalsContact O-CG2 3.28Å; L43-T47 WeakPolarHBondContact O-CG2 3.31Å; L43-T47 PolarHBondContact O-N 2.86Å; L43-T47 PolarHBondContact O-OG1 3.24Å; W44-T47 PolarHBondContact O-N 3.29Å; W44-T47 PolarHBondContact O-OG1 3.28Å; F45-T47 VanDerWaalsContact C-N 3.32Å; F45-T47 PolarHBondContact O-N 2.9Å; T47-K51 VanDerWaalsContact O-CG 3.31Å; T47-K51 WeakPolarHBondContact O-CG 3.35Å; T47-K51 PolarHBondContact O-N 2.98Å
48	L	96.8	Very high	96.2	Very high	67 Å²	67	98 Å²	98	35%	0.351	49%	0.485	S	S	.	.	H	α-helix	trans	-64.3	-46	172	-71.8	179.3	0	0	111.6	W44 F45 T46 I50 K51 V52	W44-L48 HydrophobicContact CD2-CD1 3.98Å; W44-L48 HydrophobicContact CE3-CD1 4.21Å; W44-L48 HydrophobicContact CH2-CD1 3.65Å; W44-L48 HydrophobicContact CZ2-CD1 3.38Å; W44-L48 HydrophobicContact CZ3-CD1 4.05Å; W44-L48 WeakPolarHBondContact O-CG 3.47Å; W44-L48 PolarHBondContact O-N 2.77Å; W44-L48 VanDerWaalsContact O-N 3.12Å; F45-L48 WeakPolarHBondContact O-CB 3.39Å; F45-L48 PolarHBondContact O-N 3.09Å; F45-L48 VanDerWaalsContact O-N 3.12Å; T46-L48 VanDerWaalsContact C-N 3.34Å; T46-L48 PolarHBondContact O-N 2.95Å; L48-I50 VanDerWaalsContact C-N 3.32Å; L48-I50 PolarHBondContact O-N 2.94Å; L48-K51 PolarHBondContact O-N 3.37Å; L48-V52 WeakPolarHBondContact O-CG2 3.32Å; L48-V52 PolarHBondContact O-N 2.95Å
49	V	97.3	Very high	95.8	Very high	77 Å²	77	93 Å²	93	47%	0.467	47%	0.471	S	S	.	.	H	α-helix	trans	-58.8	-44.5	177.8	173.5	0	0	0	111.1	F45 T46 K51 V52 A53	F45-V49 HydrophobicContact CD1-CG2 4.15Å; F45-V49 HydrophobicContact CE1-CG2 3.75Å; F45-V49 HydrophobicContact CZ-CG2 3.99Å; F45-V49 WeakPolarHBondContact O-CG2 3.43Å; F45-V49 PolarHBondContact O-N 2.72Å; T46-V49 PolarHBondContact O-N 3.02Å; V49-K51 PolarHBondContact O-N 3.47Å; V49-V52 PolarHBondContact O-N 3.27Å; V49-A53 PolarHBondContact O-N 3.48Å
50	I	97.9	Very high	95.5	Very high	99 Å²	99	92.4 Å²	92.4	51%	0.508	47%	0.471	S	S	.	.	H	α-helix	trans	-62.2	-44.8	176.8	-67.2	164.3	0	0	110.9	T46 L48 V52 A53 L54	T46-I50 VanDerWaalsContact O-CG1 3.32Å; T46-I50 WeakPolarHBondContact O-CG1 3.27Å; T46-I50 PolarHBondContact O-N 3.3Å; L48-I50 VanDerWaalsContact C-N 3.32Å; L48-I50 PolarHBondContact O-N 2.94Å; I50-V52 VanDerWaalsContact C-N 3.33Å; I50-V52 PolarHBondContact O-N 3.43Å; I50-A53 PolarHBondContact O-N 2.93Å; I50-L54 HydrophobicContact CG2-CD1 3.85Å; I50-L54 HydrophobicContact CG2-CG 4.27Å; I50-L54 WeakPolarHBondContact O-CB 3.39Å; I50-L54 VanDerWaalsContact O-CG 3.3Å; I50-L54 WeakPolarHBondContact O-CG 3.49Å; I50-L54 PolarHBondContact O-N 3.08Å
