A0A5K4F8S5_SCHMA Loading...

Egg protein CP391S-like protein AlphaSync

AlphaFold DB , UniProt , Accession A0A5K4F8S5, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 121 aa.

						>A0A5K4F8S5_SCHMA|A0A5K4F8S5
MKVSNETCLSASKPDMECHWCSTANLCSNGRDTLSKAWMINNCTKNNMQKDKKSDHKDKKSEHMDNKSDQKDKKSEQMDNKSDQKDNKPMFNYLYVLIPSVIGLVIVCVGFIVWFWLSKRQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.4	Low	76.5	Confident	240 Å²	240	97.9 Å²	97.9	100%	1.182	53%	0.529	S	S	*	.				0	120.9	0	-68.8	164.7	174.7	0	0	107.5
2	K	60.4	Low	76.8	Confident	215 Å²	215	93.5 Å²	93.5	94%	0.935	51%	0.511	S	S	*	.			trans	-83.6	113.1	171.8	-69.5	-179.5	179.8	-179.6	0	106.6
3	V	73.8	Confident	76.9	Confident	62 Å²	62	97.4 Å²	97.4	38%	0.376	52%	0.52	S	S	.	.			trans	-78.3	131.5	174.5	-179.5	0	0	0	0	106.9	T7 C8 W20 C27	V3-T7 HydrophobicContact CG1-CG2 4.19Å; V3-C8 HydrophobicContact CG1-CB 4.21Å; V3-W20 HydrophobicContact CB-CZ3 4.41Å; V3-W20 HydrophobicContact CG1-CZ3 4.46Å; V3-W20 WeakPolarHBondContact O-CH2 3.35Å; V3-W20 WeakPolarHBondContact O-CZ3 3.32Å; V3-C27 HydrophobicContact CG1-CB 4.07Å
4	S	81.3	Confident	76.8	Confident	38 Å²	38	101.1 Å²	101.1	27%	0.266	55%	0.552	S	S	.	*			trans	-85.2	159.4	172.5	63.7	0	0	0	0	110.8	E6 T7 C8	S4-E6 VanDerWaalsContact C-N 3.28Å; S4-E6 WeakPolarHBondContact CB-OE1 3.38Å; S4-E6 PolarHBondContact O-N 3.25Å; S4-E6 WeakPolarHBondContact OG-CG 3.27Å; S4-E6 PolarHBondContact OG-OE1 2.84Å; S4-T7 WeakPolarHBondContact O-CB 3.36Å; S4-T7 PolarHBondContact O-N 3.23Å; S4-T7 VanDerWaalsContact O-N 3.09Å; S4-T7 PolarHBondContact OG-OG1 3.03Å; S4-C8 PolarHBondContact O-N 3.04Å
5	N	81.4	Confident	76.7	Confident	63 Å²	63	103 Å²	103	34%	0.337	56%	0.561	S	S	.	*	H	α-helix	trans	-53.6	-45.8	178	-176.5	15.5	0	0	0	111.8	T7 C8 L9 W20	N5-T7 VanDerWaalsContact C-N 3.28Å; N5-T7 PolarHBondContact O-N 3.48Å; N5-C8 WeakPolarHBondContact O-CB 3.21Å; N5-C8 PolarHBondContact O-N 3.39Å; N5-C8 VanDerWaalsContact O-N 3.16Å; N5-L9 WeakPolarHBondContact O-CG 3.37Å; N5-L9 PolarHBondContact O-N 3.31Å; N5-L9 WeakPolarHBondContact OD1-CD1 3.48Å; N5-W20 HydrophobicContact CB-CD2 3.87Å; N5-W20 HydrophobicContact CB-CG 3.83Å; N5-W20 WeakPolarHBondContact OD1-CB 3.32Å; N5-W20 VanDerWaalsContact OD1-CG 3.24Å
6	E	81.1	Confident	76.4	Confident	144 Å²	144	102.9 Å²	102.9	67%	0.673	56%	0.558	S	S	*	*	H	α-helix	trans	-63.1	-34.2	179.6	72.6	-128.4	137.8	0	0	112.7	S4 S10	S4-E6 VanDerWaalsContact C-N 3.28Å; S4-E6 WeakPolarHBondContact CB-OE1 3.38Å; S4-E6 PolarHBondContact O-N 3.25Å; S4-E6 WeakPolarHBondContact OG-CG 3.27Å; S4-E6 PolarHBondContact OG-OE1 2.84Å; E6-S10 VanDerWaalsContact O-CB 3.29Å; E6-S10 WeakPolarHBondContact O-CB 3.34Å; E6-S10 PolarHBondContact O-N 2.84Å; E6-S10 PolarHBondContact O-OG 3.3Å
7	T	83.2	Confident	76.5	Confident	72 Å²	72	103.9 Å²	103.9	44%	0.442	56%	0.558	S	S	.	*	H	α-helix	trans	-72.5	-37.2	177.9	-54	0	0	0	0	110.5	V3 S4 N5 S10 A11	V3-T7 HydrophobicContact CG1-CG2 4.19Å; S4-T7 WeakPolarHBondContact O-CB 3.36Å; S4-T7 PolarHBondContact O-N 3.23Å; S4-T7 VanDerWaalsContact O-N 3.09Å; S4-T7 PolarHBondContact OG-OG1 3.03Å; N5-T7 VanDerWaalsContact C-N 3.28Å; N5-T7 PolarHBondContact O-N 3.48Å; T7-S10 WeakPolarHBondContact CA-OG 3.35Å; T7-S10 PolarHBondContact O-OG 2.95Å; T7-S10 VanDerWaalsContact O-OG 3.09Å; T7-A11 WeakPolarHBondContact O-CB 3.38Å; T7-A11 PolarHBondContact O-N 3.45Å; T7-A11 VanDerWaalsContact O-N 3.14Å
8	C	83.7	Confident	76.7	Confident	1 Å²	1	99.3 Å²	99.3	1%	0.007	53%	0.534	C	S	.	.	H	α-helix	trans	-64	-48.8	176.1	-179	0	0	0	0	112	V3 S4 N5 A11 S12 C18 H19 W20 C27	V3-C8 HydrophobicContact CG1-CB 4.21Å; S4-C8 PolarHBondContact O-N 3.04Å; N5-C8 WeakPolarHBondContact O-CB 3.21Å; N5-C8 PolarHBondContact O-N 3.39Å; N5-C8 VanDerWaalsContact O-N 3.16Å; C8-A11 PolarHBondContact O-N 3.16Å; C8-S12 PolarHBondContact O-N 3.36Å; C8-C18 WeakPolarHBondContact O-CB 3.39Å; C8-H19 VanDerWaalsContact SG-C 3.56Å; C8-H19 PolarHBondContact SG-O 3.43Å; C8-H19 VanDerWaalsContact SG-O 3.36Å; C8-W20 HydrophobicContact CB-CE3 3.82Å; C8-C27 WeakPolarHBondContact CA-SG 3.33Å; C8-C27 HydrophobicContact CB-CB 3.53Å; C8-C27 WeakPolarHBondContact CB-SG 3.23Å; C8-C27 VanDerWaalsContact SG-CA 3.56Å; C8-C27 WeakPolarHBondContact SG-CB 3.27Å; C8-C27 CovalentContact SG-SG 2.02Å; C8-C27 PolarHBondContact SG-SG 3.32Å
9	L	81.5	Confident	77	Confident	93 Å²	93	96.7 Å²	96.7	49%	0.487	52%	0.519	S	S	.	.	H	α-helix	trans	-70	-36.5	-177.6	-66	175.1	0	0	0	111.9	N5 A11 S12	N5-L9 WeakPolarHBondContact O-CG 3.37Å; N5-L9 PolarHBondContact O-N 3.31Å; N5-L9 WeakPolarHBondContact OD1-CD1 3.48Å; L9-A11 VanDerWaalsContact C-N 3.29Å; L9-A11 PolarHBondContact O-N 2.87Å; L9-S12 WeakPolarHBondContact O-CB 3.45Å; L9-S12 PolarHBondContact O-N 3.48Å
10	S	83.1	Confident	77.3	Confident	93 Å²	93	93.2 Å²	93.2	65%	0.65	50%	0.498	S	S	*	.	H	α-helix	trans	-70.4	-24.6	175.2	56.2	0	0	0	0	113.5	E6 T7 S12	E6-S10 VanDerWaalsContact O-CB 3.29Å; E6-S10 WeakPolarHBondContact O-CB 3.34Å; E6-S10 PolarHBondContact O-N 2.84Å; E6-S10 PolarHBondContact O-OG 3.3Å; T7-S10 WeakPolarHBondContact CA-OG 3.35Å; T7-S10 PolarHBondContact O-OG 2.95Å; T7-S10 VanDerWaalsContact O-OG 3.09Å; S10-S12 VanDerWaalsContact C-N 3.25Å; S10-S12 PolarHBondContact O-N 2.86Å
11	A	81.6	Confident	77.5	Confident	56 Å²	56	88.7 Å²	88.7	46%	0.463	47%	0.474	S	S	.	.	T	Hydrogen-bonded Turn	trans	-77.5	-10.2	172.8	0	0	0	0	0	113.4	T7 C8 L9 K13	T7-A11 WeakPolarHBondContact O-CB 3.38Å; T7-A11 PolarHBondContact O-N 3.45Å; T7-A11 VanDerWaalsContact O-N 3.14Å; C8-A11 PolarHBondContact O-N 3.16Å; L9-A11 VanDerWaalsContact C-N 3.29Å; L9-A11 PolarHBondContact O-N 2.87Å; A11-K13 PolarHBondContact O-N 3.28Å
