A0A5K4F8W0_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F8W0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 68 aa.

						>A0A5K4F8W0_SCHMA|A0A5K4F8W0
MQFCVGLSHRHSSHSKSNQRNVFLFRQEINLMNLIRIAQNFQSQITNALNFVHGNHLDEIKLSVDKLV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.4	Very low	59.8	Low	220 Å²	220	159.7 Å²	159.7	100%	1.084	83%	0.832	S	S	*	*				0	104.7	0	-77.6	178	-176	0	0	108.3	F3	M1-F3 PolarHBondContact O-N 3.43Å
2	Q	58.8	Low	59.6	Low	199 Å²	199	151.3 Å²	151.3	93%	0.93	80%	0.796	S	S	*	*			trans	-73.1	111.8	164.7	-74.6	170.6	-42.8	0	0	106.4	C4	Q2-C4 PolarHBondContact O-N 2.81Å; Q2-C4 VanDerWaalsContact O-N 3.11Å
3	F	60.5	Low	59.7	Low	173 Å²	173	145.8 Å²	145.8	76%	0.759	78%	0.778	S	S	*	*			trans	-72.8	101.2	177	-99.3	-94.7	0	0	0	108.9	M1 V5	M1-F3 PolarHBondContact O-N 3.43Å; F3-V5 PolarHBondContact O-N 2.99Å
4	C	70.5	Confident	60.2	Low	124 Å²	124	146.6 Å²	146.6	84%	0.838	78%	0.775	S	S	*	*			trans	-71.1	83.3	157.5	-74.7	0	0	0	0	108.1	Q2 G6	Q2-C4 PolarHBondContact O-N 2.81Å; Q2-C4 VanDerWaalsContact O-N 3.11Å; C4-G6 PolarHBondContact O-N 3.19Å; C4-G6 VanDerWaalsContact O-N 3.13Å
5	V	68	Low	61	Low	129 Å²	129	140.6 Å²	140.6	78%	0.782	75%	0.749	S	S	*	*			trans	-72.5	103.4	160.4	-103.8	0	0	0	0	106.5	F3 L7	F3-V5 PolarHBondContact O-N 2.99Å; V5-L7 PolarHBondContact O-N 3.42Å
6	G	61.1	Low	62.2	Low	61 Å²	61	140.8 Å²	140.8	63%	0.629	74%	0.741	S	S	*	*			trans	-51.8	137.2	-173.5	0	0	0	0	0	112.3	C4 S8	C4-G6 PolarHBondContact O-N 3.19Å; C4-G6 VanDerWaalsContact O-N 3.13Å; G6-S8 VanDerWaalsContact C-N 3.25Å; G6-S8 PolarHBondContact O-N 3.03Å
7	L	59.8	Low	63.6	Low	168 Å²	168	136.1 Å²	136.1	88%	0.88	72%	0.723	S	S	*	*			trans	-56.6	94.7	156.2	-72.9	161.9	0	0	0	107.7	V5 H9	V5-L7 PolarHBondContact O-N 3.42Å; L7-H9 VanDerWaalsContact C-N 3.32Å; L7-H9 PolarHBondContact O-N 3.46Å
8	S	59.7	Low	64.8	Low	122 Å²	122	134.3 Å²	134.3	85%	0.853	71%	0.714	S	S	*	*			trans	-59.3	103.4	164.8	-58.9	0	0	0	0	107.5	G6 R10	G6-S8 VanDerWaalsContact C-N 3.25Å; G6-S8 PolarHBondContact O-N 3.03Å; S8-R10 PolarHBondContact O-N 2.92Å
9	H	56.3	Low	66.3	Low	155 Å²	155	134.2 Å²	134.2	72%	0.718	71%	0.709	S	S	*	*			trans	-32	107.3	169.5	-100.7	51.4	0	0	0	112.1	L7 H11	L7-H9 VanDerWaalsContact C-N 3.32Å; L7-H9 PolarHBondContact O-N 3.46Å; H9-H11 PolarHBondContact O-CD2 3.47Å; H9-H11 PolarHBondContact O-N 3.05Å
10	R	61.2	Low	67.6	Low	237 Å²	237	136.1 Å²	136.1	89%	0.894	71%	0.706	S	S	*	*				20.2	71	125.2	-154.7	-177.1	-139.4	-149.9	5.7	116.1	S8	S8-R10 PolarHBondContact O-N 2.92Å
11	H	59.6	Low	68.8	Low	169 Å²	169	133.9 Å²	133.9	78%	0.782	70%	0.695	S	S	*	*			trans	-118.1	27.5	169.5	-82.3	-68.2	0	0	0	114.4	H9	H9-H11 PolarHBondContact O-CD2 3.47Å; H9-H11 PolarHBondContact O-N 3.05Å
12	S	56.9	Low	71.3	Confident	58 Å²	58	126.3 Å²	126.3	41%	0.406	66%	0.661	S	S	.	*			trans	-106.3	14.9	176.4	74.6	0	0	0	0	115.1	H14 S15 K16	S12-H14 PolarHBondContact O-N 2.92Å; S12-S15 WeakPolarHBondContact CB-OG 3.47Å; S12-S15 PolarHBondContact O-N 3.36Å; S12-S15 PolarHBondContact O-OG 3.21Å; S12-K16 PolarHBondContact O-N 3.46Å
13	S	61.6	Low	73.1	Confident	80 Å²	80	121.9 Å²	121.9	56%	0.559	64%	0.639	S	S	*	*	H	α-helix	trans	-53.9	-33.4	175.2	48.3	0	0	0	0	112.9	S17	S13-S17 PolarHBondContact O-N 2.95Å
