A0A5K4F8T4_SCHMA Loading...

Secreted protein

AlphaFold DB , UniProt , Accession A0A5K4F8T4, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 102 aa.

						>A0A5K4F8T4_SCHMA|A0A5K4F8T4
MNGIILTGSLFLSLCNVVMMQIVVEKVPLIDHKPNETSLEFGGIIFSLLQNSTVKIQYGRCSTMMDLSPVTPTENATRTGTRAVYDNCSEKKSRSRRRKDAE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.3	Low	58.1	Low	215 Å²	215	115.2 Å²	115.2	100%	1.059	65%	0.646	S	S	*	*				0	33.3	0	-62.9	173.3	-170	0	0	112.2
2	N	53.2	Low	58.9	Low	133 Å²	133	115.3 Å²	115.3	71%	0.711	64%	0.644	S	S	*	*			trans	-104	-10.5	-173.5	-69.7	-1	0	0	0	114.2
3	G	51.9	Low	59.7	Low	53 Å²	53	111.7 Å²	111.7	55%	0.546	63%	0.631	S	S	.	*	H	α-helix	trans	-78.7	-26.5	-176	0	0	0	0	0	115
4	I	56.9	Low	60.3	Low	139 Å²	139	111.6 Å²	111.6	71%	0.713	63%	0.627	S	S	*	*	H	α-helix	trans	-79.4	-28.6	-174.2	-55.6	173.3	0	0	0	111.6	T7 G8	I4-T7 PolarHBondContact O-OG1 3.3Å; I4-T7 VanDerWaalsContact O-OG1 3.04Å; I4-G8 PolarHBondContact O-N 3.4Å
5	I	56.2	Low	60.6	Low	132 Å²	132	107.5 Å²	107.5	68%	0.677	61%	0.607	S	S	*	*	H	α-helix	trans	-72.3	-35.9	-178.2	-56.2	173.4	0	0	0	110.6	S9	I5-S9 PolarHBondContact O-N 3.31Å
6	L	56.3	Low	60.8	Low	124 Å²	124	107.7 Å²	107.7	65%	0.649	61%	0.607	S	S	*	*	H	α-helix	trans	-68.4	-38.1	178.7	-81.2	152	0	0	0	112.6	L10	L6-L10 WeakPolarHBondContact O-CG 3.49Å; L6-L10 PolarHBondContact O-N 3.04Å
7	T	59.7	Low	61	Low	90 Å²	90	106.2 Å²	106.2	55%	0.552	60%	0.601	S	S	*	*	H	α-helix	trans	-72	-35.8	178.1	50.4	0	0	0	0	112.5	I4 L10 F11	I4-T7 PolarHBondContact O-OG1 3.3Å; I4-T7 VanDerWaalsContact O-OG1 3.04Å; T7-L10 PolarHBondContact O-N 3.49Å; T7-F11 PolarHBondContact O-N 3.06Å; T7-F11 VanDerWaalsContact O-N 3.13Å
8	G	57.6	Low	61.1	Low	35 Å²	35	104.1 Å²	104.1	36%	0.361	59%	0.59	S	S	.	*	H	α-helix	trans	-63.6	-41.9	176.4	0	0	0	0	0	113.4	I4 L10 F11 L12	I4-G8 PolarHBondContact O-N 3.4Å; G8-L10 PolarHBondContact O-N 3.44Å; G8-F11 PolarHBondContact O-N 3.07Å; G8-L12 PolarHBondContact O-N 3.32Å; G8-L12 VanDerWaalsContact O-N 3.07Å
9	S	64.5	Low	61	Low	84 Å²	84	104.8 Å²	104.8	59%	0.587	59%	0.59	S	S	*	*	H	α-helix	trans	-66	-37.9	178.3	-169.5	0	0	0	0	112.6	I5 S13	I5-S9 PolarHBondContact O-N 3.31Å; S9-S13 PolarHBondContact O-N 3.13Å
10	L	64.8	Low	60.8	Low	124 Å²	124	106.7 Å²	106.7	65%	0.649	60%	0.595	S	S	*	*	H	α-helix	trans	-66.2	-39.8	176.2	-72.6	169.1	0	0	0	111.4	L6 T7 G8 S13 L14	L6-L10 WeakPolarHBondContact O-CG 3.49Å; L6-L10 PolarHBondContact O-N 3.04Å; T7-L10 PolarHBondContact O-N 3.49Å; G8-L10 PolarHBondContact O-N 3.44Å; L10-S13 PolarHBondContact O-N 3.06Å; L10-L14 WeakPolarHBondContact O-CB 3.44Å; L10-L14 PolarHBondContact O-N 3.48Å
11	F	66.9	Low	60.5	Low	138 Å²	138	107.1 Å²	107.1	61%	0.605	59%	0.593	S	S	*	*	H	α-helix	trans	-65.5	-43.9	178.3	-164.1	-97.3	0	0	0	112	T7 G8 S13 L14 C15	T7-F11 PolarHBondContact O-N 3.06Å; T7-F11 VanDerWaalsContact O-N 3.13Å; G8-F11 PolarHBondContact O-N 3.07Å; F11-S13 PolarHBondContact O-N 2.94Å; F11-L14 PolarHBondContact O-N 2.97Å; F11-C15 VanDerWaalsContact CE1-SG 3.55Å; F11-C15 PolarHBondContact O-N 3.45Å; F11-C15 PolarHBondContact O-SG 3.43Å; F11-C15 VanDerWaalsContact O-SG 3.34Å
12	L	67.4	Low	60.7	Low	117 Å²	117	100.9 Å²	100.9	61%	0.613	56%	0.562	S	S	*	*	H	α-helix	trans	-64	-39.7	176.1	-71.8	171.1	0	0	0	112.4	G8 C15 N16	G8-L12 PolarHBondContact O-N 3.32Å; G8-L12 VanDerWaalsContact O-N 3.07Å; L12-C15 PolarHBondContact O-N 3.37Å; L12-N16 PolarHBondContact O-N 3.34Å
13	S	69.1	Low	60.8	Low	68 Å²	68	99.3 Å²	99.3	48%	0.476	56%	0.558	S	S	.	*	H	α-helix	trans	-63.2	-42.5	174.3	-171	0	0	0	0	111.6	S9 L10 F11 N16 V17	S9-S13 PolarHBondContact O-N 3.13Å; L10-S13 PolarHBondContact O-N 3.06Å; F11-S13 PolarHBondContact O-N 2.94Å; S13-N16 PolarHBondContact O-N 3.25Å; S13-V17 WeakPolarHBondContact O-CG2 3.35Å; S13-V17 PolarHBondContact O-N 3.4Å
14	L	68.2	Low	60.9	Low	110 Å²	110	101.8 Å²	101.8	58%	0.576	56%	0.562	S	S	*	*	H	α-helix	trans	-65.2	-43.4	177.8	-164	74	0	0	0	111.1	L10 F11 N16 V17 V18	L10-L14 WeakPolarHBondContact O-CB 3.44Å; L10-L14 PolarHBondContact O-N 3.48Å; F11-L14 PolarHBondContact O-N 2.97Å; L14-N16 PolarHBondContact O-N 2.88Å; L14-V17 PolarHBondContact O-N 3.37Å; L14-V18 WeakPolarHBondContact O-CB 3.15Å; L14-V18 VanDerWaalsContact O-CG2 3.24Å; L14-V18 WeakPolarHBondContact O-CG2 3.44Å; L14-V18 PolarHBondContact O-N 3.47Å
15	C	64.9	Low	60.7	Low	50 Å²	50	102.6 Å²	102.6	34%	0.338	56%	0.562	S	S	.	*	H	α-helix	trans	-60.1	-42.8	174.9	-71.8	0	0	0	0	112.1	F11 L12 V18 M19	F11-C15 VanDerWaalsContact CE1-SG 3.55Å; F11-C15 PolarHBondContact O-N 3.45Å; F11-C15 PolarHBondContact O-SG 3.43Å; F11-C15 VanDerWaalsContact O-SG 3.34Å; L12-C15 PolarHBondContact O-N 3.37Å; C15-V18 PolarHBondContact O-N 2.83Å; C15-M19 VanDerWaalsContact O-CB 3.31Å; C15-M19 WeakPolarHBondContact O-CB 3.27Å; C15-M19 WeakPolarHBondContact O-CG 3.42Å; C15-M19 PolarHBondContact O-N 3.4Å