12	S	80.3	Confident	79	Confident	45 Å²	45	79 Å²	79	32%	0.315	43%	0.43	S	S	.	.			trans	-65.4	124.2	178.4	-164.4	0	0	0	0	110.5	C8 L9 S10 E17 C18	C8-S12 PolarHBondContact O-N 3.36Å; L9-S12 WeakPolarHBondContact O-CB 3.45Å; L9-S12 PolarHBondContact O-N 3.48Å; S10-S12 VanDerWaalsContact C-N 3.25Å; S10-S12 PolarHBondContact O-N 2.86Å; S12-E17 WeakPolarHBondContact OG-CA 3.2Å; S12-C18 PolarHBondContact OG-N 2.91Å; S12-C18 VanDerWaalsContact OG-N 3.11Å
13	K	78.2	Confident	79.8	Confident	144 Å²	144	72.3 Å²	72.3	63%	0.626	41%	0.407	S	S	*	.	B	Isolated β-bridge	trans	-112.1	156.8	178.1	-70.2	-178.4	-176.2	180	0	109.2	A11 D15 M16	A11-K13 PolarHBondContact O-N 3.28Å; K13-D15 PolarHBondContact O-N 3.31Å; K13-M16 PolarHBondContact N-O 2.92Å; K13-M16 CarbonylContact O-C 3.09Å; K13-M16 PolarHBondContact O-N 2.92Å; K13-M16 VanDerWaalsContact O-O 3.06Å
14	P	74.7	Confident	79.9	Confident	150 Å²	150	70.8 Å²	70.8	97%	0.974	40%	0.4	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.4	-26.2	176.3	22	-33.7	0	0	0	113.4
15	D	75.7	Confident	79.8	Confident	129 Å²	129	74.6 Å²	74.6	69%	0.69	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.3	-19.8	176.9	-165	50.8	0	0	0	113.4	K13	K13-D15 PolarHBondContact O-N 3.31Å
16	M	71.8	Confident	79.7	Confident	102 Å²	102	72.8 Å²	72.8	50%	0.502	41%	0.408	S	S	.	.	B	Isolated β-bridge	trans	-139.9	91.2	-177.9	-65.5	-152	-172.9	0	0	110.7	K13 C18	K13-M16 PolarHBondContact N-O 2.92Å; K13-M16 CarbonylContact O-C 3.09Å; K13-M16 PolarHBondContact O-N 2.92Å; K13-M16 VanDerWaalsContact O-O 3.06Å; M16-C18 PolarHBondContact O-N 3.33Å
17	E	77.6	Confident	79.6	Confident	120 Å²	120	67.3 Å²	67.3	56%	0.561	39%	0.386	S	S	*	.			trans	-75.6	112.3	177.3	-169.5	173.5	167.1	0	0	110.4	S12 H19 N29	S12-E17 WeakPolarHBondContact OG-CA 3.2Å; E17-H19 IonicContact OE1-CE1 3.12Å; E17-H19 PolarHBondContact OE1-CE1 3.23Å; E17-H19 IonicContact OE1-NE2 3.89Å; E17-N29 WeakPolarHBondContact O-CA 3.34Å; E17-N29 WeakPolarHBondContact O-CB 3.36Å
18	C	80.1	Confident	79.5	Confident	20 Å²	20	64 Å²	64	14%	0.135	37%	0.365	C	S	.	.			trans	-92.9	139.4	177.7	-73.5	0	0	0	0	110.7	C8 S12 M16	C8-C18 WeakPolarHBondContact O-CB 3.39Å; S12-C18 PolarHBondContact OG-N 2.91Å; S12-C18 VanDerWaalsContact OG-N 3.11Å; M16-C18 PolarHBondContact O-N 3.33Å
19	H	82.4	Confident	79.1	Confident	51 Å²	51	65 Å²	65	24%	0.236	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	146.7	178.9	-64	-59.3	0	0	0	111.5	C8 E17 C27 S28 W38 N47	C8-H19 VanDerWaalsContact SG-C 3.56Å; C8-H19 PolarHBondContact SG-O 3.43Å; C8-H19 VanDerWaalsContact SG-O 3.36Å; E17-H19 IonicContact OE1-CE1 3.12Å; E17-H19 PolarHBondContact OE1-CE1 3.23Å; E17-H19 IonicContact OE1-NE2 3.89Å; H19-C27 WeakPolarHBondContact O-CA 3.15Å; H19-S28 PolarHBondContact N-O 3.48Å; H19-S28 PolarHBondContact O-N 3.09Å; H19-W38 HydrophobicContact CB-CH2 3.27Å; H19-W38 HydrophobicContact CB-CZ2 3.64Å; H19-W38 HydrophobicContact CB-CZ3 4.2Å; H19-W38 VanDerWaalsContact O-CH2 3.32Å; H19-W38 WeakPolarHBondContact O-CH2 3.37Å; H19-W38 VanDerWaalsContact O-CZ3 3.25Å; H19-W38 WeakPolarHBondContact O-CZ3 3.25Å; H19-N47 VanDerWaalsContact CB-ND2 3.26Å; H19-N47 WeakPolarHBondContact CB-ND2 3.41Å; H19-N47 PolarHBondContact ND1-ND2 2.86Å
20	W	84	Confident	78.4	Confident	25 Å²	25	61.9 Å²	61.9	10%	0.095	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	120.1	-179.6	178.5	-105.9	0	0	0	112.1	V3 N5 C8 S22 N25 C27 N47	V3-W20 HydrophobicContact CB-CZ3 4.41Å; V3-W20 HydrophobicContact CG1-CZ3 4.46Å; V3-W20 WeakPolarHBondContact O-CH2 3.35Å; V3-W20 WeakPolarHBondContact O-CZ3 3.32Å; N5-W20 HydrophobicContact CB-CD2 3.87Å; N5-W20 HydrophobicContact CB-CG 3.83Å; N5-W20 WeakPolarHBondContact OD1-CB 3.32Å; N5-W20 VanDerWaalsContact OD1-CG 3.24Å; C8-W20 HydrophobicContact CB-CE3 3.82Å; W20-S22 PolarHBondContact NE1-OG 3.5Å; W20-N25 HydrophobicContact CH2-CB 4.36Å; W20-N25 HydrophobicContact CZ2-CB 4.35Å; W20-C27 HydrophobicContact CE3-CB 4.2Å; W20-C27 HydrophobicContact CZ3-CB 4.39Å; W20-N47 PolarHBondContact O-OD1 2.94Å
21	C	82.1	Confident	77.5	Confident	0 Å²	0	67.2 Å²	67.2	0%	0	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.4	106.4	172.1	-172.1	0	0	0	0	111.8	T23 A24 N25 L26 W38 C43	C21-T23 VanDerWaalsContact C-N 3.29Å; C21-T23 PolarHBondContact O-N 3.42Å; C21-A24 PolarHBondContact O-N 3.03Å; C21-N25 WeakPolarHBondContact O-CA 3.37Å; C21-N25 PolarHBondContact O-N 3.39Å; C21-L26 HydrophobicContact CB-CD1 3.96Å; C21-L26 HydrophobicContact CB-CG 4.15Å; C21-L26 PolarHBondContact N-O 3.31Å; C21-L26 PolarHBondContact O-N 2.91Å; C21-W38 HydrophobicContact CB-CE3 4.17Å; C21-W38 HydrophobicContact CB-CH2 4.02Å; C21-W38 HydrophobicContact CB-CZ3 3.71Å; C21-C43 HydrophobicContact CB-CB 3.48Å; C21-C43 VanDerWaalsContact CB-CB 3.48Å; C21-C43 WeakPolarHBondContact CB-SG 3.32Å; C21-C43 WeakPolarHBondContact SG-CB 3.28Å; C21-C43 CovalentContact SG-SG 2Å; C21-C43 PolarHBondContact SG-SG 2.89Å
22	S	81.2	Confident	76.7	Confident	37 Å²	37	67.7 Å²	67.7	26%	0.259	36%	0.361	S	S	.	.	T	Hydrogen-bonded Turn	trans	-66.9	-28.6	176.2	-63.8	0	0	0	0	113.5	W20 A24 K50	W20-S22 PolarHBondContact NE1-OG 3.5Å; S22-A24 VanDerWaalsContact C-N 3.34Å; S22-A24 PolarHBondContact O-N 3.5Å; S22-K50 WeakPolarHBondContact OG-CE 2.84Å; S22-K50 PolarHBondContact OG-NZ 3.37Å
23	T	77.9	Confident	76	Confident	74 Å²	74	72.5 Å²	72.5	45%	0.454	39%	0.389	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.6	-40.2	179.2	-44.5	0	0	0	0	111.8	C21 N41 N46	C21-T23 VanDerWaalsContact C-N 3.29Å; C21-T23 PolarHBondContact O-N 3.42Å; T23-N41 HydrophobicContact CG2-CB 4.12Å; T23-N41 PolarHBondContact OG1-O 3.15Å; T23-N46 PolarHBondContact OG1-ND2 3.4Å
24	A	74.4	Confident	75.4	Confident	29 Å²	29	69.5 Å²	69.5	24%	0.24	38%	0.38	C	S	.	.	T	Hydrogen-bonded Turn	trans	-111.6	1.4	-172.2	0	0	0	0	0	113.5	C21 S22 L26 N41	C21-A24 PolarHBondContact O-N 3.03Å; S22-A24 VanDerWaalsContact C-N 3.34Å; S22-A24 PolarHBondContact O-N 3.5Å; A24-L26 HydrophobicContact CB-CD2 3.36Å; A24-L26 HydrophobicContact CB-CG 3.69Å; A24-L26 PolarHBondContact O-N 2.94Å; A24-N41 HydrophobicContact CB-CB 3.77Å; A24-N41 WeakPolarHBondContact CB-ND2 3.32Å