14	H	65.9	Low	74.7	Confident	158 Å²	158	117.1 Å²	117.1	73%	0.731	62%	0.621	S	S	*	*	H	α-helix	trans	-68.9	-41.3	174.6	-68.9	-69.2	0	0	0	113.2	S12 K16 S17 N18	S12-H14 PolarHBondContact O-N 2.92Å; H14-K16 PolarHBondContact O-N 2.9Å; H14-S17 PolarHBondContact O-N 2.92Å; H14-N18 PolarHBondContact O-N 3.38Å
15	S	72.9	Confident	76	Confident	56 Å²	56	117.1 Å²	117.1	39%	0.392	61%	0.607	S	S	.	*	H	α-helix	trans	-64.3	-40	178.8	72.2	0	0	0	0	112	S12 N18 Q19	S12-S15 WeakPolarHBondContact CB-OG 3.47Å; S12-S15 PolarHBondContact O-N 3.36Å; S12-S15 PolarHBondContact O-OG 3.21Å; S15-N18 PolarHBondContact O-N 3.32Å; S15-Q19 WeakPolarHBondContact O-CB 3.47Å; S15-Q19 VanDerWaalsContact O-CG 3.26Å; S15-Q19 WeakPolarHBondContact O-CG 3.46Å; S15-Q19 PolarHBondContact O-N 3.12Å
16	K	80.8	Confident	77.4	Confident	143 Å²	143	117 Å²	117	62%	0.622	59%	0.592	S	S	*	*	H	α-helix	trans	-67.6	-40.1	178.2	-66.7	-172.2	179.4	-173	0	111.8	S12 H14 R20	S12-K16 PolarHBondContact O-N 3.46Å; H14-K16 PolarHBondContact O-N 2.9Å; K16-R20 WeakPolarHBondContact O-CB 3.48Å; K16-R20 PolarHBondContact O-N 3.2Å
17	S	84.9	Confident	79.1	Confident	61 Å²	61	118.5 Å²	118.5	43%	0.427	58%	0.583	S	S	.	*	H	α-helix	trans	-64	-46.6	175.6	-171.9	0	0	0	0	111.4	S13 H14 Q19 R20 N21	S13-S17 PolarHBondContact O-N 2.95Å; H14-S17 PolarHBondContact O-N 2.92Å; S17-Q19 PolarHBondContact O-N 3.05Å; S17-R20 WeakPolarHBondContact O-CB 3.43Å; S17-R20 PolarHBondContact O-N 3.12Å; S17-N21 PolarHBondContact O-N 3.13Å; S17-N21 PolarHBondContact O-OD1 3.49Å
18	N	86.4	Confident	80.9	Confident	105 Å²	105	115.9 Å²	115.9	56%	0.561	57%	0.566	S	S	*	*	H	α-helix	trans	-63.1	-43.1	177.8	-167.3	43.5	0	0	0	112	H14 S15 R20 N21 V22	H14-N18 PolarHBondContact O-N 3.38Å; S15-N18 PolarHBondContact O-N 3.32Å; N18-R20 VanDerWaalsContact C-N 3.31Å; N18-R20 PolarHBondContact O-N 3.3Å; N18-N21 PolarHBondContact O-N 3.44Å; N18-V22 VanDerWaalsContact O-CG2 3.3Å; N18-V22 WeakPolarHBondContact O-CG2 3.44Å; N18-V22 PolarHBondContact O-N 3.28Å
19	Q	91.9	Very high	82.7	Confident	132 Å²	132	113 Å²	113	62%	0.617	54%	0.54	S	S	*	.	H	α-helix	trans	-60.4	-39.4	174.5	-75.1	175.8	-8.5	0	0	112.3	S15 S17 F23	S15-Q19 WeakPolarHBondContact O-CB 3.47Å; S15-Q19 VanDerWaalsContact O-CG 3.26Å; S15-Q19 WeakPolarHBondContact O-CG 3.46Å; S15-Q19 PolarHBondContact O-N 3.12Å; S17-Q19 PolarHBondContact O-N 3.05Å; Q19-F23 WeakPolarHBondContact O-CB 3.44Å; Q19-F23 PolarHBondContact O-N 2.97Å
20	R	93.7	Very high	84.7	Confident	172 Å²	172	109.8 Å²	109.8	65%	0.649	53%	0.529	S	S	*	.	H	α-helix	trans	-63.3	-46.5	174	178.1	178.7	174.2	159.2	-0.6	111.5	K16 S17 N18 V22 F23 L24	K16-R20 WeakPolarHBondContact O-CB 3.48Å; K16-R20 PolarHBondContact O-N 3.2Å; S17-R20 WeakPolarHBondContact O-CB 3.43Å; S17-R20 PolarHBondContact O-N 3.12Å; N18-R20 VanDerWaalsContact C-N 3.31Å; N18-R20 PolarHBondContact O-N 3.3Å; R20-V22 VanDerWaalsContact C-N 3.33Å; R20-V22 PolarHBondContact O-N 3.04Å; R20-F23 WeakPolarHBondContact O-CB 3.41Å; R20-F23 PolarHBondContact O-N 3.31Å; R20-F23 VanDerWaalsContact O-N 3.15Å; R20-L24 HydrophobicContact CG-CD1 4.06Å; R20-L24 HydrophobicContact CG-CG 4.34Å; R20-L24 WeakPolarHBondContact O-CG 3.47Å; R20-L24 PolarHBondContact O-N 2.88Å