16	N	64.7	Low	60.5	Low	111 Å²	111	103.1 Å²	103.1	59%	0.594	56%	0.56	S	S	*	*	H	α-helix	trans	-63.4	-42.9	177.3	-83.2	-17.1	0	0	0	112.2	L12 S13 L14 M19 M20	L12-N16 PolarHBondContact O-N 3.34Å; S13-N16 PolarHBondContact O-N 3.25Å; L14-N16 PolarHBondContact O-N 2.88Å; N16-M19 PolarHBondContact O-N 2.89Å; N16-M20 WeakPolarHBondContact O-CB 3.25Å; N16-M20 VanDerWaalsContact O-CG 3.27Å; N16-M20 WeakPolarHBondContact O-CG 3.48Å; N16-M20 PolarHBondContact O-N 2.88Å
17	V	63.5	Low	60.4	Low	83 Å²	83	102 Å²	102	50%	0.503	56%	0.558	S	S	.	*	H	α-helix	trans	-64.8	-44.8	177	174.9	0	0	0	0	110.7	S13 L14 M20 Q21	S13-V17 WeakPolarHBondContact O-CG2 3.35Å; S13-V17 PolarHBondContact O-N 3.4Å; L14-V17 PolarHBondContact O-N 3.37Å; V17-M20 PolarHBondContact O-N 3.31Å; V17-Q21 WeakPolarHBondContact O-CB 3.34Å; V17-Q21 PolarHBondContact O-N 2.92Å
18	V	63.5	Low	60.2	Low	67 Å²	67	100 Å²	100	41%	0.406	55%	0.547	S	S	.	.	H	α-helix	trans	-63.4	-43.5	177.8	171.8	0	0	0	0	111.2	L14 C15 Q21 I22	L14-V18 WeakPolarHBondContact O-CB 3.15Å; L14-V18 VanDerWaalsContact O-CG2 3.24Å; L14-V18 WeakPolarHBondContact O-CG2 3.44Å; L14-V18 PolarHBondContact O-N 3.47Å; C15-V18 PolarHBondContact O-N 2.83Å; V18-Q21 PolarHBondContact O-N 2.89Å; V18-I22 HydrophobicContact CG1-CD1 3.69Å; V18-I22 HydrophobicContact CG1-CG1 4.36Å; V18-I22 WeakPolarHBondContact O-CD1 3.24Å; V18-I22 WeakPolarHBondContact O-CG1 3.31Å; V18-I22 PolarHBondContact O-N 3.27Å
19	M	58.5	Low	60.5	Low	119 Å²	119	104.6 Å²	104.6	59%	0.586	56%	0.562	S	S	*	*	H	α-helix	trans	-65.1	-42.2	177.7	-71	-68.1	-74.7	0	0	111.7	C15 N16 Q21 I22 V23	C15-M19 VanDerWaalsContact O-CB 3.31Å; C15-M19 WeakPolarHBondContact O-CB 3.27Å; C15-M19 WeakPolarHBondContact O-CG 3.42Å; C15-M19 PolarHBondContact O-N 3.4Å; N16-M19 PolarHBondContact O-N 2.89Å; M19-Q21 VanDerWaalsContact C-N 3.33Å; M19-Q21 PolarHBondContact O-N 3.4Å; M19-I22 PolarHBondContact O-N 3.49Å; M19-V23 VanDerWaalsContact O-CG2 3.26Å; M19-V23 WeakPolarHBondContact O-CG2 3.2Å; M19-V23 PolarHBondContact O-N 3.23Å
20	M	56.7	Low	60.2	Low	142 Å²	142	104.9 Å²	104.9	70%	0.7	56%	0.556	S	S	*	*	H	α-helix	trans	-62.5	-41.4	173.8	-72.8	-128	170.8	0	0	111.6	N16 V17 V23 V24	N16-M20 WeakPolarHBondContact O-CB 3.25Å; N16-M20 VanDerWaalsContact O-CG 3.27Å; N16-M20 WeakPolarHBondContact O-CG 3.48Å; N16-M20 PolarHBondContact O-N 2.88Å; V17-M20 PolarHBondContact O-N 3.31Å; M20-V23 PolarHBondContact O-N 2.96Å; M20-V24 VanDerWaalsContact O-CG2 3.25Å; M20-V24 WeakPolarHBondContact O-CG2 3.26Å; M20-V24 PolarHBondContact O-N 3.29Å
21	Q	55.2	Low	60	Low	116 Å²	116	102.3 Å²	102.3	54%	0.542	54%	0.543	S	S	.	.	H	α-helix	trans	-65.5	-40.8	178.5	-157.4	170.2	9.6	0	0	111.8	V17 V18 M19 V23 V24 E25	V17-Q21 WeakPolarHBondContact O-CB 3.34Å; V17-Q21 PolarHBondContact O-N 2.92Å; V18-Q21 PolarHBondContact O-N 2.89Å; M19-Q21 VanDerWaalsContact C-N 3.33Å; M19-Q21 PolarHBondContact O-N 3.4Å; Q21-V23 VanDerWaalsContact C-N 3.34Å; Q21-V23 PolarHBondContact O-N 3.47Å; Q21-V24 PolarHBondContact O-N 2.94Å; Q21-E25 PolarHBondContact O-N 3.31Å
22	I	55	Low	59.5	Low	83 Å²	83	102.1 Å²	102.1	43%	0.426	54%	0.544	S	S	.	.	H	α-helix	trans	-63.6	-38.7	174.9	-67.3	163.8	0	0	0	111.5	V18 M19 K26	V18-I22 HydrophobicContact CG1-CD1 3.69Å; V18-I22 HydrophobicContact CG1-CG1 4.36Å; V18-I22 WeakPolarHBondContact O-CD1 3.24Å; V18-I22 WeakPolarHBondContact O-CG1 3.31Å; V18-I22 PolarHBondContact O-N 3.27Å; M19-I22 PolarHBondContact O-N 3.49Å; I22-K26 PolarHBondContact O-N 3.41Å
23	V	55.2	Low	59.4	Low	101 Å²	101	101.8 Å²	101.8	61%	0.612	54%	0.537	S	S	*	.	H	α-helix	trans	-68.6	-38.9	177.6	171.8	0	0	0	0	111	M19 M20 Q21	M19-V23 VanDerWaalsContact O-CG2 3.26Å; M19-V23 WeakPolarHBondContact O-CG2 3.2Å; M19-V23 PolarHBondContact O-N 3.23Å; M20-V23 PolarHBondContact O-N 2.96Å; Q21-V23 VanDerWaalsContact C-N 3.34Å; Q21-V23 PolarHBondContact O-N 3.47Å
24	V	54	Low	59.4	Low	105 Å²	105	104.1 Å²	104.1	64%	0.636	55%	0.551	S	S	*	*	H	α-helix	trans	-72.5	-40.5	-179.9	174.2	0	0	0	0	111.9	M20 Q21 K26 V27	M20-V24 VanDerWaalsContact O-CG2 3.25Å; M20-V24 WeakPolarHBondContact O-CG2 3.26Å; M20-V24 PolarHBondContact O-N 3.29Å; Q21-V24 PolarHBondContact O-N 2.94Å; V24-K26 PolarHBondContact O-N 3.01Å; V24-V27 PolarHBondContact O-N 3.49Å
25	E	52.8	Low	59.8	Low	155 Å²	155	103.3 Å²	103.3	72%	0.724	55%	0.547	S	S	*	.	H	α-helix	trans	-68.2	-18.3	179.8	-80.3	-169.4	159.3	0	0	113.8	Q21	Q21-E25 PolarHBondContact O-N 3.31Å
26	K	52	Low	60.5	Low	143 Å²	143	103.2 Å²	103.2	62%	0.622	54%	0.542	S	S	*	.	T	Hydrogen-bonded Turn	trans	-109.2	22.8	-179.5	-65.1	-160.3	-180	-179.2	0	113.9	I22 V24 P28	I22-K26 PolarHBondContact O-N 3.41Å; V24-K26 PolarHBondContact O-N 3.01Å; K26-P28 WeakPolarHBondContact O-CD 3.27Å; K26-P28 VanDerWaalsContact O-N 3.15Å