25	N	80.3	Confident	75	Confident	118 Å²	118	64.1 Å²	64.1	63%	0.631	35%	0.345	S	S	*	.	T	Hydrogen-bonded Turn	trans	47	44.8	-174.7	-65.2	-67.1	0	0	0	112.5	W20 C21	W20-N25 HydrophobicContact CH2-CB 4.36Å; W20-N25 HydrophobicContact CZ2-CB 4.35Å; C21-N25 WeakPolarHBondContact O-CA 3.37Å; C21-N25 PolarHBondContact O-N 3.39Å
26	L	79.1	Confident	74.7	Confident	25 Å²	25	65.5 Å²	65.5	13%	0.131	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.2	149.6	-178.1	64.9	83.1	0	0	0	110.8	C21 A24 L34 A37 W38	C21-L26 HydrophobicContact CB-CD1 3.96Å; C21-L26 HydrophobicContact CB-CG 4.15Å; C21-L26 PolarHBondContact N-O 3.31Å; C21-L26 PolarHBondContact O-N 2.91Å; A24-L26 HydrophobicContact CB-CD2 3.36Å; A24-L26 HydrophobicContact CB-CG 3.69Å; A24-L26 PolarHBondContact O-N 2.94Å; L26-L34 HydrophobicContact CB-CD2 4.18Å; L26-L34 HydrophobicContact CD1-CD2 4.15Å; L26-L34 HydrophobicContact CD2-CD2 4.19Å; L26-L34 HydrophobicContact CG-CD2 4.41Å; L26-A37 HydrophobicContact CD2-CB 4.05Å; L26-W38 HydrophobicContact CD1-CE3 3.42Å; L26-W38 VanDerWaalsContact CD1-CE3 3.42Å; L26-W38 HydrophobicContact CD1-CZ3 3.75Å
27	C	79.8	Confident	74.5	Confident	30 Å²	30	62.1 Å²	62.1	20%	0.203	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.6	131.3	171.8	-176.1	0	0	0	0	108.3	V3 C8 H19 W20	V3-C27 HydrophobicContact CG1-CB 4.07Å; C8-C27 WeakPolarHBondContact CA-SG 3.33Å; C8-C27 HydrophobicContact CB-CB 3.53Å; C8-C27 WeakPolarHBondContact CB-SG 3.23Å; C8-C27 VanDerWaalsContact SG-CA 3.56Å; C8-C27 WeakPolarHBondContact SG-CB 3.27Å; C8-C27 CovalentContact SG-SG 2.02Å; C8-C27 PolarHBondContact SG-SG 3.32Å; H19-C27 WeakPolarHBondContact O-CA 3.15Å; W20-C27 HydrophobicContact CE3-CB 4.2Å; W20-C27 HydrophobicContact CZ3-CB 4.39Å
28	S	80.2	Confident	74.2	Confident	1 Å²	1	57 Å²	57	1%	0.007	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.9	152.7	170.8	-175.5	0	0	0	0	110.5	H19 G30 D32	H19-S28 PolarHBondContact N-O 3.48Å; H19-S28 PolarHBondContact O-N 3.09Å; S28-G30 PolarHBondContact O-N 3.05Å; S28-G30 PolarHBondContact OG-N 3.22Å; S28-D32 PolarHBondContact OG-OD2 3.41Å
29	N	75.3	Confident	73.8	Confident	23 Å²	23	61.3 Å²	61.3	12%	0.123	33%	0.328	C	S	.	.			trans	-84.4	6.7	173	64.5	18.8	0	0	0	113.5	E17 R31 D32	E17-N29 WeakPolarHBondContact O-CA 3.34Å; E17-N29 WeakPolarHBondContact O-CB 3.36Å; N29-R31 PolarHBondContact O-N 3.29Å; N29-R31 WeakPolarHBondContact OD1-CA 3.24Å; N29-R31 PolarHBondContact OD1-N 3.3Å; N29-D32 VanDerWaalsContact CG-OD1 3.29Å; N29-D32 PolarHBondContact N-OD2 3.04Å; N29-D32 VanDerWaalsContact N-OD2 3.08Å; N29-D32 VanDerWaalsContact ND2-CG 3.32Å; N29-D32 PolarHBondContact ND2-OD1 2.93Å; N29-D32 PolarHBondContact ND2-OD2 3.28Å; N29-D32 PolarHBondContact OD1-N 3.39Å; N29-D32 PolarHBondContact OD1-OD1 2.86Å; N29-D32 PolarHBondContact OD1-OD2 3.3Å
30	G	66.7	Low	73.5	Confident	27 Å²	27	65.1 Å²	65.1	28%	0.278	35%	0.349	S	S	.	.	S	Bend	trans	73	-12.8	-176.6	0	0	0	0	0	115.4	S28 S35	S28-G30 PolarHBondContact O-N 3.05Å; S28-G30 PolarHBondContact OG-N 3.22Å; G30-S35 PolarHBondContact O-OG 3.44Å; G30-S35 VanDerWaalsContact O-OG 3.1Å
31	R	64.1	Low	72.8	Confident	205 Å²	205	66.4 Å²	66.4	77%	0.774	36%	0.358	S	S	*	.	S	Bend	trans	-102.6	-12.5	175.7	-80.6	-173.8	-88.5	165.9	-4.6	113.8	N29	N29-R31 PolarHBondContact O-N 3.29Å; N29-R31 WeakPolarHBondContact OD1-CA 3.24Å; N29-R31 PolarHBondContact OD1-N 3.3Å
32	D	64.3	Low	72.2	Confident	66 Å²	66	71.3 Å²	71.3	35%	0.353	38%	0.384	S	S	.	.	S	Bend	trans	-69.8	166	178.7	-56.1	-49.8	0	0	0	112.6	S28 N29 L34 S35	S28-D32 PolarHBondContact OG-OD2 3.41Å; N29-D32 VanDerWaalsContact CG-OD1 3.29Å; N29-D32 PolarHBondContact N-OD2 3.04Å; N29-D32 VanDerWaalsContact N-OD2 3.08Å; N29-D32 VanDerWaalsContact ND2-CG 3.32Å; N29-D32 PolarHBondContact ND2-OD1 2.93Å; N29-D32 PolarHBondContact ND2-OD2 3.28Å; N29-D32 PolarHBondContact OD1-N 3.39Å; N29-D32 PolarHBondContact OD1-OD1 2.86Å; N29-D32 PolarHBondContact OD1-OD2 3.3Å; D32-L34 HydrophobicContact CB-CB 4.48Å; D32-L34 PolarHBondContact O-N 3.45Å; D32-S35 VanDerWaalsContact O-CB 3.23Å; D32-S35 WeakPolarHBondContact O-CB 3.41Å; D32-S35 PolarHBondContact O-N 3.49Å
33	T	66	Low	71.9	Confident	147 Å²	147	69.6 Å²	69.6	90%	0.902	37%	0.372	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.4	-20	170.4	-40	0	0	0	0	113.1	S35	T33-S35 VanDerWaalsContact C-N 3.28Å; T33-S35 PolarHBondContact O-N 2.81Å
34	L	65.7	Low	71.4	Confident	81 Å²	81	70.9 Å²	70.9	42%	0.424	38%	0.38	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79.2	-1.6	176.2	-128.4	69.8	0	0	0	114.5	L26 D32 K36 A37 W38	L26-L34 HydrophobicContact CB-CD2 4.18Å; L26-L34 HydrophobicContact CD1-CD2 4.15Å; L26-L34 HydrophobicContact CD2-CD2 4.19Å; L26-L34 HydrophobicContact CG-CD2 4.41Å; D32-L34 HydrophobicContact CB-CB 4.48Å; D32-L34 PolarHBondContact O-N 3.45Å; L34-K36 PolarHBondContact O-N 3.23Å; L34-K36 VanDerWaalsContact O-N 3.13Å; L34-A37 HydrophobicContact CG-CB 4.4Å; L34-A37 PolarHBondContact O-N 2.95Å; L34-W38 PolarHBondContact O-N 3.09Å
35	S	65.8	Low	70.6	Confident	36 Å²	36	77.2 Å²	77.2	25%	0.252	40%	0.402	S	S	.	.	H	α-helix	trans	-54.8	-32.3	179.4	-172.6	0	0	0	0	112.7	G30 D32 T33 W38 M39	G30-S35 PolarHBondContact O-OG 3.44Å; G30-S35 VanDerWaalsContact O-OG 3.1Å; D32-S35 VanDerWaalsContact O-CB 3.23Å; D32-S35 WeakPolarHBondContact O-CB 3.41Å; D32-S35 PolarHBondContact O-N 3.49Å; T33-S35 VanDerWaalsContact C-N 3.28Å; T33-S35 PolarHBondContact O-N 2.81Å; S35-W38 WeakPolarHBondContact O-CB 3.5Å; S35-W38 PolarHBondContact O-N 3.14Å; S35-M39 WeakPolarHBondContact O-CG 3.34Å; S35-M39 PolarHBondContact O-N 3.36Å