21	N	92.1	Very high	86.4	Confident	89 Å²	89	103.3 Å²	103.3	48%	0.476	51%	0.511	S	S	.	.	H	α-helix	trans	-61.2	-43.8	179.5	-68.5	-9.9	0	0	0	111.4	S17 N18 F23 L24 F25	S17-N21 PolarHBondContact O-N 3.13Å; S17-N21 PolarHBondContact O-OD1 3.49Å; N18-N21 PolarHBondContact O-N 3.44Å; N21-F23 VanDerWaalsContact C-N 3.31Å; N21-F23 PolarHBondContact O-N 2.85Å; N21-L24 PolarHBondContact O-N 3.49Å; N21-F25 WeakPolarHBondContact O-CB 3.23Å; N21-F25 PolarHBondContact O-N 3.33Å
22	V	94.8	Very high	88.3	Confident	61 Å²	61	100.5 Å²	100.5	37%	0.37	50%	0.5	S	S	.	.	H	α-helix	trans	-64.8	-35.2	176.2	175	0	0	0	0	111.6	N18 R20 R26	N18-V22 VanDerWaalsContact O-CG2 3.3Å; N18-V22 WeakPolarHBondContact O-CG2 3.44Å; N18-V22 PolarHBondContact O-N 3.28Å; R20-V22 VanDerWaalsContact C-N 3.33Å; R20-V22 PolarHBondContact O-N 3.04Å; V22-R26 PolarHBondContact O-N 2.96Å
23	F	95.6	Very high	90.3	Very high	107 Å²	107	100.9 Å²	100.9	47%	0.469	50%	0.497	S	S	.	.	H	α-helix	trans	-65.1	-47.4	171.9	171.6	-92.4	0	0	0	112.3	Q19 R20 N21 R26 Q27	Q19-F23 WeakPolarHBondContact O-CB 3.44Å; Q19-F23 PolarHBondContact O-N 2.97Å; R20-F23 WeakPolarHBondContact O-CB 3.41Å; R20-F23 PolarHBondContact O-N 3.31Å; R20-F23 VanDerWaalsContact O-N 3.15Å; N21-F23 VanDerWaalsContact C-N 3.31Å; N21-F23 PolarHBondContact O-N 2.85Å; F23-R26 PolarHBondContact O-N 3.44Å; F23-Q27 HydrophobicContact CD1-CG 4.32Å; F23-Q27 HydrophobicContact CE1-CG 3.84Å; F23-Q27 HydrophobicContact CE2-CG 4.32Å; F23-Q27 HydrophobicContact CZ-CG 3.84Å; F23-Q27 WeakPolarHBondContact O-CG 3.4Å; F23-Q27 PolarHBondContact O-N 2.92Å
24	L	95.2	Very high	92	Very high	72 Å²	72	102.4 Å²	102.4	38%	0.377	50%	0.498	S	S	.	.	H	α-helix	trans	-61.9	-44.3	178.9	-69.1	174	0	0	0	111.3	R20 N21 R26 Q27 E28	R20-L24 HydrophobicContact CG-CD1 4.06Å; R20-L24 HydrophobicContact CG-CG 4.34Å; R20-L24 WeakPolarHBondContact O-CG 3.47Å; R20-L24 PolarHBondContact O-N 2.88Å; N21-L24 PolarHBondContact O-N 3.49Å; L24-R26 VanDerWaalsContact C-N 3.29Å; L24-R26 PolarHBondContact O-N 3.01Å; L24-Q27 CarbonylContact O-C 3.6Å; L24-Q27 WeakPolarHBondContact O-CA 3.37Å; L24-Q27 WeakPolarHBondContact O-CB 3.04Å; L24-Q27 PolarHBondContact O-N 3.39Å; L24-E28 WeakPolarHBondContact O-CG 3.33Å; L24-E28 PolarHBondContact O-N 2.95Å
25	F	97.1	Very high	93.6	Very high	124 Å²	124	98.9 Å²	98.9	54%	0.544	48%	0.484	S	S	.	.	H	α-helix	trans	-58.6	-40	176.6	-175.9	-109.4	0	0	0	112.5	N21 E28 I29	N21-F25 WeakPolarHBondContact O-CB 3.23Å; N21-F25 PolarHBondContact O-N 3.33Å; F25-E28 PolarHBondContact O-N 3.48Å; F25-I29 HydrophobicContact CD1-CD1 3.87Å; F25-I29 HydrophobicContact CE1-CD1 3.41Å; F25-I29 VanDerWaalsContact CE1-CD1 3.41Å; F25-I29 HydrophobicContact CE1-CG1 4.43Å; F25-I29 HydrophobicContact CE2-CD1 4.5Å; F25-I29 HydrophobicContact CZ-CD1 3.78Å; F25-I29 HydrophobicContact CZ-CG1 4.45Å; F25-I29 WeakPolarHBondContact O-CG1 3.36Å; F25-I29 PolarHBondContact O-N 2.98Å; F25-I29 VanDerWaalsContact O-N 3.07Å
26	R	97.4	Very high	94.8	Very high	128 Å²	128	103 Å²	103	48%	0.483	49%	0.491	S	S	.	.	H	α-helix	trans	-64.4	-40.5	172.8	-77.2	-173.2	-69.3	-105.4	-2.8	112.6	V22 F23 L24 E28 I29 N30	V22-R26 PolarHBondContact O-N 2.96Å; F23-R26 PolarHBondContact O-N 3.44Å; L24-R26 VanDerWaalsContact C-N 3.29Å; L24-R26 PolarHBondContact O-N 3.01Å; R26-E28 VanDerWaalsContact C-N 3.32Å; R26-I29 PolarHBondContact O-N 3.23Å; R26-N30 WeakPolarHBondContact O-CB 3.49Å; R26-N30 PolarHBondContact O-N 3.38Å; R26-N30 PolarHBondContact O-ND2 2.95Å