51	K	95.8	Very high	95.4	Very high	139 Å²	139	92.6 Å²	92.6	60%	0.604	48%	0.475	S	S	*	.	H	α-helix	trans	-60.7	-41.7	177.4	-75.6	174.3	-179.6	179.6	112.1	T47 L48 V49 L54 F55	T47-K51 VanDerWaalsContact O-CG 3.31Å; T47-K51 WeakPolarHBondContact O-CG 3.35Å; T47-K51 PolarHBondContact O-N 2.98Å; L48-K51 PolarHBondContact O-N 3.37Å; V49-K51 PolarHBondContact O-N 3.47Å; K51-L54 PolarHBondContact O-N 3Å; K51-F55 WeakPolarHBondContact O-CB 3.41Å; K51-F55 PolarHBondContact O-N 3.19Å
52	V	96.5	Very high	95	Very high	102 Å²	102	90.4 Å²	90.4	62%	0.618	47%	0.471	S	S	*	.	H	α-helix	trans	-64	-45.3	176.9	172.4	0	0	0	111	L48 V49 I50 L54 F55 S56	L48-V52 WeakPolarHBondContact O-CG2 3.32Å; L48-V52 PolarHBondContact O-N 2.95Å; V49-V52 PolarHBondContact O-N 3.27Å; I50-V52 VanDerWaalsContact C-N 3.33Å; I50-V52 PolarHBondContact O-N 3.43Å; V52-L54 PolarHBondContact O-N 2.93Å; V52-F55 PolarHBondContact O-N 3.21Å; V52-S56 PolarHBondContact O-N 3.01Å; V52-S56 PolarHBondContact O-OG 3.12Å
53	A	95.4	Very high	94.5	Very high	45 Å²	45	88.7 Å²	88.7	37%	0.372	47%	0.471	S	S	.	.	H	α-helix	trans	-64.5	-39	178.2	0	0	0	0	112.8	V49 I50 S56 N57	V49-A53 PolarHBondContact O-N 3.48Å; I50-A53 PolarHBondContact O-N 2.93Å; A53-S56 PolarHBondContact O-OG 2.93Å; A53-N57 PolarHBondContact O-N 3.28Å; A53-N57 PolarHBondContact O-ND2 3.29Å
54	L	95.6	Very high	94.1	Very high	97 Å²	97	88.5 Å²	88.5	51%	0.508	47%	0.47	S	S	.	.	H	α-helix	trans	-67.7	-41.4	175.2	-70.1	175	0	0	111.5	I50 K51 V52 N57 Q58	I50-L54 HydrophobicContact CG2-CD1 3.85Å; I50-L54 HydrophobicContact CG2-CG 4.27Å; I50-L54 WeakPolarHBondContact O-CB 3.39Å; I50-L54 VanDerWaalsContact O-CG 3.3Å; I50-L54 WeakPolarHBondContact O-CG 3.49Å; I50-L54 PolarHBondContact O-N 3.08Å; K51-L54 PolarHBondContact O-N 3Å; V52-L54 PolarHBondContact O-N 2.93Å; L54-N57 PolarHBondContact O-N 2.92Å; L54-Q58 WeakPolarHBondContact O-CG 3.29Å; L54-Q58 PolarHBondContact O-N 3.27Å
55	F	94.1	Very high	93.7	Very high	136 Å²	136	86.8 Å²	86.8	60%	0.596	47%	0.471	S	S	*	.	H	α-helix	trans	-62.2	-45.2	177.1	-179	-100.5	0	0	111.8	K51 V52 N57 Q58 V59	K51-F55 WeakPolarHBondContact O-CB 3.41Å; K51-F55 PolarHBondContact O-N 3.19Å; V52-F55 PolarHBondContact O-N 3.21Å; F55-N57 VanDerWaalsContact C-N 3.31Å; F55-N57 PolarHBondContact O-N 3.12Å; F55-Q58 PolarHBondContact O-N 3.49Å; F55-V59 HydrophobicContact CD1-CG2 4.21Å; F55-V59 HydrophobicContact CE1-CG2 3.8Å; F55-V59 HydrophobicContact CE2-CG2 4.35Å; F55-V59 HydrophobicContact CZ-CG2 3.88Å; F55-V59 WeakPolarHBondContact O-CG2 3.45Å; F55-V59 PolarHBondContact O-N 2.96Å