36	K	69.2	Low	69.3	Low	159 Å²	159	74.9 Å²	74.9	69%	0.691	39%	0.389	S	S	*	.	H	α-helix	trans	-61.2	-50.2	172.7	-71.2	-177.8	-179	178.1	0	112.4	L34 W38 M39 I40	L34-K36 PolarHBondContact O-N 3.23Å; L34-K36 VanDerWaalsContact O-N 3.13Å; K36-W38 VanDerWaalsContact C-N 3.28Å; K36-W38 PolarHBondContact O-N 3.47Å; K36-M39 PolarHBondContact O-N 3.01Å; K36-I40 WeakPolarHBondContact O-CB 3.23Å; K36-I40 WeakPolarHBondContact O-CD1 3.38Å; K36-I40 WeakPolarHBondContact O-CG1 3.4Å; K36-I40 PolarHBondContact O-N 2.93Å
37	A	67.8	Low	68.1	Low	31 Å²	31	77.1 Å²	77.1	26%	0.256	40%	0.402	S	S	.	.	H	α-helix	trans	-67.5	-33	178.5	0	0	0	0	0	111.5	L26 L34 N41	L26-A37 HydrophobicContact CD2-CB 4.05Å; L34-A37 HydrophobicContact CG-CB 4.4Å; L34-A37 PolarHBondContact O-N 2.95Å; A37-N41 WeakPolarHBondContact O-CB 3.08Å; A37-N41 PolarHBondContact O-N 3.04Å; A37-N41 VanDerWaalsContact O-N 3.14Å; A37-N41 PolarHBondContact O-ND2 3.44Å
38	W	73.1	Confident	66.6	Low	12 Å²	12	84.2 Å²	84.2	5%	0.045	43%	0.434	C	S	.	.	H	α-helix	trans	-60.2	-48.3	173.5	-170	-87.3	0	0	0	112	H19 C21 L26 L34 S35 K36 N42 C43 T44	H19-W38 HydrophobicContact CB-CH2 3.27Å; H19-W38 HydrophobicContact CB-CZ2 3.64Å; H19-W38 HydrophobicContact CB-CZ3 4.2Å; H19-W38 VanDerWaalsContact O-CH2 3.32Å; H19-W38 WeakPolarHBondContact O-CH2 3.37Å; H19-W38 VanDerWaalsContact O-CZ3 3.25Å; H19-W38 WeakPolarHBondContact O-CZ3 3.25Å; C21-W38 HydrophobicContact CB-CE3 4.17Å; C21-W38 HydrophobicContact CB-CH2 4.02Å; C21-W38 HydrophobicContact CB-CZ3 3.71Å; L26-W38 HydrophobicContact CD1-CE3 3.42Å; L26-W38 VanDerWaalsContact CD1-CE3 3.42Å; L26-W38 HydrophobicContact CD1-CZ3 3.75Å; L34-W38 PolarHBondContact O-N 3.09Å; S35-W38 WeakPolarHBondContact O-CB 3.5Å; S35-W38 PolarHBondContact O-N 3.14Å; K36-W38 VanDerWaalsContact C-N 3.28Å; K36-W38 PolarHBondContact O-N 3.47Å; W38-N42 PolarHBondContact O-N 3.39Å; W38-C43 HydrophobicContact CD2-CB 3.4Å; W38-C43 VanDerWaalsContact CD2-CB 3.4Å; W38-C43 HydrophobicContact CE3-CB 3.87Å; W38-C43 HydrophobicContact CG-CB 3.73Å; W38-C43 HydrophobicContact CH2-CB 4.06Å; W38-C43 HydrophobicContact CZ2-CB 3.68Å; W38-C43 HydrophobicContact CZ3-CB 4.18Å; W38-C43 VanDerWaalsContact O-CB 3.28Å; W38-C43 WeakPolarHBondContact O-CB 3.13Å; W38-C43 PolarHBondContact O-N 2.97Å; W38-C43 PolarHBondContact O-SG 3.49Å; W38-C43 VanDerWaalsContact O-SG 3.38Å; W38-T44 PolarHBondContact NE1-OG1 3.1Å
39	M	71.6	Confident	65.1	Low	110 Å²	110	92.2 Å²	92.2	54%	0.542	47%	0.471	S	S	.	.	H	α-helix	trans	-68	-45.3	178.2	-71.9	-172	-69.7	0	0	112.3	S35 K36 N41 N42	S35-M39 WeakPolarHBondContact O-CG 3.34Å; S35-M39 PolarHBondContact O-N 3.36Å; K36-M39 PolarHBondContact O-N 3.01Å; M39-N41 PolarHBondContact O-N 3.32Å; M39-N42 PolarHBondContact O-N 3.04Å; M39-N42 VanDerWaalsContact O-N 3.07Å
40	I	74.9	Confident	63.8	Low	131 Å²	131	98 Å²	98	67%	0.672	50%	0.496	S	S	*	.	H	α-helix	trans	-58.7	-38.1	-179.4	-69.9	164	0	0	0	111.2	K36 N42	K36-I40 WeakPolarHBondContact O-CB 3.23Å; K36-I40 WeakPolarHBondContact O-CD1 3.38Å; K36-I40 WeakPolarHBondContact O-CG1 3.4Å; K36-I40 PolarHBondContact O-N 2.93Å; I40-N42 VanDerWaalsContact C-N 3.29Å; I40-N42 PolarHBondContact O-N 2.82Å
41	N	68.8	Low	63.1	Low	53 Å²	53	104.4 Å²	104.4	28%	0.283	52%	0.523	S	S	.	.	T	Hydrogen-bonded Turn	trans	-90	13.6	-178.6	-68.5	-67.9	0	0	0	113.8	T23 A24 A37 M39 C43	T23-N41 HydrophobicContact CG2-CB 4.12Å; T23-N41 PolarHBondContact OG1-O 3.15Å; A24-N41 HydrophobicContact CB-CB 3.77Å; A24-N41 WeakPolarHBondContact CB-ND2 3.32Å; A37-N41 WeakPolarHBondContact O-CB 3.08Å; A37-N41 PolarHBondContact O-N 3.04Å; A37-N41 VanDerWaalsContact O-N 3.14Å; A37-N41 PolarHBondContact O-ND2 3.44Å; M39-N41 PolarHBondContact O-N 3.32Å; N41-C43 VanDerWaalsContact CB-SG 3.53Å; N41-C43 PolarHBondContact O-N 3.03Å; N41-C43 VanDerWaalsContact O-N 3.1Å
42	N	70.2	Confident	62.3	Low	103 Å²	103	104.8 Å²	104.8	55%	0.551	53%	0.53	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.5	30	-179.4	-74	-60	0	0	0	113.9	W38 M39 I40 T44 K45	W38-N42 PolarHBondContact O-N 3.39Å; M39-N42 PolarHBondContact O-N 3.04Å; M39-N42 VanDerWaalsContact O-N 3.07Å; I40-N42 VanDerWaalsContact C-N 3.29Å; I40-N42 PolarHBondContact O-N 2.82Å; N42-T44 PolarHBondContact O-N 3.13Å; N42-K45 PolarHBondContact O-N 2.81Å
43	C	75.1	Confident	61.2	Low	0 Å²	0	111.3 Å²	111.3	0%	0	56%	0.556	C	S	.	*	G	3₁₀ helix	trans	-66	-22.2	-174.8	-57.8	0	0	0	0	112.9	C21 W38 N41 K45 N46	C21-C43 HydrophobicContact CB-CB 3.48Å; C21-C43 VanDerWaalsContact CB-CB 3.48Å; C21-C43 WeakPolarHBondContact CB-SG 3.32Å; C21-C43 WeakPolarHBondContact SG-CB 3.28Å; C21-C43 CovalentContact SG-SG 2Å; C21-C43 PolarHBondContact SG-SG 2.89Å; W38-C43 HydrophobicContact CD2-CB 3.4Å; W38-C43 VanDerWaalsContact CD2-CB 3.4Å; W38-C43 HydrophobicContact CE3-CB 3.87Å; W38-C43 HydrophobicContact CG-CB 3.73Å; W38-C43 HydrophobicContact CH2-CB 4.06Å; W38-C43 HydrophobicContact CZ2-CB 3.68Å; W38-C43 HydrophobicContact CZ3-CB 4.18Å; W38-C43 VanDerWaalsContact O-CB 3.28Å; W38-C43 WeakPolarHBondContact O-CB 3.13Å; W38-C43 PolarHBondContact O-N 2.97Å; W38-C43 PolarHBondContact O-SG 3.49Å; W38-C43 VanDerWaalsContact O-SG 3.38Å; N41-C43 VanDerWaalsContact CB-SG 3.53Å; N41-C43 PolarHBondContact O-N 3.03Å; N41-C43 VanDerWaalsContact O-N 3.1Å; C43-K45 PolarHBondContact O-N 3.46Å; C43-N46 PolarHBondContact O-N 2.84Å
44	T	67	Low	60.2	Low	101 Å²	101	109.5 Å²	109.5	62%	0.62	55%	0.549	S	S	*	.	G	3₁₀ helix	trans	-61.9	-24.8	177.5	-41.1	0	0	0	0	113.3	W38 N42	W38-T44 PolarHBondContact NE1-OG1 3.1Å; N42-T44 PolarHBondContact O-N 3.13Å
45	K	57.6	Low	59.3	Low	163 Å²	163	113.9 Å²	113.9	71%	0.709	57%	0.573	S	S	*	*	G	3₁₀ helix	trans	-94.9	-17.5	-179.7	-69.2	-178.4	178.3	178.7	0	113.6	N42 C43	N42-K45 PolarHBondContact O-N 2.81Å; C43-K45 PolarHBondContact O-N 3.46Å