27	Q	96.9	Very high	95.6	Very high	92 Å²	92	100.3 Å²	100.3	43%	0.43	48%	0.483	S	S	.	.	H	α-helix	trans	-65	-38	176.6	-68	-58.9	-37.4	0	0	111.6	F23 L24 N30 L31	F23-Q27 HydrophobicContact CD1-CG 4.32Å; F23-Q27 HydrophobicContact CE1-CG 3.84Å; F23-Q27 HydrophobicContact CE2-CG 4.32Å; F23-Q27 HydrophobicContact CZ-CG 3.84Å; F23-Q27 WeakPolarHBondContact O-CG 3.4Å; F23-Q27 PolarHBondContact O-N 2.92Å; L24-Q27 CarbonylContact O-C 3.6Å; L24-Q27 WeakPolarHBondContact O-CA 3.37Å; L24-Q27 WeakPolarHBondContact O-CB 3.04Å; L24-Q27 PolarHBondContact O-N 3.39Å; Q27-N30 PolarHBondContact O-N 3.35Å; Q27-L31 VanDerWaalsContact O-CB 3.27Å; Q27-L31 WeakPolarHBondContact O-CB 3.1Å; Q27-L31 PolarHBondContact O-N 3.36Å
28	E	97.7	Very high	96.2	Very high	113 Å²	113	100 Å²	100	53%	0.528	48%	0.484	S	S	.	.	H	α-helix	trans	-61.8	-45.9	174.2	-71.3	176	159.1	0	0	111.6	L24 F25 R26 N30 L31 M32	L24-E28 WeakPolarHBondContact O-CG 3.33Å; L24-E28 PolarHBondContact O-N 2.95Å; F25-E28 PolarHBondContact O-N 3.48Å; R26-E28 VanDerWaalsContact C-N 3.32Å; E28-N30 PolarHBondContact O-N 3.39Å; E28-L31 PolarHBondContact O-N 2.87Å; E28-M32 WeakPolarHBondContact O-CB 3.49Å; E28-M32 WeakPolarHBondContact O-CG 3.35Å; E28-M32 PolarHBondContact O-N 2.94Å
29	I	98.5	Very high	96.7	Very high	61 Å²	61	100.5 Å²	100.5	31%	0.313	48%	0.483	S	S	.	.	H	α-helix	trans	-60.9	-45.9	175.1	-68.6	168.8	0	0	0	111.2	F25 R26 L31 M32 N33	F25-I29 HydrophobicContact CD1-CD1 3.87Å; F25-I29 HydrophobicContact CE1-CD1 3.41Å; F25-I29 VanDerWaalsContact CE1-CD1 3.41Å; F25-I29 HydrophobicContact CE1-CG1 4.43Å; F25-I29 HydrophobicContact CE2-CD1 4.5Å; F25-I29 HydrophobicContact CZ-CD1 3.78Å; F25-I29 HydrophobicContact CZ-CG1 4.45Å; F25-I29 WeakPolarHBondContact O-CG1 3.36Å; F25-I29 PolarHBondContact O-N 2.98Å; F25-I29 VanDerWaalsContact O-N 3.07Å; R26-I29 PolarHBondContact O-N 3.23Å; I29-L31 VanDerWaalsContact C-N 3.32Å; I29-L31 PolarHBondContact O-N 3.37Å; I29-M32 HydrophobicContact CG1-CE 4.16Å; I29-M32 PolarHBondContact O-N 3.4Å; I29-N33 WeakPolarHBondContact O-CB 3.37Å; I29-N33 VanDerWaalsContact O-CG 3.29Å; I29-N33 PolarHBondContact O-N 3.38Å; I29-N33 PolarHBondContact O-ND2 3.33Å
30	N	97.1	Very high	96.9	Very high	88 Å²	88	98.7 Å²	98.7	47%	0.471	48%	0.478	S	S	.	.	H	α-helix	trans	-62.2	-41.2	178.8	-71.4	-18.3	0	0	0	111.7	R26 Q27 E28 N33 L34	R26-N30 WeakPolarHBondContact O-CB 3.49Å; R26-N30 PolarHBondContact O-N 3.38Å; R26-N30 PolarHBondContact O-ND2 2.95Å; Q27-N30 PolarHBondContact O-N 3.35Å; E28-N30 PolarHBondContact O-N 3.39Å; N30-N33 PolarHBondContact O-N 3.37Å; N30-L34 WeakPolarHBondContact O-CB 3.5Å; N30-L34 PolarHBondContact O-N 2.92Å
31	L	98.6	Very high	97	Very high	101 Å²	101	96.2 Å²	96.2	53%	0.529	47%	0.472	S	S	.	.	H	α-helix	trans	-65.4	-46	177.3	-177.2	61.7	0	0	0	111.4	Q27 E28 I29 N33 L34 I35	Q27-L31 VanDerWaalsContact O-CB 3.27Å; Q27-L31 WeakPolarHBondContact O-CB 3.1Å; Q27-L31 PolarHBondContact O-N 3.36Å; E28-L31 PolarHBondContact O-N 2.87Å; I29-L31 VanDerWaalsContact C-N 3.32Å; I29-L31 PolarHBondContact O-N 3.37Å; L31-N33 VanDerWaalsContact C-N 3.28Å; L31-N33 PolarHBondContact O-N 3.22Å; L31-L34 PolarHBondContact O-N 3.14Å; L31-I35 HydrophobicContact CG-CD1 4.2Å; L31-I35 WeakPolarHBondContact O-CG1 3.35Å; L31-I35 PolarHBondContact O-N 3.01Å