27	V	53.4	Low	61.3	Low	101 Å²	101	100.9 Å²	100.9	61%	0.612	53%	0.532	S	S	*	.			trans	-69.5	108.3	163.9	-177.9	0	0	0	0	106.4	V24 L29	V24-V27 PolarHBondContact O-N 3.49Å; V27-L29 PolarHBondContact O-N 2.91Å; V27-L29 VanDerWaalsContact O-N 3.15Å
28	P	55.5	Low	62.3	Low	48 Å²	48	97.7 Å²	97.7	31%	0.312	51%	0.513	S	S	.	.			trans	-58.5	126	176.7	25	-31.5	0	0	0	107.3	K26 I30 L39	K26-P28 WeakPolarHBondContact O-CD 3.27Å; K26-P28 VanDerWaalsContact O-N 3.15Å; P28-I30 PolarHBondContact O-N 3.15Å; P28-L39 HydrophobicContact CB-CD1 3.93Å; P28-L39 HydrophobicContact CB-CD2 4.47Å; P28-L39 HydrophobicContact CB-CG 3.92Å; P28-L39 HydrophobicContact CG-CD1 4.15Å
29	L	63.7	Low	63.3	Low	132 Å²	132	97.6 Å²	97.6	69%	0.691	51%	0.51	S	S	*	.			trans	-64.8	103.9	172.7	-120	92.7	0	0	0	106.7	V27 D31	V27-L29 PolarHBondContact O-N 2.91Å; V27-L29 VanDerWaalsContact O-N 3.15Å; L29-D31 PolarHBondContact O-N 3.23Å
30	I	58.7	Low	64.5	Low	90 Å²	90	96.7 Å²	96.7	46%	0.462	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.7	95.6	170.3	-53.8	177.8	0	0	0	105.8	P28 H32 T37 L39	P28-I30 PolarHBondContact O-N 3.15Å; I30-H32 WeakPolarHBondContact CG2-CE1 3.06Å; I30-H32 VanDerWaalsContact CG2-NE2 3.27Å; I30-H32 WeakPolarHBondContact CG2-NE2 3.39Å; I30-T37 HydrophobicContact CG2-CG2 4.36Å; I30-L39 HydrophobicContact CG1-CD1 4.4Å
31	D	60.5	Low	65.5	Low	70 Å²	70	95.8 Å²	95.8	37%	0.374	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85	111.9	171.4	-172.4	11.4	0	0	0	107.9	L29 K33 S38	L29-D31 PolarHBondContact O-N 3.23Å; D31-K33 VanDerWaalsContact OD2-CE 3.27Å; D31-K33 WeakPolarHBondContact OD2-CE 3.27Å; D31-K33 IonicContact OD2-NZ 3.77Å; D31-S38 PolarHBondContact N-O 3.36Å; D31-S38 PolarHBondContact O-N 3.49Å; D31-S38 PolarHBondContact O-OG 3.19Å
32	H	56.1	Low	66.8	Low	134 Å²	134	93.7 Å²	93.7	62%	0.62	51%	0.506	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.5	93.9	175.1	-70.7	-65.2	0	0	0	108.6	I30	I30-H32 WeakPolarHBondContact CG2-CE1 3.06Å; I30-H32 VanDerWaalsContact CG2-NE2 3.27Å; I30-H32 WeakPolarHBondContact CG2-NE2 3.39Å
33	K	65.5	Low	68	Low	109 Å²	109	91.5 Å²	91.5	47%	0.474	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.3	149.8	162.5	-72	176	-174.1	160.7	0	108.6	D31 N35 E36	D31-K33 VanDerWaalsContact OD2-CE 3.27Å; D31-K33 WeakPolarHBondContact OD2-CE 3.27Å; D31-K33 IonicContact OD2-NZ 3.77Å; K33-N35 PolarHBondContact O-N 2.78Å; K33-E36 HydrophobicContact CB-CB 4.24Å; K33-E36 PolarHBondContact N-O 2.78Å; K33-E36 PolarHBondContact O-N 2.87Å; K33-E36 VanDerWaalsContact O-N 3.15Å
34	P	69.5	Low	69.3	Low	117 Å²	117	89.4 Å²	89.4	76%	0.76	49%	0.489	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.1	-29.1	-178.1	15.9	-28.5	0	0	0	113.1	Q50	P34-Q50 PolarHBondContact O-NE2 2.99Å
35	N	77.6	Confident	70.9	Confident	94 Å²	94	86.8 Å²	86.8	50%	0.503	47%	0.471	S	S	.	.	T	Hydrogen-bonded Turn	trans	-115.2	1.2	-175.9	-55.5	-14.8	0	0	0	115.1	K33 Q50	K33-N35 PolarHBondContact O-N 2.78Å; N35-Q50 VanDerWaalsContact CA-CD 3.47Å; N35-Q50 HydrophobicContact CB-CG 4.21Å; N35-Q50 PolarHBondContact O-N 2.81Å; N35-Q50 VanDerWaalsContact O-N 3.14Å; N35-Q50 VanDerWaalsContact OD1-CD 3.27Å; N35-Q50 PolarHBondContact OD1-NE2 3.46Å; N35-Q50 PolarHBondContact OD1-OE1 3.24Å
36	E	78.7	Confident	72.5	Confident	47 Å²	47	83.2 Å²	83.2	22%	0.22	45%	0.453	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.9	124.1	-173.1	-174.6	179.2	-178.4	0	0	109.4	K33 S47 L48 L49	K33-E36 HydrophobicContact CB-CB 4.24Å; K33-E36 PolarHBondContact N-O 2.78Å; K33-E36 PolarHBondContact O-N 2.87Å; K33-E36 VanDerWaalsContact O-N 3.15Å; E36-S47 WeakPolarHBondContact OE1-CB 3.02Å; E36-S47 PolarHBondContact OE1-OG 2.93Å; E36-L48 WeakPolarHBondContact CA-O 3.45Å; E36-L49 HydrophobicContact CB-CD2 4.23Å; E36-L49 HydrophobicContact CG-CD2 3.98Å
37	T	82.4	Confident	74.2	Confident	62 Å²	62	76.6 Å²	76.6	38%	0.38	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	113.6	166.9	-58.3	0	0	0	0	107.7	I30 S47 L48	I30-T37 HydrophobicContact CG2-CG2 4.36Å; T37-S47 CarbonylContact O-C 3.52Å; T37-S47 WeakPolarHBondContact O-CA 3.42Å; T37-L48 PolarHBondContact N-O 2.64Å; T37-L48 PolarHBondContact O-N 2.79Å
38	S	84.7	Confident	75.7	Confident	16 Å²	16	76 Å²	76	11%	0.112	42%	0.418	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	137.4	177.7	57.9	0	0	0	0	111.7	D31 F46 S47	D31-S38 PolarHBondContact N-O 3.36Å; D31-S38 PolarHBondContact O-N 3.49Å; D31-S38 PolarHBondContact O-OG 3.19Å; S38-F46 CarbonylContact C-O 3.59Å; S38-F46 VanDerWaalsContact CA-O 3.25Å; S38-F46 WeakPolarHBondContact CA-O 3.25Å; S38-S47 WeakPolarHBondContact CB-OG 3.45Å