46	N	53.6	Low	58.4	Low	68 Å²	68	120.6 Å²	120.6	36%	0.364	60%	0.6	S	S	.	*	G	3₁₀ helix	trans	-93.6	0	-163.5	-73.5	2	0	0	0	114.8	T23 C43 M48	T23-N46 PolarHBondContact OG1-ND2 3.4Å; C43-N46 PolarHBondContact O-N 2.84Å; N46-M48 PolarHBondContact O-N 3.35Å
47	N	53.3	Low	57.2	Low	73 Å²	73	120.9 Å²	120.9	39%	0.39	60%	0.601	S	S	.	*	G	3₁₀ helix	trans	-74.5	-4	172.8	-76.5	-10.6	0	0	0	114.4	H19 W20	H19-N47 VanDerWaalsContact CB-ND2 3.26Å; H19-N47 WeakPolarHBondContact CB-ND2 3.41Å; H19-N47 PolarHBondContact ND1-ND2 2.86Å; W20-N47 PolarHBondContact O-OD1 2.94Å
48	M	49.2	Very low	56.3	Low	178 Å²	178	125.4 Å²	125.4	88%	0.877	62%	0.621	S	S	*	*	G	3₁₀ helix	trans	-107.5	2.3	-179	-70.9	-167.3	79.3	0	0	115	N46	N46-M48 PolarHBondContact O-N 3.35Å
49	Q	47.9	Very low	55	Low	170 Å²	170	134.6 Å²	134.6	79%	0.794	66%	0.661	S	S	*	*			trans	-135.8	74.1	-176	-75.8	-174.5	2.7	0	0	112.2
50	K	48	Very low	53.5	Low	145 Å²	145	139.3 Å²	139.3	63%	0.63	68%	0.679	S	S	*	*	S	Bend	trans	-145.9	35.9	163.2	-121.5	-175.3	-171.5	-175.3	0	115.9	S22	S22-K50 WeakPolarHBondContact OG-CE 2.84Å; S22-K50 PolarHBondContact OG-NZ 3.37Å
51	D	51.7	Low	52.1	Low	161 Å²	161	138.2 Å²	138.2	86%	0.861	68%	0.683	S	S	*	*	S	Bend	trans	-137.8	12.8	172	-70.8	-52.6	0	0	0	115.6
52	K	48	Very low	50.7	Low	212 Å²	212	144.4 Å²	144.4	92%	0.922	71%	0.71	S	S	*	*	S	Bend	trans	-138.8	38.8	-174.5	-68.4	-168.2	-179.5	179	0	116.7
53	K	41.6	Very low	49.3	Very low	204 Å²	204	146.4 Å²	146.4	89%	0.887	72%	0.716	S	S	*	*	S	Bend	trans	-156.6	74.7	170.5	-158	165.1	-175.7	173.9	0	114.4
54	S	43.5	Very low	47.8	Very low	108 Å²	108	153.8 Å²	153.8	76%	0.755	75%	0.752	S	S	*	*			trans	175.9	68.2	143.8	56.2	0	0	0	0	111.2
55	D	47.4	Very low	46.8	Very low	173 Å²	173	154.9 Å²	154.9	93%	0.925	75%	0.754	S	S	*	*			trans	-131.8	99.6	154.2	-79.9	-51.2	0	0	0	109
56	H	47.7	Very low	46	Very low	178 Å²	178	154.6 Å²	154.6	82%	0.824	76%	0.76	S	S	*	*			trans	-53.3	139.7	162.7	-123.7	-77.4	0	0	0	109
57	K	44.4	Very low	45.3	Very low	164 Å²	164	161.3 Å²	161.3	71%	0.713	79%	0.786	S	S	*	*			trans	88.6	101.4	135.4	-143.5	164.8	-163.6	179.3	0	118
58	D	48	Very low	44.9	Very low	126 Å²	126	163.3 Å²	163.3	67%	0.674	81%	0.806	S	S	*	*				77	124.2	129.6	-59.3	-19.6	0	0	0	121
59	K	46.6	Very low	44.8	Very low	206 Å²	206	161.5 Å²	161.5	90%	0.896	80%	0.8	S	S	*	*			trans	78.3	100.4	151.6	-66.3	170.6	179.5	179.3	0	117.9
60	K	40	Very low	44.6	Very low	209 Å²	209	162.5 Å²	162.5	91%	0.909	81%	0.805	S	S	*	*			trans	-125.9	105.7	145.9	-171.5	153.7	-177.7	172.1	0	109.9
61	S	44.2	Very low	44.4	Very low	108 Å²	108	164.1 Å²	164.1	76%	0.755	81%	0.812	S	S	*	*			trans	-74.7	166.4	164.1	62.8	0	0	0	0	110.5
62	E	40.1	Very low	44.2	Very low	182 Å²	182	162.7 Å²	162.7	85%	0.85	80%	0.804	S	S	*	*			trans	-71	162.8	-165.9	-63.7	157.2	159.6	0	0	115
63	H	41.3	Very low	44.1	Very low	145 Å²	145	163 Å²	163	67%	0.671	81%	0.805	S	S	*	*			trans	82.8	111.7	148	-132.1	-2.3	0	0	0	118.8
64	M	43.5	Very low	43.9	Very low	156 Å²	156	162.2 Å²	162.2	77%	0.768	80%	0.802	S	S	*	*				171.5	137.5	104.7	-86.9	-64.2	179.3	0	0	110.5
65	D	44.5	Very low	43.5	Very low	123 Å²	123	161.7 Å²	161.7	66%	0.658	80%	0.798	S	S	*	*			trans	-69.1	158.9	-176.6	-62.3	-76.8	0	0	0	114.3
66	N	42.5	Very low	43	Very low	158 Å²	158	161.9 Å²	161.9	85%	0.845	79%	0.793	S	S	*	*			trans	92.1	117.1	148.8	-67.9	-30.8	0	0	0	120.5
67	K	37.3	Very low	42.6	Very low	209 Å²	209	162.3 Å²	162.3	91%	0.909	80%	0.796	S	S	*	*			trans	95.7	83.9	142	-151.4	171	-171.2	174	0	116.2
68	S	46.1	Very low	42.4	Very low	115 Å²	115	161.6 Å²	161.6	80%	0.804	80%	0.797	S	S	*	*			trans	-158.7	139.7	142.9	-172.9	0	0	0	0	110.1
69	D	47.2	Very low	41.9	Very low	140 Å²	140	162.1 Å²	162.1	75%	0.749	80%	0.8	S	S	*	*			trans	-54	152.7	-173.5	-59.9	-84.5	0	0	0	115.9
70	Q	43.2	Very low	41.6	Very low	191 Å²	191	159.7 Å²	159.7	89%	0.893	80%	0.796	S	S	*	*			trans	52.9	120.4	156.4	-72	179.2	-9.3	0	0	117.1
71	K	43.9	Very low	41.3	Very low	179 Å²	179	159.4 Å²	159.4	78%	0.778	80%	0.795	S	S	*	*				159.7	115.8	108.9	-167.3	160.9	-172.1	173.5	0	110.9
72	D	48.4	Very low	41.2	Very low	130 Å²	130	158.7 Å²	158.7	70%	0.695	79%	0.79	S	S	*	*			trans	68.9	103.3	149.1	-54.2	-23.2	0	0	0	119.6	K74	D72-K74 PolarHBondContact O-N 3.43Å
73	K	44.9	Very low	41.3	Very low	218 Å²	218	156.9 Å²	156.9	95%	0.948	79%	0.786	S	S	*	*			trans	-48.7	118.1	162.8	-75.8	172.4	172	177.4	0	111.1
74	K	37.5	Very low	41.4	Very low	189 Å²	189	158.6 Å²	158.6	82%	0.822	79%	0.794	S	S	*	*			trans	-80.7	151.3	163.3	174.9	173.3	176.2	-176.5	0	109.9	D72	D72-K74 PolarHBondContact O-N 3.43Å
75	S	34.6	Very low	41.3	Very low	96 Å²	96	158.6 Å²	158.6	67%	0.671	79%	0.79	S	S	*	*			trans	75	105.1	165.6	-81.7	0	0	0	0	115.8
76	E	37.9	Very low	41.3	Very low	177 Å²	177	160.3 Å²	160.3	83%	0.827	80%	0.799	S	S	*	*				170	110.2	113.1	-88.8	167.5	-172.4	0	0	109.3
77	Q	38.3	Very low	41.5	Very low	188 Å²	188	159.6 Å²	159.6	88%	0.879	80%	0.796	S	S	*	*			trans	-157.1	95.2	152.4	-119.4	-176.7	-47	0	0	105.3
78	M	39.9	Very low	42.1	Very low	149 Å²	149	159 Å²	159	73%	0.734	79%	0.793	S	S	*	*				42.6	107	74.8	-75.5	-167	178.7	0	0	111.8
79	D	37.3	Very low	42.6	Very low	137 Å²	137	157.3 Å²	157.3	73%	0.733	78%	0.779	S	S	*	*				30.9	107.8	127.1	-52.6	-66.9	0	0	0	115.5
80	N	41.5	Very low	43.2	Very low	154 Å²	154	158.3 Å²	158.3	82%	0.824	78%	0.781	S	S	*	*			trans	-177.8	106.5	134.1	-89.3	-34.4	0	0	0	111.6
81	K	34.3	Very low	44.3	Very low	203 Å²	203	157.7 Å²	157.7	88%	0.883	78%	0.776	S	S	*	*			trans	-11.6	119.3	137.3	-174.9	174.9	-168	161.7	0	114.9
82	S	40.4	Very low	45.8	Very low	93 Å²	93	153.9 Å²	153.9	65%	0.65	76%	0.764	S	S	*	*			trans	169.6	130.8	134.5	37	0	0	0	0	111.5
83	D	43.7	Very low	47.4	Very low	144 Å²	144	155.1 Å²	155.1	77%	0.77	76%	0.76	S	S	*	*			trans	53.2	117.6	140.3	-56.2	-66.1	0	0	0	118.6