32	M	98.6	Very high	97.3	Very high	109 Å²	109	98.1 Å²	98.1	54%	0.537	48%	0.478	S	S	.	.	H	α-helix	trans	-59	-40.1	174.9	-73.7	-172.6	-71.6	0	0	111.9	E28 I29 I35 R36	E28-M32 WeakPolarHBondContact O-CB 3.49Å; E28-M32 WeakPolarHBondContact O-CG 3.35Å; E28-M32 PolarHBondContact O-N 2.94Å; I29-M32 HydrophobicContact CG1-CE 4.16Å; I29-M32 PolarHBondContact O-N 3.4Å; M32-I35 PolarHBondContact O-N 3.28Å; M32-R36 PolarHBondContact O-N 2.93Å; M32-R36 VanDerWaalsContact O-N 3.08Å
33	N	98.3	Very high	97.3	Very high	67 Å²	67	98.2 Å²	98.2	36%	0.358	48%	0.481	S	S	.	.	H	α-helix	trans	-67.1	-40.6	176.2	-73.2	-24.1	0	0	0	112.3	I29 N30 L31 R36 I37	I29-N33 WeakPolarHBondContact O-CB 3.37Å; I29-N33 VanDerWaalsContact O-CG 3.29Å; I29-N33 PolarHBondContact O-N 3.38Å; I29-N33 PolarHBondContact O-ND2 3.33Å; N30-N33 PolarHBondContact O-N 3.37Å; L31-N33 VanDerWaalsContact C-N 3.28Å; L31-N33 PolarHBondContact O-N 3.22Å; N33-R36 PolarHBondContact O-N 3.4Å; N33-R36 PolarHBondContact OD1-NH1 2.98Å; N33-R36 VanDerWaalsContact OD1-NH1 3.1Å; N33-I37 WeakPolarHBondContact O-CG1 3.43Å; N33-I37 PolarHBondContact O-N 2.95Å
34	L	98.4	Very high	97.4	Very high	111 Å²	111	99 Å²	99	58%	0.581	49%	0.486	S	S	*	.	H	α-helix	trans	-62.5	-42.8	175.9	-176.8	63	0	0	0	111.6	N30 L31 R36 I37 A38	N30-L34 WeakPolarHBondContact O-CB 3.5Å; N30-L34 PolarHBondContact O-N 2.92Å; L31-L34 PolarHBondContact O-N 3.14Å; L34-R36 VanDerWaalsContact C-N 3.35Å; L34-R36 PolarHBondContact O-N 3.35Å; L34-I37 PolarHBondContact O-N 3.24Å; L34-A38 PolarHBondContact O-N 3.03Å
35	I	98.3	Very high	97.3	Very high	85 Å²	85	100.4 Å²	100.4	44%	0.436	49%	0.493	S	S	.	.	H	α-helix	trans	-59.8	-45.4	175.3	-68.8	166.4	0	0	0	110.6	L31 M32 I37 A38 Q39	L31-I35 HydrophobicContact CG-CD1 4.2Å; L31-I35 WeakPolarHBondContact O-CG1 3.35Å; L31-I35 PolarHBondContact O-N 3.01Å; M32-I35 PolarHBondContact O-N 3.28Å; I35-I37 VanDerWaalsContact C-N 3.33Å; I35-I37 PolarHBondContact O-N 3.48Å; I35-A38 PolarHBondContact O-N 3.21Å; I35-Q39 HydrophobicContact CG2-CG 4.45Å; I35-Q39 WeakPolarHBondContact O-CG 3.34Å; I35-Q39 PolarHBondContact O-N 3.18Å
36	R	98.5	Very high	97.1	Very high	141 Å²	141	97.4 Å²	97.4	53%	0.532	49%	0.485	S	S	.	.	H	α-helix	trans	-59.5	-43.2	177.4	-177.9	179.5	-68.1	117.2	0	112	M32 N33 L34 Q39 N40	M32-R36 PolarHBondContact O-N 2.93Å; M32-R36 VanDerWaalsContact O-N 3.08Å; N33-R36 PolarHBondContact O-N 3.4Å; N33-R36 PolarHBondContact OD1-NH1 2.98Å; N33-R36 VanDerWaalsContact OD1-NH1 3.1Å; L34-R36 VanDerWaalsContact C-N 3.35Å; L34-R36 PolarHBondContact O-N 3.35Å; R36-Q39 PolarHBondContact O-N 3.41Å; R36-N40 VanDerWaalsContact O-CG 3.29Å; R36-N40 PolarHBondContact O-N 3.09Å; R36-N40 VanDerWaalsContact O-N 3.09Å
37	I	97.8	Very high	96.7	Very high	87 Å²	87	95.9 Å²	95.9	45%	0.446	49%	0.487	S	S	.	.	H	α-helix	trans	-62.6	-46.8	176.6	-69.2	166.4	0	0	0	110.3	N33 L34 I35 Q39 N40 F41	N33-I37 WeakPolarHBondContact O-CG1 3.43Å; N33-I37 PolarHBondContact O-N 2.95Å; L34-I37 PolarHBondContact O-N 3.24Å; I35-I37 VanDerWaalsContact C-N 3.33Å; I35-I37 PolarHBondContact O-N 3.48Å; I37-Q39 VanDerWaalsContact C-N 3.34Å; I37-Q39 PolarHBondContact O-N 3.03Å; I37-N40 WeakPolarHBondContact O-CB 3.48Å; I37-N40 PolarHBondContact O-N 3.47Å; I37-F41 HydrophobicContact CG2-CD2 3.64Å; I37-F41 HydrophobicContact CG2-CE2 3.62Å; I37-F41 WeakPolarHBondContact O-CD2 3.48Å; I37-F41 PolarHBondContact O-N 2.91Å