39	L	83.7	Confident	77.1	Confident	65 Å²	65	75.9 Å²	75.9	34%	0.34	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122	122	173.1	-178.6	136.5	0	0	0	108.8	P28 I30 F41 F46	P28-L39 HydrophobicContact CB-CD1 3.93Å; P28-L39 HydrophobicContact CB-CD2 4.47Å; P28-L39 HydrophobicContact CB-CG 3.92Å; P28-L39 HydrophobicContact CG-CD1 4.15Å; I30-L39 HydrophobicContact CG1-CD1 4.4Å; L39-F41 HydrophobicContact CD2-CB 4.17Å; L39-F46 HydrophobicContact CD2-CD2 4.21Å; L39-F46 PolarHBondContact N-O 2.94Å; L39-F46 PolarHBondContact O-N 3.15Å
40	E	82.7	Confident	77.9	Confident	100 Å²	100	76 Å²	76	47%	0.467	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	128.2	174.8	-172.8	175.3	171.2	0	0	110.7	I44 I45	E40-I44 WeakPolarHBondContact CA-O 3.47Å; E40-I45 HydrophobicContact CB-CG1 4.4Å; E40-I45 HydrophobicContact CG-CG1 4.05Å
41	F	79.3	Confident	78.9	Confident	124 Å²	124	76.3 Å²	76.3	54%	0.544	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.6	119.3	174.4	-175.6	-97.8	0	0	0	110.9	L39 G43 I44	L39-F41 HydrophobicContact CD2-CB 4.17Å; F41-G43 VanDerWaalsContact C-N 3.26Å; F41-G43 PolarHBondContact O-N 2.97Å; F41-I44 PolarHBondContact N-O 3.15Å; F41-I44 WeakPolarHBondContact O-CB 3.31Å; F41-I44 PolarHBondContact O-N 3.18Å
42	G	81.6	Confident	79.7	Confident	72 Å²	72	75.4 Å²	75.4	74%	0.742	41%	0.413	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.2	31.5	174.8	0	0	0	0	0	114.5	I44	G42-I44 VanDerWaalsContact C-N 3.27Å; G42-I44 PolarHBondContact O-N 2.82Å
43	G	80.7	Confident	80.9	Confident	37 Å²	37	69.7 Å²	69.7	38%	0.381	39%	0.388	S	S	.	.	T	Hydrogen-bonded Turn	trans	79.2	4.3	-176	0	0	0	0	0	114.8	F41	F41-G43 VanDerWaalsContact C-N 3.26Å; F41-G43 PolarHBondContact O-N 2.97Å
44	I	82.8	Confident	81.9	Confident	57 Å²	57	66.3 Å²	66.3	29%	0.292	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	125.5	169.1	-54.5	170.6	0	0	0	108.2	E40 F41 G42 F46 I56 Q57 Y58	E40-I44 WeakPolarHBondContact CA-O 3.47Å; F41-I44 PolarHBondContact N-O 3.15Å; F41-I44 WeakPolarHBondContact O-CB 3.31Å; F41-I44 PolarHBondContact O-N 3.18Å; G42-I44 VanDerWaalsContact C-N 3.27Å; G42-I44 PolarHBondContact O-N 2.82Å; I44-F46 HydrophobicContact CB-CE2 3.93Å; I44-F46 HydrophobicContact CB-CZ 4.32Å; I44-F46 HydrophobicContact CG2-CD2 4.07Å; I44-F46 HydrophobicContact CG2-CE1 4.17Å; I44-F46 HydrophobicContact CG2-CE2 3.48Å; I44-F46 VanDerWaalsContact CG2-CE2 3.48Å; I44-F46 HydrophobicContact CG2-CZ 3.55Å; I44-I56 HydrophobicContact CG2-CG2 3.72Å; I44-Q57 CarbonylContact C-O 3.54Å; I44-Q57 VanDerWaalsContact CA-O 3.31Å; I44-Q57 WeakPolarHBondContact CA-O 3.48Å; I44-Y58 HydrophobicContact CG1-CD2 3.66Å; I44-Y58 HydrophobicContact CG1-CE2 4.4Å; I44-Y58 HydrophobicContact CG1-CG 4.43Å
45	I	87	Confident	82.6	Confident	50 Å²	50	62.9 Å²	62.9	26%	0.256	35%	0.349	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.2	118.5	176.6	-55	168.8	0	0	0	108	E40 I56 Q57	E40-I45 HydrophobicContact CB-CG1 4.4Å; E40-I45 HydrophobicContact CG-CG1 4.05Å; I45-I56 CarbonylContact O-C 3.55Å; I45-I56 WeakPolarHBondContact O-CA 3.41Å; I45-Q57 HydrophobicContact CB-CB 4.32Å; I45-Q57 PolarHBondContact N-O 3.08Å; I45-Q57 PolarHBondContact O-N 2.79Å
46	F	86.6	Confident	83.1	Confident	79 Å²	79	61.4 Å²	61.4	35%	0.346	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	111.7	172.6	-61.2	-91	0	0	0	108.5	S38 L39 I44 I56	S38-F46 CarbonylContact C-O 3.59Å; S38-F46 VanDerWaalsContact CA-O 3.25Å; S38-F46 WeakPolarHBondContact CA-O 3.25Å; L39-F46 HydrophobicContact CD2-CD2 4.21Å; L39-F46 PolarHBondContact N-O 2.94Å; L39-F46 PolarHBondContact O-N 3.15Å; I44-F46 HydrophobicContact CB-CE2 3.93Å; I44-F46 HydrophobicContact CB-CZ 4.32Å; I44-F46 HydrophobicContact CG2-CD2 4.07Å; I44-F46 HydrophobicContact CG2-CE1 4.17Å; I44-F46 HydrophobicContact CG2-CE2 3.48Å; I44-F46 VanDerWaalsContact CG2-CE2 3.48Å; I44-F46 HydrophobicContact CG2-CZ 3.55Å; F46-I56 HydrophobicContact CD1-CD1 4.37Å; F46-I56 HydrophobicContact CD1-CG1 3.95Å; F46-I56 HydrophobicContact CD1-CG2 4.1Å; F46-I56 HydrophobicContact CE1-CD1 4.25Å; F46-I56 HydrophobicContact CE1-CG1 4.23Å; F46-I56 HydrophobicContact CE1-CG2 3.87Å; F46-I56 HydrophobicContact CZ-CG2 4.49Å
47	S	86.7	Confident	83.4	Confident	4 Å²	4	61.8 Å²	61.8	3%	0.028	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112	125.9	177.3	-63.8	0	0	0	0	110.7	E36 T37 S38 V54 K55	E36-S47 WeakPolarHBondContact OE1-CB 3.02Å; E36-S47 PolarHBondContact OE1-OG 2.93Å; T37-S47 CarbonylContact O-C 3.52Å; T37-S47 WeakPolarHBondContact O-CA 3.42Å; S38-S47 WeakPolarHBondContact CB-OG 3.45Å; S47-V54 CarbonylContact O-C 3.49Å; S47-V54 WeakPolarHBondContact O-CA 3.39Å; S47-K55 PolarHBondContact N-O 2.81Å; S47-K55 PolarHBondContact O-N 2.87Å