56	S	92.1	Very high	93.3	Very high	56 Å²	56	87.3 Å²	87.3	39%	0.392	48%	0.475	S	S	.	.	H	α-helix	trans	-60.7	-41.1	176.5	55.4	0	0	0	112.2	V52 A53 V59 V60	V52-S56 PolarHBondContact O-N 3.01Å; V52-S56 PolarHBondContact O-OG 3.12Å; A53-S56 PolarHBondContact O-OG 2.93Å; S56-V59 PolarHBondContact O-N 3.49Å; S56-V60 WeakPolarHBondContact O-CG2 3.44Å; S56-V60 PolarHBondContact O-N 3.47Å
57	N	91.8	Very high	92.7	Very high	96 Å²	96	88.5 Å²	88.5	51%	0.513	49%	0.485	S	S	.	.	H	α-helix	trans	-66.7	-37.7	177.7	-69.1	-16.7	0	0	112.2	A53 L54 F55 V60 T61	A53-N57 PolarHBondContact O-N 3.28Å; A53-N57 PolarHBondContact O-ND2 3.29Å; L54-N57 PolarHBondContact O-N 2.92Å; F55-N57 VanDerWaalsContact C-N 3.31Å; F55-N57 PolarHBondContact O-N 3.12Å; N57-V60 PolarHBondContact O-N 2.87Å; N57-T61 WeakPolarHBondContact O-CB 3.47Å; N57-T61 PolarHBondContact O-N 2.99Å; N57-T61 PolarHBondContact O-OG1 3.47Å
58	Q	91.7	Very high	92.3	Very high	123 Å²	123	92.3 Å²	92.3	58%	0.575	49%	0.493	S	S	*	.	H	α-helix	trans	-63.3	-43.3	173.7	-74.1	175.2	-5	0	111.4	L54 F55 T61 V62	L54-Q58 WeakPolarHBondContact O-CG 3.29Å; L54-Q58 PolarHBondContact O-N 3.27Å; F55-Q58 PolarHBondContact O-N 3.49Å; Q58-T61 PolarHBondContact O-N 3.23Å; Q58-V62 VanDerWaalsContact O-CG2 3.31Å; Q58-V62 WeakPolarHBondContact O-CG2 3.34Å; Q58-V62 PolarHBondContact O-N 3.05Å
59	V	90	Very high	92	Very high	60 Å²	60	95.9 Å²	95.9	36%	0.364	51%	0.507	S	S	.	.	H	α-helix	trans	-61	-46	176.8	173.5	0	0	0	111.3	F55 S56 T61 V62 N63	F55-V59 HydrophobicContact CD1-CG2 4.21Å; F55-V59 HydrophobicContact CE1-CG2 3.8Å; F55-V59 HydrophobicContact CE2-CG2 4.35Å; F55-V59 HydrophobicContact CZ-CG2 3.88Å; F55-V59 WeakPolarHBondContact O-CG2 3.45Å; F55-V59 PolarHBondContact O-N 2.96Å; S56-V59 PolarHBondContact O-N 3.49Å; V59-T61 VanDerWaalsContact C-N 3.34Å; V59-T61 PolarHBondContact O-N 3.4Å; V59-V62 PolarHBondContact O-N 3.33Å; V59-N63 VanDerWaalsContact O-CG 3.24Å; V59-N63 PolarHBondContact O-N 3.43Å; V59-N63 PolarHBondContact O-ND2 3.26Å
60	V	91	Very high	91.4	Very high	83 Å²	83	98.8 Å²	98.8	50%	0.503	52%	0.52	S	S	.	.	H	α-helix	trans	-61.8	-43.5	176.1	177.4	0	0	0	111.1	S56 N57 V62 N63 L64	S56-V60 WeakPolarHBondContact O-CG2 3.44Å; S56-V60 PolarHBondContact O-N 3.47Å; N57-V60 PolarHBondContact O-N 2.87Å; V60-V62 PolarHBondContact O-N 3.49Å; V60-N63 PolarHBondContact O-N 3.36Å; V60-L64 HydrophobicContact CG1-CD1 4.12Å; V60-L64 HydrophobicContact CG1-CG 4.42Å; V60-L64 WeakPolarHBondContact O-CG 3.46Å; V60-L64 PolarHBondContact O-N 2.92Å