38	A	96.7	Very high	96.3	Very high	55 Å²	55	94.1 Å²	94.1	46%	0.455	49%	0.488	S	S	.	.	H	α-helix	trans	-59.9	-41.9	179	0	0	0	0	0	112.5	L34 I35 F41 Q42	L34-A38 PolarHBondContact O-N 3.03Å; I35-A38 PolarHBondContact O-N 3.21Å; A38-F41 PolarHBondContact O-N 2.94Å; A38-Q42 WeakPolarHBondContact O-CB 3.43Å; A38-Q42 PolarHBondContact O-N 3.37Å
39	Q	97.7	Very high	95.9	Very high	115 Å²	115	94 Å²	94	54%	0.537	49%	0.49	S	S	.	.	H	α-helix	trans	-63.6	-40.1	175.8	-72.3	174.9	-31.1	0	0	112.4	I35 R36 I37 Q42 S43	I35-Q39 HydrophobicContact CG2-CG 4.45Å; I35-Q39 WeakPolarHBondContact O-CG 3.34Å; I35-Q39 PolarHBondContact O-N 3.18Å; R36-Q39 PolarHBondContact O-N 3.41Å; I37-Q39 VanDerWaalsContact C-N 3.34Å; I37-Q39 PolarHBondContact O-N 3.03Å; Q39-Q42 PolarHBondContact O-N 3.08Å; Q39-S43 PolarHBondContact O-N 3.34Å
40	N	95.7	Very high	95.3	Very high	95 Å²	95	96 Å²	96	51%	0.508	50%	0.501	S	S	.	.	H	α-helix	trans	-63	-45.5	175	-71	-14.7	0	0	0	111.4	R36 I37 S43 Q44	R36-N40 VanDerWaalsContact O-CG 3.29Å; R36-N40 PolarHBondContact O-N 3.09Å; R36-N40 VanDerWaalsContact O-N 3.09Å; I37-N40 WeakPolarHBondContact O-CB 3.48Å; I37-N40 PolarHBondContact O-N 3.47Å; N40-S43 PolarHBondContact O-N 3.36Å; N40-Q44 WeakPolarHBondContact O-CG 3.47Å; N40-Q44 PolarHBondContact O-N 3.36Å; N40-Q44 VanDerWaalsContact O-N 3.14Å
41	F	97	Very high	95	Very high	120 Å²	120	98.2 Å²	98.2	53%	0.526	51%	0.507	S	S	.	.	H	α-helix	trans	-61.8	-42.9	174.9	-87.6	-74.9	0	0	0	112.1	I37 A38 S43 Q44 I45	I37-F41 HydrophobicContact CG2-CD2 3.64Å; I37-F41 HydrophobicContact CG2-CE2 3.62Å; I37-F41 WeakPolarHBondContact O-CD2 3.48Å; I37-F41 PolarHBondContact O-N 2.91Å; A38-F41 PolarHBondContact O-N 2.94Å; F41-S43 VanDerWaalsContact C-N 3.32Å; F41-S43 PolarHBondContact O-N 3.48Å; F41-Q44 PolarHBondContact O-N 3.2Å; F41-I45 WeakPolarHBondContact O-CG1 3.38Å; F41-I45 PolarHBondContact O-N 3Å
42	Q	97	Very high	94.4	Very high	128 Å²	128	96.9 Å²	96.9	60%	0.598	50%	0.503	S	S	*	.	H	α-helix	trans	-57.9	-44.9	177	-177.9	-177.1	-11.3	0	0	111.5	A38 Q39 I45 T46	A38-Q42 WeakPolarHBondContact O-CB 3.43Å; A38-Q42 PolarHBondContact O-N 3.37Å; Q39-Q42 PolarHBondContact O-N 3.08Å; Q42-I45 PolarHBondContact O-N 3.32Å; Q42-T46 WeakPolarHBondContact O-CB 3.38Å; Q42-T46 PolarHBondContact O-N 2.88Å; Q42-T46 PolarHBondContact O-OG1 3.29Å
43	S	96.3	Very high	93.8	Very high	63 Å²	63	97.5 Å²	97.5	44%	0.441	50%	0.504	S	S	.	.	H	α-helix	trans	-60.8	-45.3	176.7	-177.6	0	0	0	0	112.1	Q39 N40 F41 I45 T46 N47	Q39-S43 PolarHBondContact O-N 3.34Å; N40-S43 PolarHBondContact O-N 3.36Å; F41-S43 VanDerWaalsContact C-N 3.32Å; F41-S43 PolarHBondContact O-N 3.48Å; S43-I45 PolarHBondContact O-N 2.83Å; S43-T46 PolarHBondContact O-N 3.37Å; S43-N47 WeakPolarHBondContact O-CB 3.44Å; S43-N47 PolarHBondContact O-N 3.36Å; S43-N47 PolarHBondContact O-ND2 2.94Å
44	Q	95.8	Very high	93.2	Very high	124 Å²	124	95.5 Å²	95.5	58%	0.579	50%	0.5	S	S	*	.	H	α-helix	trans	-61.3	-44.4	177.4	-70.1	177.8	8.3	0	0	112.4	N40 F41 N47 A48	N40-Q44 WeakPolarHBondContact O-CG 3.47Å; N40-Q44 PolarHBondContact O-N 3.36Å; N40-Q44 VanDerWaalsContact O-N 3.14Å; F41-Q44 PolarHBondContact O-N 3.2Å; Q44-N47 PolarHBondContact O-N 3.1Å; Q44-A48 WeakPolarHBondContact O-CB 3.34Å; Q44-A48 PolarHBondContact O-N 3.06Å