48	L	85.3	Confident	83.5	Confident	89 Å²	89	66.2 Å²	66.2	47%	0.466	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.1	114.7	166.2	-178.5	66.5	0	0	0	108.9	E36 T37 V54	E36-L48 WeakPolarHBondContact CA-O 3.45Å; T37-L48 PolarHBondContact N-O 2.64Å; T37-L48 PolarHBondContact O-N 2.79Å; L48-V54 HydrophobicContact CD1-CG2 3.7Å
49	L	84.6	Confident	83.4	Confident	45 Å²	45	68 Å²	68	24%	0.236	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.4	150.8	177.8	-63.5	158.1	0	0	0	110.1	E36 N51 S52 T53	E36-L49 HydrophobicContact CB-CD2 4.23Å; E36-L49 HydrophobicContact CG-CD2 3.98Å; L49-N51 WeakPolarHBondContact CB-OD1 3.32Å; L49-N51 PolarHBondContact O-N 2.79Å; L49-N51 VanDerWaalsContact O-N 3.12Å; L49-S52 PolarHBondContact O-N 2.83Å; L49-T53 WeakPolarHBondContact CB-O 3.39Å; L49-T53 HydrophobicContact CD1-CG2 3.97Å; L49-T53 PolarHBondContact N-O 2.79Å
50	Q	82	Confident	83.2	Confident	134 Å²	134	74 Å²	74	63%	0.626	39%	0.393	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.7	-28.4	179.6	-87	178.1	-7.5	0	0	114.9	P34 N35 S52	P34-Q50 PolarHBondContact O-NE2 2.99Å; N35-Q50 VanDerWaalsContact CA-CD 3.47Å; N35-Q50 HydrophobicContact CB-CG 4.21Å; N35-Q50 PolarHBondContact O-N 2.81Å; N35-Q50 VanDerWaalsContact O-N 3.14Å; N35-Q50 VanDerWaalsContact OD1-CD 3.27Å; N35-Q50 PolarHBondContact OD1-NE2 3.46Å; N35-Q50 PolarHBondContact OD1-OE1 3.24Å; Q50-S52 PolarHBondContact O-N 2.83Å; Q50-S52 VanDerWaalsContact O-N 3.07Å
51	N	78.4	Confident	83	Confident	98 Å²	98	71.2 Å²	71.2	52%	0.524	38%	0.384	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.2	26.4	179.2	69.5	-28.4	0	0	0	113.1	L49 T53	L49-N51 WeakPolarHBondContact CB-OD1 3.32Å; L49-N51 PolarHBondContact O-N 2.79Å; L49-N51 VanDerWaalsContact O-N 3.12Å; N51-T53 VanDerWaalsContact CG-OG1 3.3Å; N51-T53 PolarHBondContact ND2-OG1 2.03Å; N51-T53 PolarHBondContact O-N 3.14Å; N51-T53 VanDerWaalsContact O-N 3.14Å; N51-T53 VanDerWaalsContact OD1-CB 3.24Å; N51-T53 WeakPolarHBondContact OD1-CB 3.13Å; N51-T53 PolarHBondContact OD1-N 2.98Å; N51-T53 PolarHBondContact OD1-OG1 3.23Å
52	S	78.4	Confident	83.1	Confident	50 Å²	50	66.2 Å²	66.2	35%	0.35	36%	0.364	S	S	.	.	S	Bend	trans	57.5	24	-175.1	-54.9	0	0	0	0	113.6	L49 Q50 L67	L49-S52 PolarHBondContact O-N 2.83Å; Q50-S52 PolarHBondContact O-N 2.83Å; Q50-S52 VanDerWaalsContact O-N 3.07Å; S52-L67 VanDerWaalsContact O-CA 3.32Å; S52-L67 WeakPolarHBondContact O-CA 3.32Å; S52-L67 WeakPolarHBondContact O-CB 3.36Å; S52-L67 WeakPolarHBondContact O-CG 3.2Å; S52-L67 PolarHBondContact O-N 2.9Å
53	T	80.9	Confident	83.1	Confident	15 Å²	15	64.3 Å²	64.3	9%	0.092	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.9	128.5	175.9	-60.1	0	0	0	0	110.3	L49 N51 M64 M65	L49-T53 WeakPolarHBondContact CB-O 3.39Å; L49-T53 HydrophobicContact CD1-CG2 3.97Å; L49-T53 PolarHBondContact N-O 2.79Å; N51-T53 VanDerWaalsContact CG-OG1 3.3Å; N51-T53 PolarHBondContact ND2-OG1 2.03Å; N51-T53 PolarHBondContact O-N 3.14Å; N51-T53 VanDerWaalsContact O-N 3.14Å; N51-T53 VanDerWaalsContact OD1-CB 3.24Å; N51-T53 WeakPolarHBondContact OD1-CB 3.13Å; N51-T53 PolarHBondContact OD1-N 2.98Å; N51-T53 PolarHBondContact OD1-OG1 3.23Å; T53-M64 HydrophobicContact CG2-CB 4.11Å; T53-M65 CarbonylContact C-O 3.58Å; T53-M65 WeakPolarHBondContact CA-O 3.45Å
54	V	85.5	Confident	83.2	Confident	37 Å²	37	65.1 Å²	65.1	22%	0.224	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.5	122.6	169.6	175	0	0	0	0	109.1	S47 L48 I56 M64 M65 L67	S47-V54 CarbonylContact O-C 3.49Å; S47-V54 WeakPolarHBondContact O-CA 3.39Å; L48-V54 HydrophobicContact CD1-CG2 3.7Å; V54-I56 HydrophobicContact CG1-CG1 4.1Å; V54-M64 CarbonylContact O-C 3.53Å; V54-M64 WeakPolarHBondContact O-CA 2.95Å; V54-M65 PolarHBondContact N-O 3.17Å; V54-M65 PolarHBondContact O-N 3.04Å; V54-L67 HydrophobicContact CG2-CD1 3.46Å; V54-L67 VanDerWaalsContact CG2-CD1 3.46Å; V54-L67 HydrophobicContact CG2-CG 4.07Å
55	K	85.5	Confident	83	Confident	45 Å²	45	66.4 Å²	66.4	20%	0.196	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	125.4	172.6	178.6	-170.3	177.5	-164.1	0	109	S47 Q57 T63 M64	S47-K55 PolarHBondContact N-O 2.81Å; S47-K55 PolarHBondContact O-N 2.87Å; K55-Q57 VanDerWaalsContact NZ-OE1 3.08Å; K55-T63 CarbonylContact C-O 3.35Å; K55-T63 WeakPolarHBondContact CA-O 3.35Å; K55-M64 HydrophobicContact CB-CG 4.15Å; K55-M64 HydrophobicContact CD-CE 3.95Å; K55-M64 HydrophobicContact CG-CE 4.21Å; K55-M64 HydrophobicContact CG-CG 4.04Å