61	T	90.4	Very high	90.8	Very high	75 Å²	75	100.5 Å²	100.5	46%	0.46	53%	0.53	S	S	.	.	H	α-helix	trans	-63.6	-40.9	179.8	-55.1	0	0	0	112	N57 Q58 V59 L64 N65	N57-T61 WeakPolarHBondContact O-CB 3.47Å; N57-T61 PolarHBondContact O-N 2.99Å; N57-T61 PolarHBondContact O-OG1 3.47Å; Q58-T61 PolarHBondContact O-N 3.23Å; V59-T61 VanDerWaalsContact C-N 3.34Å; V59-T61 PolarHBondContact O-N 3.4Å; T61-L64 PolarHBondContact O-N 3.24Å; T61-N65 PolarHBondContact O-N 3.32Å
62	V	90.9	Very high	90.1	Very high	75 Å²	75	103.4 Å²	103.4	46%	0.455	55%	0.55	S	S	.	.	H	α-helix	trans	-65.5	-44.8	176.4	171.9	0	0	0	111	Q58 V59 V60 L64 N65 Q66	Q58-V62 VanDerWaalsContact O-CG2 3.31Å; Q58-V62 WeakPolarHBondContact O-CG2 3.34Å; Q58-V62 PolarHBondContact O-N 3.05Å; V59-V62 PolarHBondContact O-N 3.33Å; V60-V62 PolarHBondContact O-N 3.49Å; V62-L64 VanDerWaalsContact C-N 3.3Å; V62-L64 PolarHBondContact O-N 2.97Å; V62-N65 PolarHBondContact O-N 2.81Å; V62-Q66 WeakPolarHBondContact O-CG 3.26Å; V62-Q66 PolarHBondContact O-N 2.79Å
63	N	86.5	Confident	89.8	Confident	92 Å²	92	103.5 Å²	103.5	49%	0.492	55%	0.546	S	S	.	.	H	α-helix	trans	-61	-39.5	177.6	-69.8	-13.1	0	0	111.9	V59 V60 S67	V59-N63 VanDerWaalsContact O-CG 3.24Å; V59-N63 PolarHBondContact O-N 3.43Å; V59-N63 PolarHBondContact O-ND2 3.26Å; V60-N63 PolarHBondContact O-N 3.36Å; N63-S67 WeakPolarHBondContact O-CB 3.46Å; N63-S67 PolarHBondContact O-N 2.99Å
64	L	90.7	Very high	89.5	Confident	87 Å²	87	106.6 Å²	106.6	46%	0.455	56%	0.556	S	S	.	*	H	α-helix	trans	-63.4	-48.7	174.6	-71.8	173.7	0	0	111.2	V60 T61 V62 Q66 S67 Y68	V60-L64 HydrophobicContact CG1-CD1 4.12Å; V60-L64 HydrophobicContact CG1-CG 4.42Å; V60-L64 WeakPolarHBondContact O-CG 3.46Å; V60-L64 PolarHBondContact O-N 2.92Å; T61-L64 PolarHBondContact O-N 3.24Å; V62-L64 VanDerWaalsContact C-N 3.3Å; V62-L64 PolarHBondContact O-N 2.97Å; L64-Q66 VanDerWaalsContact C-N 3.33Å; L64-Q66 PolarHBondContact O-N 3.24Å; L64-S67 PolarHBondContact O-N 3.48Å; L64-S67 VanDerWaalsContact O-N 3.17Å; L64-Y68 HydrophobicContact CB-CD2 4.39Å; L64-Y68 HydrophobicContact CB-CE2 4.11Å; L64-Y68 WeakPolarHBondContact O-CD2 3.39Å; L64-Y68 PolarHBondContact O-N 3.41Å
65	N	88.5	Confident	89.1	Confident	103 Å²	103	107.1 Å²	107.1	55%	0.551	56%	0.558	S	S	*	*	H	α-helix	trans	-61.3	-39	179.3	-75.5	-5.7	0	0	112.9	T61 V62 Y68 H69	T61-N65 PolarHBondContact O-N 3.32Å; V62-N65 PolarHBondContact O-N 2.81Å; N65-Y68 PolarHBondContact O-N 3.02Å; N65-H69 PolarHBondContact O-N 3.46Å