84	Q	42.7	Very low	49.2	Very low	181 Å²	181	149.1 Å²	149.1	85%	0.846	74%	0.738	S	S	*	*				-173.1	101.9	86.7	-176.3	171.2	7.1	0	0	108.7
85	K	42.3	Very low	51.5	Low	157 Å²	157	148.7 Å²	148.7	68%	0.683	73%	0.733	S	S	*	*				35.2	114.3	104.3	-93.1	173.8	176.6	162	0	113.1
86	D	44.1	Very low	54.1	Low	158 Å²	158	148.5 Å²	148.5	85%	0.845	73%	0.727	S	S	*	*				-139.4	70.2	92.1	-65	-45.1	0	0	0	114.4
87	N	47.2	Very low	56.6	Low	144 Å²	144	143.3 Å²	143.3	77%	0.77	71%	0.705	S	S	*	*			trans	-98.1	83.4	164.3	-12	-45.8	0	0	0	106.9
88	K	49.9	Very low	59.1	Low	196 Å²	196	138.5 Å²	138.5	85%	0.852	68%	0.684	S	S	*	*			trans	-62.8	137.8	172.2	-135.9	169.8	-168.7	-112.7	0	108.4	M90	K88-M90 PolarHBondContact O-N 3.27Å
89	P	55	Low	61.7	Low	79 Å²	79	134.6 Å²	134.6	51%	0.513	67%	0.67	S	S	.	*			trans	-76.5	94.3	-156.6	30.6	-34.9	0	0	0	111.7	F91 N92	P89-F91 PolarHBondContact O-N 3.07Å; P89-F91 VanDerWaalsContact O-N 3.15Å; P89-N92 HydrophobicContact CB-CB 4.33Å; P89-N92 HydrophobicContact CG-CB 4.23Å; P89-N92 PolarHBondContact O-N 2.92Å; P89-N92 VanDerWaalsContact O-N 3.14Å
90	M	60	Low	64.4	Low	161 Å²	161	131.2 Å²	131.2	79%	0.793	66%	0.657	S	S	*	*	H	α-helix	trans	-55.8	-27.4	167.5	-110.1	-164.3	172.7	0	0	111.7	K88 N92 Y93 L94	K88-M90 PolarHBondContact O-N 3.27Å; M90-N92 VanDerWaalsContact C-N 3.31Å; M90-N92 PolarHBondContact O-N 3.32Å; M90-Y93 PolarHBondContact O-N 2.92Å; M90-L94 WeakPolarHBondContact O-CB 3.37Å; M90-L94 PolarHBondContact O-N 3.04Å
91	F	67.3	Low	67	Low	178 Å²	178	127.5 Å²	127.5	78%	0.781	64%	0.64	S	S	*	*	H	α-helix	trans	-61.3	-34.7	177.5	-64.3	-70	0	0	0	113.6	P89 L94 Y95	P89-F91 PolarHBondContact O-N 3.07Å; P89-F91 VanDerWaalsContact O-N 3.15Å; F91-L94 PolarHBondContact O-N 3.38Å; F91-Y95 WeakPolarHBondContact O-CB 3.17Å; F91-Y95 PolarHBondContact O-N 3.37Å
92	N	75	Confident	70	Confident	100 Å²	100	122.4 Å²	122.4	54%	0.535	62%	0.621	S	S	.	*	H	α-helix	trans	-72.6	-39.3	179.8	-161.8	17.9	0	0	0	111.2	P89 M90 Y95 V96	P89-N92 HydrophobicContact CB-CB 4.33Å; P89-N92 HydrophobicContact CG-CB 4.23Å; P89-N92 PolarHBondContact O-N 2.92Å; P89-N92 VanDerWaalsContact O-N 3.14Å; M90-N92 VanDerWaalsContact C-N 3.31Å; M90-N92 PolarHBondContact O-N 3.32Å; N92-Y95 PolarHBondContact O-N 2.82Å; N92-V96 WeakPolarHBondContact O-CG2 3.47Å; N92-V96 PolarHBondContact O-N 3.08Å
93	Y	80.8	Confident	72.6	Confident	156 Å²	156	119.5 Å²	119.5	61%	0.612	61%	0.606	S	S	*	*	H	α-helix	trans	-64.2	-42.8	174.6	-177.3	-101.5	0	0	0	111.4	M90 Y95 V96 L97	M90-Y93 PolarHBondContact O-N 2.92Å; Y93-Y95 VanDerWaalsContact C-N 3.34Å; Y93-Y95 PolarHBondContact O-N 2.84Å; Y93-V96 PolarHBondContact O-N 3.03Å; Y93-L97 HydrophobicContact CD1-CD2 4.49Å; Y93-L97 HydrophobicContact CE1-CB 4.31Å; Y93-L97 HydrophobicContact CE1-CD2 3.73Å; Y93-L97 HydrophobicContact CE1-CG 4.42Å; Y93-L97 VanDerWaalsContact O-CB 3.23Å; Y93-L97 WeakPolarHBondContact O-CB 3.26Å; Y93-L97 PolarHBondContact O-N 3.31Å
94	L	83.9	Confident	75.1	Confident	92 Å²	92	117.9 Å²	117.9	48%	0.482	60%	0.596	S	S	.	*	H	α-helix	trans	-63	-41.4	177.8	-163.9	71.7	0	0	0	111.6	M90 F91 V96 L97 I98	M90-L94 WeakPolarHBondContact O-CB 3.37Å; M90-L94 PolarHBondContact O-N 3.04Å; F91-L94 PolarHBondContact O-N 3.38Å; L94-V96 VanDerWaalsContact C-N 3.32Å; L94-V96 PolarHBondContact O-N 3.15Å; L94-L97 PolarHBondContact O-N 2.96Å; L94-I98 HydrophobicContact CD1-CD1 4.01Å; L94-I98 HydrophobicContact CD1-CG1 4.32Å; L94-I98 HydrophobicContact CD2-CD1 4.23Å; L94-I98 HydrophobicContact CG-CD1 3.64Å; L94-I98 HydrophobicContact CG-CG1 4.28Å; L94-I98 WeakPolarHBondContact O-CB 3.36Å; L94-I98 VanDerWaalsContact O-CG1 3.24Å; L94-I98 WeakPolarHBondContact O-CG1 2.97Å; L94-I98 PolarHBondContact O-N 2.98Å
95	Y	86	Confident	77.7	Confident	180 Å²	180	113.2 Å²	113.2	71%	0.706	58%	0.58	S	S	*	*	H	α-helix	trans	-66.5	-28.7	176.1	-175.5	-98.3	0	0	0	113.5	F91 N92 Y93 P99	F91-Y95 WeakPolarHBondContact O-CB 3.17Å; F91-Y95 PolarHBondContact O-N 3.37Å; N92-Y95 PolarHBondContact O-N 2.82Å; Y93-Y95 VanDerWaalsContact C-N 3.34Å; Y93-Y95 PolarHBondContact O-N 2.84Å; Y95-P99 WeakPolarHBondContact O-CD 2.96Å; Y95-P99 WeakPolarHBondContact O-CG 3.4Å
96	V	88.7	Confident	80.3	Confident	91 Å²	91	111.2 Å²	111.2	55%	0.552	58%	0.576	S	S	*	*	H	α-helix	trans	-83.7	-40.7	175.2	173.8	0	0	0	0	111.5	N92 Y93 L94 S100	N92-V96 WeakPolarHBondContact O-CG2 3.47Å; N92-V96 PolarHBondContact O-N 3.08Å; Y93-V96 PolarHBondContact O-N 3.03Å; L94-V96 VanDerWaalsContact C-N 3.32Å; L94-V96 PolarHBondContact O-N 3.15Å; V96-S100 VanDerWaalsContact O-CB 3.32Å; V96-S100 WeakPolarHBondContact O-CB 3.12Å; V96-S100 PolarHBondContact O-N 3.11Å
97	L	90.2	Very high	82.8	Confident	69 Å²	69	107.5 Å²	107.5	36%	0.361	56%	0.559	S	S	.	*	H	α-helix	trans	-69.2	-43.7	-176.4	-172.2	72.5	0	0	0	111.9	Y93 L94 S100 V101	Y93-L97 HydrophobicContact CD1-CD2 4.49Å; Y93-L97 HydrophobicContact CE1-CB 4.31Å; Y93-L97 HydrophobicContact CE1-CD2 3.73Å; Y93-L97 HydrophobicContact CE1-CG 4.42Å; Y93-L97 VanDerWaalsContact O-CB 3.23Å; Y93-L97 WeakPolarHBondContact O-CB 3.26Å; Y93-L97 PolarHBondContact O-N 3.31Å; L94-L97 PolarHBondContact O-N 2.96Å; L97-S100 PolarHBondContact O-N 3.49Å; L97-V101 HydrophobicContact CD1-CG2 4.37Å; L97-V101 HydrophobicContact CG-CG2 4.31Å; L97-V101 WeakPolarHBondContact O-CG2 3Å; L97-V101 PolarHBondContact O-N 2.98Å
98	I	91.3	Very high	85.1	Confident	86 Å²	86	104.1 Å²	104.1	44%	0.441	55%	0.545	S	S	.	.	H	α-helix	trans	-60.7	-54.5	-175.9	-68.7	170.8	0	0	0	111.4	L94 S100 V101 I102	L94-I98 HydrophobicContact CD1-CD1 4.01Å; L94-I98 HydrophobicContact CD1-CG1 4.32Å; L94-I98 HydrophobicContact CD2-CD1 4.23Å; L94-I98 HydrophobicContact CG-CD1 3.64Å; L94-I98 HydrophobicContact CG-CG1 4.28Å; L94-I98 WeakPolarHBondContact O-CB 3.36Å; L94-I98 VanDerWaalsContact O-CG1 3.24Å; L94-I98 WeakPolarHBondContact O-CG1 2.97Å; L94-I98 PolarHBondContact O-N 2.98Å; I98-S100 VanDerWaalsContact C-N 3.31Å; I98-S100 PolarHBondContact O-N 2.87Å; I98-V101 PolarHBondContact O-N 3.36Å; I98-I102 HydrophobicContact CG2-CD1 3.65Å; I98-I102 VanDerWaalsContact O-CG1 3.27Å; I98-I102 WeakPolarHBondContact O-CG1 3.44Å; I98-I102 PolarHBondContact O-N 3.47Å