56	I	87.5	Confident	82.7	Confident	64 Å²	64	66.7 Å²	66.7	33%	0.328	34%	0.34	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	120.6	173.2	-51	174.2	0	0	0	106.9	I44 I45 F46 V54 S62 T63	I44-I56 HydrophobicContact CG2-CG2 3.72Å; I45-I56 CarbonylContact O-C 3.55Å; I45-I56 WeakPolarHBondContact O-CA 3.41Å; F46-I56 HydrophobicContact CD1-CD1 4.37Å; F46-I56 HydrophobicContact CD1-CG1 3.95Å; F46-I56 HydrophobicContact CD1-CG2 4.1Å; F46-I56 HydrophobicContact CE1-CD1 4.25Å; F46-I56 HydrophobicContact CE1-CG1 4.23Å; F46-I56 HydrophobicContact CE1-CG2 3.87Å; F46-I56 HydrophobicContact CZ-CG2 4.49Å; V54-I56 HydrophobicContact CG1-CG1 4.1Å; I56-S62 CarbonylContact O-C 3.57Å; I56-S62 VanDerWaalsContact O-CA 3.27Å; I56-S62 WeakPolarHBondContact O-CA 3.4Å; I56-T63 HydrophobicContact CB-CG2 3.72Å; I56-T63 HydrophobicContact CD1-CG2 4.29Å; I56-T63 HydrophobicContact CG1-CG2 4.29Å; I56-T63 PolarHBondContact N-O 3.19Å; I56-T63 PolarHBondContact O-N 3.12Å
57	Q	86.4	Confident	82.1	Confident	54 Å²	54	67.3 Å²	67.3	25%	0.252	35%	0.347	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	133.1	-177.4	178.2	172.9	-7.3	0	0	110.7	I44 I45 K55 G59 C61	I44-Q57 CarbonylContact C-O 3.54Å; I44-Q57 VanDerWaalsContact CA-O 3.31Å; I44-Q57 WeakPolarHBondContact CA-O 3.48Å; I45-Q57 HydrophobicContact CB-CB 4.32Å; I45-Q57 PolarHBondContact N-O 3.08Å; I45-Q57 PolarHBondContact O-N 2.79Å; K55-Q57 VanDerWaalsContact NZ-OE1 3.08Å; Q57-G59 PolarHBondContact NE2-O 2.84Å; Q57-G59 VanDerWaalsContact NE2-O 3.08Å; Q57-C61 CarbonylContact C-O 3.53Å; Q57-C61 VanDerWaalsContact CA-O 3.32Å; Q57-C61 WeakPolarHBondContact CA-O 3.27Å
58	Y	84.4	Confident	81.4	Confident	155 Å²	155	69.7 Å²	69.7	61%	0.608	36%	0.363	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-131.2	107.4	171.7	178.8	-107.9	0	0	0	108.8	I44 R60 C61	I44-Y58 HydrophobicContact CG1-CD2 3.66Å; I44-Y58 HydrophobicContact CG1-CE2 4.4Å; I44-Y58 HydrophobicContact CG1-CG 4.43Å; Y58-R60 PolarHBondContact O-N 2.84Å; Y58-R60 VanDerWaalsContact O-N 3.15Å; Y58-C61 PolarHBondContact N-O 2.81Å; Y58-C61 WeakPolarHBondContact O-CB 3.38Å; Y58-C61 PolarHBondContact O-N 3.07Å
59	G	81.3	Confident	80.3	Confident	55 Å²	55	71.2 Å²	71.2	57%	0.567	38%	0.379	S	S	*	.	T	Hydrogen-bonded Turn	trans	57.3	-116.7	-171.7	0	0	0	0	0	112.3	Q57	Q57-G59 PolarHBondContact NE2-O 2.84Å; Q57-G59 VanDerWaalsContact NE2-O 3.08Å
60	R	80.5	Confident	79.2	Confident	190 Å²	190	73.1 Å²	73.1	72%	0.717	39%	0.392	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.1	-4.8	177.9	-62.7	-174	-176.7	-163	-2.9	113.9	Y58	Y58-R60 PolarHBondContact O-N 2.84Å; Y58-R60 VanDerWaalsContact O-N 3.15Å
61	C	77	Confident	78	Confident	42 Å²	42	72 Å²	72	28%	0.284	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.4	134.4	-178.3	-63.8	0	0	0	0	109.2	Q57 Y58 C88	Q57-C61 CarbonylContact C-O 3.53Å; Q57-C61 VanDerWaalsContact CA-O 3.32Å; Q57-C61 WeakPolarHBondContact CA-O 3.27Å; Y58-C61 PolarHBondContact N-O 2.81Å; Y58-C61 WeakPolarHBondContact O-CB 3.38Å; Y58-C61 PolarHBondContact O-N 3.07Å; C61-C88 VanDerWaalsContact CA-SG 3.58Å; C61-C88 WeakPolarHBondContact CB-SG 3.24Å; C61-C88 WeakPolarHBondContact SG-CB 3.13Å; C61-C88 CovalentContact SG-SG 2.03Å; C61-C88 PolarHBondContact SG-SG 3.19Å
62	S	83	Confident	76.9	Confident	19 Å²	19	73.3 Å²	73.3	13%	0.133	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.5	134.7	176.1	61.6	0	0	0	0	111.7	I56 Y85	I56-S62 CarbonylContact O-C 3.57Å; I56-S62 VanDerWaalsContact O-CA 3.27Å; I56-S62 WeakPolarHBondContact O-CA 3.4Å; S62-Y85 CarbonylContact O-C 3.55Å; S62-Y85 WeakPolarHBondContact O-CA 3.49Å; S62-Y85 PolarHBondContact O-N 3Å; S62-Y85 VanDerWaalsContact O-N 3.16Å
63	T	81.4	Confident	75.7	Confident	31 Å²	31	75.6 Å²	75.6	19%	0.19	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	139.3	169.2	-177.1	0	0	0	0	108.8	K55 I56	K55-T63 CarbonylContact C-O 3.35Å; K55-T63 WeakPolarHBondContact CA-O 3.35Å; I56-T63 HydrophobicContact CB-CG2 3.72Å; I56-T63 HydrophobicContact CD1-CG2 4.29Å; I56-T63 HydrophobicContact CG1-CG2 4.29Å; I56-T63 PolarHBondContact N-O 3.19Å; I56-T63 PolarHBondContact O-N 3.12Å
64	M	82	Confident	74.5	Confident	55 Å²	55	84.2 Å²	84.2	27%	0.271	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	139.4	173.8	-62.4	-176	-169.5	0	0	109.1	T53 V54 K55 A83 Y85	T53-M64 HydrophobicContact CG2-CB 4.11Å; V54-M64 CarbonylContact O-C 3.53Å; V54-M64 WeakPolarHBondContact O-CA 2.95Å; K55-M64 HydrophobicContact CB-CG 4.15Å; K55-M64 HydrophobicContact CD-CE 3.95Å; K55-M64 HydrophobicContact CG-CE 4.21Å; K55-M64 HydrophobicContact CG-CG 4.04Å; M64-A83 PolarHBondContact N-O 3.37Å; M64-A83 CarbonylContact O-C 3.46Å; M64-A83 PolarHBondContact O-N 2.99Å; M64-Y85 HydrophobicContact CB-CD2 4.2Å; M64-Y85 HydrophobicContact CB-CE2 4.1Å; M64-Y85 HydrophobicContact CE-CD2 4.36Å; M64-Y85 HydrophobicContact CG-CD2 3.96Å; M64-Y85 HydrophobicContact CG-CE2 4.11Å; M64-Y85 HydrophobicContact SD-CD2 3.95Å; M64-Y85 HydrophobicContact SD-CE2 3.71Å
65	M	79.8	Confident	73	Confident	83 Å²	83	89.6 Å²	89.6	41%	0.409	49%	0.487	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.5	121.4	177.6	-172.1	169.8	-158	0	0	108.7	T53 V54 L67	T53-M65 CarbonylContact C-O 3.58Å; T53-M65 WeakPolarHBondContact CA-O 3.45Å; V54-M65 PolarHBondContact N-O 3.17Å; V54-M65 PolarHBondContact O-N 3.04Å; M65-L67 HydrophobicContact CG-CD2 4.19Å; M65-L67 HydrophobicContact SD-CD2 4.37Å