45	I	93.9	Very high	92.3	Very high	101 Å²	101	93.1 Å²	93.1	52%	0.518	49%	0.488	S	S	.	.	H	α-helix	trans	-62.6	-47.4	177.3	-68.7	169	0	0	0	110.5	F41 Q42 S43 N47 A48 L49	F41-I45 WeakPolarHBondContact O-CG1 3.38Å; F41-I45 PolarHBondContact O-N 3Å; Q42-I45 PolarHBondContact O-N 3.32Å; S43-I45 PolarHBondContact O-N 2.83Å; I45-N47 VanDerWaalsContact C-N 3.31Å; I45-N47 PolarHBondContact O-N 3.45Å; I45-A48 PolarHBondContact O-N 3.49Å; I45-L49 HydrophobicContact CG2-CD1 3.97Å; I45-L49 HydrophobicContact CG2-CG 4.37Å; I45-L49 WeakPolarHBondContact O-CG 3.47Å; I45-L49 PolarHBondContact O-N 2.89Å
46	T	92.5	Very high	91.5	Very high	62 Å²	62	93.9 Å²	93.9	38%	0.38	49%	0.489	S	S	.	.	H	α-helix	trans	-59.1	-42.8	177.9	-61.5	0	0	0	0	111.6	Q42 S43 L49 N50	Q42-T46 WeakPolarHBondContact O-CB 3.38Å; Q42-T46 PolarHBondContact O-N 2.88Å; Q42-T46 PolarHBondContact O-OG1 3.29Å; S43-T46 PolarHBondContact O-N 3.37Å; T46-L49 PolarHBondContact O-N 2.94Å; T46-N50 WeakPolarHBondContact O-CB 3.45Å; T46-N50 PolarHBondContact O-N 2.87Å; T46-N50 PolarHBondContact O-ND2 3.34Å
47	N	90.5	Very high	90.6	Very high	96 Å²	96	91.6 Å²	91.6	51%	0.513	49%	0.487	S	S	.	.	H	α-helix	trans	-65.3	-41.6	177.9	-67.9	-22.1	0	0	0	112.1	S43 Q44 I45 N50 F51	S43-N47 WeakPolarHBondContact O-CB 3.44Å; S43-N47 PolarHBondContact O-N 3.36Å; S43-N47 PolarHBondContact O-ND2 2.94Å; Q44-N47 PolarHBondContact O-N 3.1Å; I45-N47 VanDerWaalsContact C-N 3.31Å; I45-N47 PolarHBondContact O-N 3.45Å; N47-N50 PolarHBondContact O-N 3.27Å; N47-F51 WeakPolarHBondContact O-CB 3.49Å; N47-F51 PolarHBondContact O-N 3.26Å
48	A	87.9	Confident	90	Very high	55 Å²	55	92.4 Å²	92.4	46%	0.455	49%	0.492	S	S	.	.	H	α-helix	trans	-63.4	-42.8	176.1	0	0	0	0	0	111.7	Q44 I45 F51 V52	Q44-A48 WeakPolarHBondContact O-CB 3.34Å; Q44-A48 PolarHBondContact O-N 3.06Å; I45-A48 PolarHBondContact O-N 3.49Å; A48-F51 PolarHBondContact O-N 3.31Å; A48-V52 WeakPolarHBondContact O-CG2 3.44Å; A48-V52 PolarHBondContact O-N 3.42Å
49	L	88.5	Confident	89.2	Confident	109 Å²	109	95.5 Å²	95.5	57%	0.571	50%	0.497	S	S	*	.	H	α-helix	trans	-62.5	-44.2	175.4	-71.4	173.3	0	0	0	111.8	I45 T46 F51 V52 H53	I45-L49 HydrophobicContact CG2-CD1 3.97Å; I45-L49 HydrophobicContact CG2-CG 4.37Å; I45-L49 WeakPolarHBondContact O-CG 3.47Å; I45-L49 PolarHBondContact O-N 2.89Å; T46-L49 PolarHBondContact O-N 2.94Å; L49-F51 VanDerWaalsContact C-N 3.32Å; L49-F51 PolarHBondContact O-N 3.38Å; L49-V52 PolarHBondContact O-N 3.07Å; L49-H53 WeakPolarHBondContact O-CB 3.45Å; L49-H53 PolarHBondContact O-N 2.96Å
50	N	86.9	Confident	88.2	Confident	103 Å²	103	95 Å²	95	55%	0.551	50%	0.497	S	S	*	.	H	α-helix	trans	-63.1	-37.9	177.3	-71.9	-18.5	0	0	0	112	T46 N47 G54	T46-N50 WeakPolarHBondContact O-CB 3.45Å; T46-N50 PolarHBondContact O-N 2.87Å; T46-N50 PolarHBondContact O-ND2 3.34Å; N47-N50 PolarHBondContact O-N 3.27Å; N50-G54 PolarHBondContact O-N 2.9Å