99	P	94.7	Very high	87.4	Confident	67 Å²	67	98.7 Å²	98.7	44%	0.435	53%	0.528	S	S	.	.	H	α-helix	trans	-63.1	-34.9	176.6	-22.8	35.5	0	0	0	113.1	Y95 I102 G103	Y95-P99 WeakPolarHBondContact O-CD 2.96Å; Y95-P99 WeakPolarHBondContact O-CG 3.4Å; P99-I102 PolarHBondContact O-N 3.38Å; P99-G103 PolarHBondContact O-N 3.02Å
100	S	94	Very high	89.3	Confident	66 Å²	66	96.9 Å²	96.9	46%	0.462	52%	0.524	S	S	.	.	H	α-helix	trans	-62.1	-44.1	176.7	-174	0	0	0	0	111.8	V96 L97 I98 L104	V96-S100 VanDerWaalsContact O-CB 3.32Å; V96-S100 WeakPolarHBondContact O-CB 3.12Å; V96-S100 PolarHBondContact O-N 3.11Å; L97-S100 PolarHBondContact O-N 3.49Å; I98-S100 VanDerWaalsContact C-N 3.31Å; I98-S100 PolarHBondContact O-N 2.87Å; S100-L104 WeakPolarHBondContact O-CG 3.35Å; S100-L104 PolarHBondContact O-N 3.14Å; S100-L104 VanDerWaalsContact O-N 3.09Å
101	V	96.1	Very high	91	Very high	77 Å²	77	96.2 Å²	96.2	47%	0.467	52%	0.517	S	S	.	.	H	α-helix	trans	-68	-43.3	178	174	0	0	0	0	110.7	L97 I98 G103 L104 V105	L97-V101 HydrophobicContact CD1-CG2 4.37Å; L97-V101 HydrophobicContact CG-CG2 4.31Å; L97-V101 WeakPolarHBondContact O-CG2 3Å; L97-V101 PolarHBondContact O-N 2.98Å; I98-V101 PolarHBondContact O-N 3.36Å; V101-G103 VanDerWaalsContact C-N 3.34Å; V101-G103 PolarHBondContact O-N 3.46Å; V101-L104 PolarHBondContact O-N 3.12Å; V101-V105 WeakPolarHBondContact O-CG2 3.47Å; V101-V105 PolarHBondContact O-N 3.2Å
102	I	96	Very high	92.4	Very high	95 Å²	95	92.3 Å²	92.3	49%	0.487	50%	0.503	S	S	.	.	H	α-helix	trans	-60	-45.6	177.1	-66.3	165.9	0	0	0	110.7	I98 P99 L104 V105 I106	I98-I102 HydrophobicContact CG2-CD1 3.65Å; I98-I102 VanDerWaalsContact O-CG1 3.27Å; I98-I102 WeakPolarHBondContact O-CG1 3.44Å; I98-I102 PolarHBondContact O-N 3.47Å; P99-I102 PolarHBondContact O-N 3.38Å; I102-L104 PolarHBondContact O-N 3Å; I102-V105 PolarHBondContact O-N 2Å; I102-I106 HydrophobicContact CG2-CD1 3.93Å; I102-I106 WeakPolarHBondContact O-CG1 3.45Å; I102-I106 PolarHBondContact O-N 3.1Å; I102-I106 VanDerWaalsContact O-N 3.09Å
103	G	95.7	Very high	93.4	Very high	32 Å²	32	91.4 Å²	91.4	33%	0.33	50%	0.501	S	S	.	.	H	α-helix	trans	-60	-45.1	177.4	0	0	0	0	0	112.7	P99 V101 V105 I106 V107	P99-G103 PolarHBondContact O-N 3.02Å; V101-G103 VanDerWaalsContact C-N 3.34Å; V101-G103 PolarHBondContact O-N 3.46Å; G103-V105 VanDerWaalsContact C-N 3.35Å; G103-V105 PolarHBondContact O-N 3.25Å; G103-I106 PolarHBondContact O-N 2.83Å; G103-V107 WeakPolarHBondContact O-CG2 3.14Å; G103-V107 PolarHBondContact O-N 3.43Å
104	L	96.2	Very high	94.1	Very high	110 Å²	110	92.5 Å²	92.5	58%	0.576	51%	0.505	S	S	*	.	H	α-helix	trans	-61	-41.6	176.5	-73.5	172.9	0	0	0	112.3	S100 V101 I102 V107 C108	S100-L104 WeakPolarHBondContact O-CG 3.35Å; S100-L104 PolarHBondContact O-N 3.14Å; S100-L104 VanDerWaalsContact O-N 3.09Å; V101-L104 PolarHBondContact O-N 3.12Å; I102-L104 PolarHBondContact O-N 3Å; L104-V107 PolarHBondContact O-N 3.32Å; L104-C108 WeakPolarHBondContact O-CB 3.37Å; L104-C108 PolarHBondContact O-N 3.04Å; L104-C108 PolarHBondContact O-SG 2.87Å
105	V	96.7	Very high	94.7	Very high	84 Å²	84	94.6 Å²	94.6	51%	0.509	51%	0.51	S	S	.	.	H	α-helix	trans	-63.1	-44.3	177.8	173.4	0	0	0	0	111.2	V101 I102 G103 V107 C108 V109	V101-V105 WeakPolarHBondContact O-CG2 3.47Å; V101-V105 PolarHBondContact O-N 3.2Å; I102-V105 PolarHBondContact O-N 2Å; G103-V105 VanDerWaalsContact C-N 3.35Å; G103-V105 PolarHBondContact O-N 3.25Å; V105-V107 PolarHBondContact O-N 3.5Å; V105-C108 PolarHBondContact O-N 3.36Å; V105-V109 HydrophobicContact CG1-CG2 4.39Å; V105-V109 VanDerWaalsContact O-CG2 3.32Å; V105-V109 WeakPolarHBondContact O-CG2 2.95Å; V105-V109 PolarHBondContact O-N 3.22Å
106	I	97	Very high	95.1	Very high	115 Å²	115	94.2 Å²	94.2	59%	0.59	51%	0.507	S	S	*	.	H	α-helix	trans	-62.4	-45.3	178.6	-65.9	167.1	0	0	0	110.8	I102 G103 V109 G110	I102-I106 HydrophobicContact CG2-CD1 3.93Å; I102-I106 WeakPolarHBondContact O-CG1 3.45Å; I102-I106 PolarHBondContact O-N 3.1Å; I102-I106 VanDerWaalsContact O-N 3.09Å; G103-I106 PolarHBondContact O-N 2.83Å; I106-V109 PolarHBondContact O-N 3.26Å; I106-G110 PolarHBondContact O-N 3.43Å
107	V	97	Very high	95.3	Very high	80 Å²	80	94.8 Å²	94.8	49%	0.485	51%	0.507	S	S	.	.	H	α-helix	trans	-60.6	-48.2	176.8	172.9	0	0	0	0	110.3	G103 L104 V105 V109 G110 F111	G103-V107 WeakPolarHBondContact O-CG2 3.14Å; G103-V107 PolarHBondContact O-N 3.43Å; L104-V107 PolarHBondContact O-N 3.32Å; V105-V107 PolarHBondContact O-N 3.5Å; V107-V109 PolarHBondContact O-N 3.19Å; V107-G110 PolarHBondContact O-N 3.45Å; V107-F111 HydrophobicContact CG1-CD2 3.61Å; V107-F111 HydrophobicContact CG1-CE2 3.72Å; V107-F111 WeakPolarHBondContact O-CD2 3.37Å; V107-F111 PolarHBondContact O-N 2.02Å
108	C	96.4	Very high	95.4	Very high	72 Å²	72	94.3 Å²	94.3	49%	0.486	51%	0.509	S	S	.	.	H	α-helix	trans	-58.2	-46.7	177.6	-73.4	0	0	0	0	112.4	L104 V105 G110 F111 I112	L104-C108 WeakPolarHBondContact O-CB 3.37Å; L104-C108 PolarHBondContact O-N 3.04Å; L104-C108 PolarHBondContact O-SG 2.87Å; V105-C108 PolarHBondContact O-N 3.36Å; C108-G110 PolarHBondContact O-N 2.91Å; C108-F111 PolarHBondContact O-N 3.43Å; C108-I112 WeakPolarHBondContact O-CB 3.44Å; C108-I112 WeakPolarHBondContact O-CD1 2.95Å; C108-I112 WeakPolarHBondContact O-CG1 3.13Å; C108-I112 PolarHBondContact O-N 3.38Å