66	D	79	Confident	71.5	Confident	56 Å²	56	89.5 Å²	89.5	30%	0.299	50%	0.495	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.7	122.2	173.8	-170.4	1.4	0	0	0	109.6	S68 T81	D66-S68 WeakPolarHBondContact OD1-CB 3.11Å; D66-S68 PolarHBondContact OD1-N 3.16Å; D66-S68 PolarHBondContact OD1-OG 3.37Å; D66-S68 PolarHBondContact OD2-OG 2.75Å; D66-T81 PolarHBondContact N-O 3.14Å; D66-T81 VanDerWaalsContact N-O 3.12Å
67	L	74.8	Confident	69.8	Low	92 Å²	92	92 Å²	92	48%	0.482	51%	0.513	S	S	.	.			trans	-101.1	11.6	175.5	-51.4	-179.1	0	0	0	112.1	S52 V54 M65	S52-L67 VanDerWaalsContact O-CA 3.32Å; S52-L67 WeakPolarHBondContact O-CA 3.32Å; S52-L67 WeakPolarHBondContact O-CB 3.36Å; S52-L67 WeakPolarHBondContact O-CG 3.2Å; S52-L67 PolarHBondContact O-N 2.9Å; V54-L67 HydrophobicContact CG2-CD1 3.46Å; V54-L67 VanDerWaalsContact CG2-CD1 3.46Å; V54-L67 HydrophobicContact CG2-CG 4.07Å; M65-L67 HydrophobicContact CG-CD2 4.19Å; M65-L67 HydrophobicContact SD-CD2 4.37Å
68	S	71.2	Confident	68.1	Low	54 Å²	54	101.2 Å²	101.2	38%	0.378	55%	0.546	S	S	.	.			trans	-47.8	130.4	174.3	-67.4	0	0	0	0	110	D66 V70	D66-S68 WeakPolarHBondContact OD1-CB 3.11Å; D66-S68 PolarHBondContact OD1-N 3.16Å; D66-S68 PolarHBondContact OD1-OG 3.37Å; D66-S68 PolarHBondContact OD2-OG 2.75Å; S68-V70 PolarHBondContact O-N 2.95Å
69	P	63.8	Low	66.5	Low	121 Å²	121	99 Å²	99	79%	0.786	55%	0.548	S	S	*	.			trans	-61.1	112.8	-179.7	23.9	-31.7	0	0	0	108.4	T71	P69-T71 PolarHBondContact O-N 3.41Å
70	V	61.4	Low	65.1	Low	85 Å²	85	98 Å²	98	52%	0.515	54%	0.538	S	S	.	.			trans	-67.3	117.4	170.3	-179.3	0	0	0	0	106	S68 P72 A76	S68-V70 PolarHBondContact O-N 2.95Å; V70-P72 WeakPolarHBondContact O-CD 3.49Å; V70-P72 VanDerWaalsContact O-N 3.14Å; V70-A76 HydrophobicContact CG1-CB 4.24Å
71	T	55.8	Low	64.1	Low	112 Å²	112	93.5 Å²	93.5	69%	0.687	53%	0.532	S	S	*	.			trans	-50.5	122.6	168.4	20.7	0	0	0	0	107.7	P69 T73	P69-T71 PolarHBondContact O-N 3.41Å; T71-T73 PolarHBondContact O-N 2.64Å
72	P	56.5	Low	62.9	Low	124 Å²	124	100 Å²	100	81%	0.805	55%	0.551	S	S	*	*			trans	-67.4	90.7	178	27.6	-32.7	0	0	0	107.7	V70	V70-P72 WeakPolarHBondContact O-CD 3.49Å; V70-P72 VanDerWaalsContact O-N 3.14Å
73	T	53.1	Low	61.6	Low	98 Å²	98	100.7 Å²	100.7	60%	0.601	56%	0.557	S	S	*	*			trans	-75.3	142.3	156.1	43.1	0	0	0	0	106.4	T71 N75 A76	T71-T73 PolarHBondContact O-N 2.64Å; T73-N75 PolarHBondContact O-N 2.87Å; T73-A76 WeakPolarHBondContact O-CB 3.47Å; T73-A76 PolarHBondContact O-N 3.12Å; T73-A76 WeakPolarHBondContact OG1-CB 3.46Å
74	E	55.1	Low	60.2	Low	197 Å²	197	102.3 Å²	102.3	92%	0.921	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51	-17.8	-169.9	-64.7	176.9	155	0	0	114.4
75	N	54.7	Low	58.8	Low	149 Å²	149	105.6 Å²	105.6	80%	0.797	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-120.7	13.3	-178.8	-61.6	-39.5	0	0	0	114.6	T73 T77	T73-N75 PolarHBondContact O-N 2.87Å; N75-T77 PolarHBondContact O-N 2.98Å
76	A	53.3	Low	57.5	Low	44 Å²	44	106.6 Å²	106.6	36%	0.364	58%	0.584	S	S	.	*			trans	-75.4	96	-179.7	0	0	0	0	0	111.1	V70 T73 R78	V70-A76 HydrophobicContact CG1-CB 4.24Å; T73-A76 WeakPolarHBondContact O-CB 3.47Å; T73-A76 PolarHBondContact O-N 3.12Å; T73-A76 WeakPolarHBondContact OG1-CB 3.46Å; A76-R78 PolarHBondContact O-N 3.4Å
77	T	52.1	Low	56.3	Low	116 Å²	116	109.3 Å²	109.3	71%	0.712	60%	0.599	S	S	*	*			trans	-51.8	127.1	159.5	-42.9	0	0	0	0	108	N75 T79	N75-T77 PolarHBondContact O-N 2.98Å; T77-T79 VanDerWaalsContact C-N 3.29Å; T77-T79 PolarHBondContact O-N 3.49Å; T77-T79 PolarHBondContact O-OG1 2.97Å
78	R	50.8	Low	55.2	Low	247 Å²	247	107.8 Å²	107.8	93%	0.932	60%	0.595	S	S	*	*			trans	-58.7	87.5	179.1	179.9	-176.5	162	176.6	-3.7	110.3	A76	A76-R78 PolarHBondContact O-N 3.4Å
79	T	49.1	Very low	54.3	Low	109 Å²	109	109.4 Å²	109.4	67%	0.669	61%	0.606	S	S	*	*			trans	-114.9	89	175.2	3.3	0	0	0	0	107.8	T77 T81	T77-T79 VanDerWaalsContact C-N 3.29Å; T77-T79 PolarHBondContact O-N 3.49Å; T77-T79 PolarHBondContact O-OG1 2.97Å; T79-T81 PolarHBondContact O-N 3.49Å
80	G	53.8	Low	53.7	Low	34 Å²	34	111.3 Å²	111.3	35%	0.351	61%	0.605	S	S	.	*			trans	-62.3	133.6	163	0	0	0	0	0	108.4	R82	G80-R82 PolarHBondContact O-N 3.2Å
81	T	58	Low	53.2	Low	96 Å²	96	116.3 Å²	116.3	59%	0.589	62%	0.62	S	S	*	*			trans	-67.8	104.3	178.6	-51.5	0	0	0	0	108.4	D66 T79 A83	D66-T81 PolarHBondContact N-O 3.14Å; D66-T81 VanDerWaalsContact N-O 3.12Å; T79-T81 PolarHBondContact O-N 3.49Å; T81-A83 PolarHBondContact O-N 2.74Å
82	R	51.9	Low	52.8	Low	179 Å²	179	120.3 Å²	120.3	68%	0.675	63%	0.627	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-90.2	99.8	173.4	-171.5	-177.9	178.1	179.8	-1.3	108.4	G80 V84	G80-R82 PolarHBondContact O-N 3.2Å; R82-V84 HydrophobicContact CG-CG2 3.91Å