66	Q	90	Very high	88.8	Confident	118 Å²	118	105.4 Å²	105.4	55%	0.551	56%	0.556	S	S	*	*	H	α-helix	trans	-67.9	-40.9	174.2	-71.9	-179.8	-10	0	112.1	V62 L64 Y68 H69 N70	V62-Q66 WeakPolarHBondContact O-CG 3.26Å; V62-Q66 PolarHBondContact O-N 2.79Å; L64-Q66 VanDerWaalsContact C-N 3.33Å; L64-Q66 PolarHBondContact O-N 3.24Å; Q66-Y68 VanDerWaalsContact C-N 3.33Å; Q66-Y68 PolarHBondContact O-N 3.47Å; Q66-H69 PolarHBondContact O-N 3.33Å; Q66-N70 PolarHBondContact O-N 3.01Å
67	S	86.1	Confident	88.6	Confident	63 Å²	63	108.5 Å²	108.5	44%	0.441	57%	0.566	S	S	.	*	H	α-helix	trans	-62.3	-40.3	174.1	-172.8	0	0	0	111.9	N63 L64 H69 N70 L71	N63-S67 WeakPolarHBondContact O-CB 3.46Å; N63-S67 PolarHBondContact O-N 2.99Å; L64-S67 PolarHBondContact O-N 3.48Å; L64-S67 VanDerWaalsContact O-N 3.17Å; S67-H69 VanDerWaalsContact C-N 3.34Å; S67-N70 PolarHBondContact O-N 3.29Å; S67-L71 VanDerWaalsContact O-CG 3.32Å; S67-L71 WeakPolarHBondContact O-CG 3.34Å; S67-L71 PolarHBondContact O-N 3.45Å
68	Y	90	Very high	88.4	Confident	145 Å²	145	109.3 Å²	109.3	57%	0.569	57%	0.57	S	S	*	*	H	α-helix	trans	-62.9	-41.1	174.1	-74.5	-62.3	0	0	111.4	L64 N65 Q66 N70 L71	L64-Y68 HydrophobicContact CB-CD2 4.39Å; L64-Y68 HydrophobicContact CB-CE2 4.11Å; L64-Y68 WeakPolarHBondContact O-CD2 3.39Å; L64-Y68 PolarHBondContact O-N 3.41Å; N65-Y68 PolarHBondContact O-N 3.02Å; Q66-Y68 VanDerWaalsContact C-N 3.33Å; Q66-Y68 PolarHBondContact O-N 3.47Å; Y68-N70 VanDerWaalsContact C-N 3.34Å; Y68-N70 PolarHBondContact O-N 3.44Å; Y68-L71 PolarHBondContact O-N 3.05Å
69	H	90.6	Very high	88.2	Confident	142 Å²	142	108.4 Å²	108.4	66%	0.657	57%	0.57	S	S	*	*	H	α-helix	trans	-67.1	-32.1	175.9	-168.2	-61.5	0	0	112.9	N65 Q66 S67 L71	N65-H69 PolarHBondContact O-N 3.46Å; Q66-H69 PolarHBondContact O-N 3.33Å; S67-H69 VanDerWaalsContact C-N 3.34Å; H69-L71 VanDerWaalsContact C-N 3.29Å
70	N	83.3	Confident	88.1	Confident	138 Å²	138	112.1 Å²	112.1	74%	0.738	59%	0.585	S	S	*	*	H	α-helix	trans	-77.4	-12.4	176.5	-74.8	-5.4	0	0	113.8	Q66 S67 Y68	Q66-N70 PolarHBondContact O-N 3.01Å; S67-N70 PolarHBondContact O-N 3.29Å; Y68-N70 VanDerWaalsContact C-N 3.34Å; Y68-N70 PolarHBondContact O-N 3.44Å
71	L	85.5	Confident	87.8	Confident	136 Å²	136	114.5 Å²	114.5	71%	0.712	59%	0.592	S	S	*	*	H	α-helix	trans	-91.8	-18.9	178.3	-76	168.3	0	0	113.5	S67 Y68 H69	S67-L71 VanDerWaalsContact O-CG 3.32Å; S67-L71 WeakPolarHBondContact O-CG 3.34Å; S67-L71 PolarHBondContact O-N 3.45Å; Y68-L71 PolarHBondContact O-N 3.05Å; H69-L71 VanDerWaalsContact C-N 3.29Å
72	I	81.1	Confident	87.6	Confident	200 Å²	200	118.1 Å²	118.1	100%	1.026	60%	0.604	S	S	*	*			trans	-88.9	0	176.7	-61.7	169.9	0	0	109

Retrieved 72 of 72 residues in 38.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).