109	V	96.7	Very high	95.4	Very high	82 Å²	82	98 Å²	98	50%	0.497	52%	0.522	S	S	.	.	H	α-helix	trans	-62.7	-43.5	177.5	173.2	0	0	0	0	110.9	V105 I106 V107 I112 V113	V105-V109 HydrophobicContact CG1-CG2 4.39Å; V105-V109 VanDerWaalsContact O-CG2 3.32Å; V105-V109 WeakPolarHBondContact O-CG2 2.95Å; V105-V109 PolarHBondContact O-N 3.22Å; I106-V109 PolarHBondContact O-N 3.26Å; V107-V109 PolarHBondContact O-N 3.19Å; V109-I112 PolarHBondContact O-N 3.5Å; V109-V113 HydrophobicContact CG1-CG2 4.47Å; V109-V113 WeakPolarHBondContact O-CG2 3.47Å; V109-V113 PolarHBondContact O-N 3.33Å
110	G	96	Very high	95.1	Very high	41 Å²	41	105.2 Å²	105.2	42%	0.423	54%	0.541	S	S	.	.	H	α-helix	trans	-60.3	-45.4	176	0	0	0	0	0	112.9	I106 V107 C108 V113 W114	I106-G110 PolarHBondContact O-N 3.43Å; V107-G110 PolarHBondContact O-N 3.45Å; C108-G110 PolarHBondContact O-N 2.91Å; G110-V113 PolarHBondContact O-N 3.39Å; G110-W114 VanDerWaalsContact O-CB 3.27Å; G110-W114 WeakPolarHBondContact O-CB 3.45Å; G110-W114 PolarHBondContact O-N 3.32Å
111	F	96.3	Very high	94.3	Very high	148 Å²	148	113.2 Å²	113.2	65%	0.649	57%	0.571	S	S	*	*	H	α-helix	trans	-62.3	-42.3	175.4	-96	-86.7	0	0	0	112.4	V107 C108 W114 F115	V107-F111 HydrophobicContact CG1-CD2 3.61Å; V107-F111 HydrophobicContact CG1-CE2 3.72Å; V107-F111 WeakPolarHBondContact O-CD2 3.37Å; V107-F111 PolarHBondContact O-N 2.02Å; C108-F111 PolarHBondContact O-N 3.43Å; F111-W114 PolarHBondContact O-N 3.46Å; F111-F115 WeakPolarHBondContact O-CB 3.29Å; F111-F115 PolarHBondContact O-N 3.14Å
112	I	96.3	Very high	94.2	Very high	95 Å²	95	115 Å²	115	49%	0.487	58%	0.576	S	S	.	*	H	α-helix	trans	-60	-54.8	176.1	-69.9	164.4	0	0	0	109	C108 V109 W114 F115 W116	C108-I112 WeakPolarHBondContact O-CB 3.44Å; C108-I112 WeakPolarHBondContact O-CD1 2.95Å; C108-I112 WeakPolarHBondContact O-CG1 3.13Å; C108-I112 PolarHBondContact O-N 3.38Å; V109-I112 PolarHBondContact O-N 3.5Å; I112-W114 VanDerWaalsContact C-N 3.34Å; I112-W114 PolarHBondContact O-N 3.31Å; I112-F115 PolarHBondContact O-N 2.76Å; I112-F115 VanDerWaalsContact O-N 3.16Å; I112-W116 VanDerWaalsContact CG2-CD1 3.49Å; I112-W116 PolarHBondContact O-N 3.16Å
113	V	96	Very high	94.1	Very high	81 Å²	81	116.1 Å²	116.1	49%	0.491	58%	0.581	S	S	.	*	H	α-helix	trans	-58	-45.5	-180	174	0	0	0	0	111.5	V109 G110 F115 W116 L117	V109-V113 HydrophobicContact CG1-CG2 4.47Å; V109-V113 WeakPolarHBondContact O-CG2 3.47Å; V109-V113 PolarHBondContact O-N 3.33Å; G110-V113 PolarHBondContact O-N 3.39Å; V113-F115 PolarHBondContact O-N 3.09Å; V113-W116 PolarHBondContact O-N 3.05Å; V113-L117 HydrophobicContact CG1-CD1 4.09Å; V113-L117 HydrophobicContact CG1-CG 4.47Å; V113-L117 WeakPolarHBondContact O-CG 3.35Å; V113-L117 PolarHBondContact O-N 2.98Å
114	W	95.1	Very high	94	Very high	180 Å²	180	120.7 Å²	120.7	68%	0.682	59%	0.594	S	S	*	*	H	α-helix	trans	-58.8	-45.3	176.5	177.5	-89.9	0	0	0	112.3	G110 F111 I112 L117 S118	G110-W114 VanDerWaalsContact O-CB 3.27Å; G110-W114 WeakPolarHBondContact O-CB 3.45Å; G110-W114 PolarHBondContact O-N 3.32Å; F111-W114 PolarHBondContact O-N 3.46Å; I112-W114 VanDerWaalsContact C-N 3.34Å; I112-W114 PolarHBondContact O-N 3.31Å; W114-L117 PolarHBondContact O-N 3.32Å; W114-S118 PolarHBondContact NE1-OG 3.24Å; W114-S118 WeakPolarHBondContact O-CB 3.38Å; W114-S118 PolarHBondContact O-N 3.09Å; W114-S118 PolarHBondContact O-OG 3.32Å
115	F	95.5	Very high	93.8	Very high	135 Å²	135	121.4 Å²	121.4	59%	0.592	60%	0.596	S	S	*	*	H	α-helix	trans	-63.7	-41.6	178.2	-176.9	-99.8	0	0	0	111.7	F111 I112 V113 S118 K119	F111-F115 WeakPolarHBondContact O-CB 3.29Å; F111-F115 PolarHBondContact O-N 3.14Å; I112-F115 PolarHBondContact O-N 2.76Å; I112-F115 VanDerWaalsContact O-N 3.16Å; V113-F115 PolarHBondContact O-N 3.09Å; F115-S118 PolarHBondContact O-N 3.01Å; F115-K119 WeakPolarHBondContact O-CB 3.2Å; F115-K119 PolarHBondContact O-N 3.01Å
116	W	94.7	Very high	93.7	Very high	172 Å²	172	123.7 Å²	123.7	65%	0.652	60%	0.601	S	S	*	*	H	α-helix	trans	-63.9	-38.6	174.9	-81.6	99.7	0	0	0	112.6	I112 V113 R120	I112-W116 VanDerWaalsContact CG2-CD1 3.49Å; I112-W116 PolarHBondContact O-N 3.16Å; V113-W116 PolarHBondContact O-N 3.05Å; W116-R120 PolarHBondContact O-N 2.8Å
117	L	93.9	Very high	93.4	Very high	104 Å²	104	124.3 Å²	124.3	55%	0.545	60%	0.602	S	S	.	*	H	α-helix	trans	-71.2	-43.5	176.3	-70.2	175.9	0	0	0	112	V113 W114 K119 R120 Q121	V113-L117 HydrophobicContact CG1-CD1 4.09Å; V113-L117 HydrophobicContact CG1-CG 4.47Å; V113-L117 WeakPolarHBondContact O-CG 3.35Å; V113-L117 PolarHBondContact O-N 2.98Å; W114-L117 PolarHBondContact O-N 3.32Å; L117-K119 PolarHBondContact O-N 3.37Å; L117-R120 PolarHBondContact O-N 2.81Å; L117-Q121 PolarHBondContact O-N 2.69Å
118	S	92.1	Very high	93.2	Very high	59 Å²	59	127.4 Å²	127.4	41%	0.413	61%	0.61	S	S	.	*	H	α-helix	trans	-64.7	-28	178.7	-58.3	0	0	0	0	112.5	W114 F115	W114-S118 PolarHBondContact NE1-OG 3.24Å; W114-S118 WeakPolarHBondContact O-CB 3.38Å; W114-S118 PolarHBondContact O-N 3.09Å; W114-S118 PolarHBondContact O-OG 3.32Å; F115-S118 PolarHBondContact O-N 3.01Å
119	K	91.8	Very high	92.9	Very high	163 Å²	163	131.7 Å²	131.7	71%	0.709	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.9	-17.4	175.1	-167.5	172.8	-179.3	176.1	0	113	F115 L117	F115-K119 WeakPolarHBondContact O-CB 3.2Å; F115-K119 PolarHBondContact O-N 3.01Å; L117-K119 PolarHBondContact O-N 3.37Å
120	R	88.1	Confident	92.6	Very high	218 Å²	218	135.8 Å²	135.8	82%	0.823	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.9	-25.2	176.9	-87.7	-163.7	-172.9	-177.5	4.1	113.4	W116 L117	W116-R120 PolarHBondContact O-N 2.8Å; L117-R120 PolarHBondContact O-N 2.81Å
121	Q	76	Confident	92.3	Very high	234 Å²	234	144.5 Å²	144.5	100%	1.093	65%	0.649	S	S	*	*			trans	-82.9	0	168.1	-74	-156	-14.9	0	0	110.7	L117	L117-Q121 PolarHBondContact O-N 2.69Å

Retrieved 121 of 121 residues in 33.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).