83	A	56.1	Low	52.4	Low	33 Å²	33	119.5 Å²	119.5	27%	0.273	63%	0.625	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-92.4	97	170.1	0	0	0	0	0	108.6	M64 T81 Y85	M64-A83 PolarHBondContact N-O 3.37Å; M64-A83 CarbonylContact O-C 3.46Å; M64-A83 PolarHBondContact O-N 2.99Å; T81-A83 PolarHBondContact O-N 2.74Å; A83-Y85 HydrophobicContact CB-CD2 4.22Å; A83-Y85 HydrophobicContact CB-CE2 3.57Å; A83-Y85 WeakPolarHBondContact O-CD2 3.49Å; A83-Y85 PolarHBondContact O-N 2.92Å
84	V	51.9	Low	52.1	Low	64 Å²	64	127 Å²	127	39%	0.388	64%	0.642	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-80.9	110.7	171.4	-174.7	0	0	0	0	107.7	R82 D86	R82-V84 HydrophobicContact CG-CG2 3.91Å; V84-D86 PolarHBondContact O-N 3.27Å
85	Y	52.7	Low	51.7	Low	124 Å²	124	123 Å²	123	49%	0.486	64%	0.636	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-92.9	83.9	174	-67.4	-84	0	0	0	109.2	S62 M64 A83 N87	S62-Y85 CarbonylContact O-C 3.55Å; S62-Y85 WeakPolarHBondContact O-CA 3.49Å; S62-Y85 PolarHBondContact O-N 3Å; S62-Y85 VanDerWaalsContact O-N 3.16Å; M64-Y85 HydrophobicContact CB-CD2 4.2Å; M64-Y85 HydrophobicContact CB-CE2 4.1Å; M64-Y85 HydrophobicContact CE-CD2 4.36Å; M64-Y85 HydrophobicContact CG-CD2 3.96Å; M64-Y85 HydrophobicContact CG-CE2 4.11Å; M64-Y85 HydrophobicContact SD-CD2 3.95Å; M64-Y85 HydrophobicContact SD-CE2 3.71Å; A83-Y85 HydrophobicContact CB-CD2 4.22Å; A83-Y85 HydrophobicContact CB-CE2 3.57Å; A83-Y85 WeakPolarHBondContact O-CD2 3.49Å; A83-Y85 PolarHBondContact O-N 2.92Å; Y85-N87 VanDerWaalsContact C-N 3.29Å; Y85-N87 PolarHBondContact O-N 3.01Å
86	D	52.5	Low	51.4	Low	105 Å²	105	127.1 Å²	127.1	56%	0.561	64%	0.64	S	S	*	*			trans	-76.6	76.5	175.5	-84.2	-28.3	0	0	0	111.5	V84 C88	V84-D86 PolarHBondContact O-N 3.27Å; D86-C88 PolarHBondContact O-N 2.86Å
87	N	53.2	Low	51	Low	113 Å²	113	135.8 Å²	135.8	60%	0.604	66%	0.663	S	S	*	*	G	3₁₀ helix	trans	-73	5.2	160.6	-80.2	-12.2	0	0	0	112.4	Y85 S89	Y85-N87 VanDerWaalsContact C-N 3.29Å; Y85-N87 PolarHBondContact O-N 3.01Å; N87-S89 PolarHBondContact O-N 2.76Å
88	C	53.1	Low	50.7	Low	59 Å²	59	142.4 Å²	142.4	40%	0.399	68%	0.675	S	S	.	*	G	3₁₀ helix	trans	-64.5	-17.2	177.6	-45.5	0	0	0	0	113.1	C61 D86	C61-C88 VanDerWaalsContact CA-SG 3.58Å; C61-C88 WeakPolarHBondContact CB-SG 3.24Å; C61-C88 WeakPolarHBondContact SG-CB 3.13Å; C61-C88 CovalentContact SG-SG 2.03Å; C61-C88 PolarHBondContact SG-SG 3.19Å; D86-C88 PolarHBondContact O-N 2.86Å
89	S	51	Low	50.6	Low	88 Å²	88	139.3 Å²	139.3	62%	0.615	67%	0.669	S	S	*	*	G	3₁₀ helix	trans	-94.7	8.1	-170.7	-76.2	0	0	0	0	116.5	N87 K91	N87-S89 PolarHBondContact O-N 2.76Å; S89-K91 PolarHBondContact O-N 2.76Å
90	E	52.7	Low	50.5	Low	161 Å²	161	141.7 Å²	141.7	75%	0.752	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.8	-8	-179.9	-85.5	-160.5	139.8	0	0	115.2
91	K	50.3	Low	50.1	Low	191 Å²	191	145.2 Å²	145.2	83%	0.83	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.8	7.7	-178.7	-74.5	-164.9	177	-174.5	0	116.9	S89	S89-K91 PolarHBondContact O-N 2.76Å
92	K	47	Very low	49.8	Very low	196 Å²	196	153.4 Å²	153.4	85%	0.852	74%	0.735	S	S	*	*	S	Bend	trans	-103.2	-2.5	-177.7	-131.5	175.7	-176	174.7	0	117.2
93	S	47.7	Very low	49.7	Very low	107 Å²	107	152.2 Å²	152.2	75%	0.748	74%	0.738	S	S	*	*	S	Bend	trans	-110.6	12.1	-172.2	52.7	0	0	0	0	116.7
94	R	47.4	Very low	49.4	Very low	255 Å²	255	158.4 Å²	158.4	96%	0.962	76%	0.762	S	S	*	*	S	Bend	trans	-108.1	29.9	174.7	-97.8	-171	-175.5	175.5	3.7	115.7
95	S	46	Very low	49.2	Very low	114 Å²	114	163.7 Å²	163.7	80%	0.797	78%	0.783	S	S	*	*			trans	-130.2	34.9	176.1	-169	0	0	0	0	114.7
96	R	48	Very low	49	Very low	235 Å²	235	166 Å²	166	89%	0.887	80%	0.8	S	S	*	*	S	Bend	trans	-123.3	117	166.8	-79.3	-173.1	177	176.7	-0.5	111.2
97	R	45.4	Very low	48.8	Very low	225 Å²	225	169.8 Å²	169.8	85%	0.849	82%	0.815	S	S	*	*			trans	80.9	73.9	157.5	-59.5	-175	178	175.9	-1.9	117.4
98	R	45.4	Very low	48.5	Very low	255 Å²	255	173.6 Å²	173.6	96%	0.962	83%	0.829	S	S	*	*			trans	-120.8	75.9	137.8	-95	-169.7	175.7	178.6	-1.3	108.5
99	K	48.9	Very low	48.2	Very low	183 Å²	183	181.8 Å²	181.8	80%	0.796	86%	0.86	S	S	*	*			trans	-154.9	139.9	155	-86.6	-165.4	177.1	-174	0	103.5
100	D	47.2	Very low	48	Very low	159 Å²	159	189 Å²	189	85%	0.85	88%	0.879	S	S	*	*			trans	106.2	63.1	-172.9	-46.2	-20.6	0	0	0	112.8
101	A	46.1	Very low	47.6	Very low	107 Å²	107	191.3 Å²	191.3	88%	0.884	89%	0.89	S	S	*	*			trans	-170	68.9	151.4	0	0	0	0	0	108.2
102	E	51.9	Low	47.4	Very low	269 Å²	269	191.4 Å²	191.4	100%	1.257	90%	0.895	S	S	*	*			trans	-123.7	0	157.2	-156.4	174.8	174.1	0	0	105.8

Retrieved 102 of 102 residues in 71 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).