51	F	89.7	Confident	87.7	Confident	136 Å²	136	96.8 Å²	96.8	60%	0.596	50%	0.5	S	S	*	.	H	α-helix	trans	-63.7	-47.5	174.4	175.8	-102.2	0	0	0	111.8	N47 A48 L49 H53 G54 N55	N47-F51 WeakPolarHBondContact O-CB 3.49Å; N47-F51 PolarHBondContact O-N 3.26Å; A48-F51 PolarHBondContact O-N 3.31Å; L49-F51 VanDerWaalsContact C-N 3.32Å; L49-F51 PolarHBondContact O-N 3.38Å; F51-H53 PolarHBondContact O-N 3.24Å; F51-G54 PolarHBondContact O-N 3.18Å; F51-N55 WeakPolarHBondContact CE1-ND2 3.27Å; F51-N55 WeakPolarHBondContact CE2-ND2 3.47Å; F51-N55 WeakPolarHBondContact CZ-ND2 3.46Å; F51-N55 WeakPolarHBondContact O-CB 3.49Å; F51-N55 PolarHBondContact O-N 2.98Å; F51-N55 PolarHBondContact O-ND2 3.46Å
52	V	87.5	Confident	87.3	Confident	72 Å²	72	95.8 Å²	95.8	44%	0.436	50%	0.5	S	S	.	.	H	α-helix	trans	-61.3	-45.5	176.8	171.9	0	0	0	0	110.8	A48 L49 H56	A48-V52 WeakPolarHBondContact O-CG2 3.44Å; A48-V52 PolarHBondContact O-N 3.42Å; L49-V52 PolarHBondContact O-N 3.07Å; V52-H56 PolarHBondContact O-CD2 3.44Å; V52-H56 PolarHBondContact O-N 3.49Å; V52-H56 VanDerWaalsContact O-N 3.13Å
53	H	85.6	Confident	86.7	Confident	122 Å²	122	92.9 Å²	92.9	57%	0.565	49%	0.494	S	S	*	.	H	α-helix	trans	-65.2	-43.3	179.9	-165.6	93.4	0	0	0	112.2	L49 F51 H56 L57	L49-H53 WeakPolarHBondContact O-CB 3.45Å; L49-H53 PolarHBondContact O-N 2.96Å; F51-H53 PolarHBondContact O-N 3.24Å; H53-H56 PolarHBondContact O-N 2.92Å; H53-L57 WeakPolarHBondContact O-CG 3.34Å; H53-L57 PolarHBondContact O-N 3.15Å; H53-L57 VanDerWaalsContact O-N 3.12Å
54	G	85.1	Confident	86.3	Confident	26 Å²	26	93.5 Å²	93.5	27%	0.268	50%	0.495	S	S	.	.	H	α-helix	trans	-60.1	-49.5	176.5	0	0	0	0	0	112.2	N50 F51 H56 L57 D58	N50-G54 PolarHBondContact O-N 2.9Å; F51-G54 PolarHBondContact O-N 3.18Å; G54-H56 PolarHBondContact O-N 3.23Å; G54-L57 PolarHBondContact O-N 3.45Å; G54-D58 PolarHBondContact O-N 2.94Å
55	N	79.6	Confident	85.9	Confident	61 Å²	61	92.4 Å²	92.4	33%	0.326	49%	0.493	S	S	.	.	H	α-helix	trans	-61.8	-41.2	-179.4	-66.1	-15.8	0	0	0	112.6	F51 D58 E59	F51-N55 WeakPolarHBondContact CE1-ND2 3.27Å; F51-N55 WeakPolarHBondContact CE2-ND2 3.47Å; F51-N55 WeakPolarHBondContact CZ-ND2 3.46Å; F51-N55 WeakPolarHBondContact O-CB 3.49Å; F51-N55 PolarHBondContact O-N 2.98Å; F51-N55 PolarHBondContact O-ND2 3.46Å; N55-D58 PolarHBondContact O-N 3.4Å; N55-E59 WeakPolarHBondContact O-CG 3.42Å; N55-E59 PolarHBondContact O-N 3.46Å
56	H	80.9	Confident	85.8	Confident	100 Å²	100	95.2 Å²	95.2	46%	0.463	50%	0.501	S	S	.	.	H	α-helix	trans	-66.9	-37.2	177.6	-72.2	-47.9	0	0	0	112.5	V52 H53 G54 D58 E59 I60	V52-H56 PolarHBondContact O-CD2 3.44Å; V52-H56 PolarHBondContact O-N 3.49Å; V52-H56 VanDerWaalsContact O-N 3.13Å; H53-H56 PolarHBondContact O-N 2.92Å; G54-H56 PolarHBondContact O-N 3.23Å; H56-D58 VanDerWaalsContact C-N 3.32Å; H56-E59 IonicContact ND1-OE2 3.71Å; H56-E59 PolarHBondContact O-N 3.17Å; H56-I60 WeakPolarHBondContact O-CD1 3.48Å; H56-I60 VanDerWaalsContact O-CG1 3.23Å; H56-I60 WeakPolarHBondContact O-CG1 3.37Å; H56-I60 PolarHBondContact O-N 2.78Å
57	L	79.9	Confident	85.5	Confident	94 Å²	94	99.5 Å²	99.5	49%	0.492	52%	0.521	S	S	.	.	H	α-helix	trans	-65.2	-38.3	173.7	-70.1	179.5	0	0	0	111.5	H53 G54 I60 K61	H53-L57 WeakPolarHBondContact O-CG 3.34Å; H53-L57 PolarHBondContact O-N 3.15Å; H53-L57 VanDerWaalsContact O-N 3.12Å; G54-L57 PolarHBondContact O-N 3.45Å; L57-I60 PolarHBondContact O-N 3.02Å; L57-K61 WeakPolarHBondContact O-CB 3.44Å; L57-K61 PolarHBondContact O-N 3.37Å
58	D	85.9	Confident	85.2	Confident	103 Å²	103	103.2 Å²	103.2	55%	0.551	55%	0.547	S	S	*	.	H	α-helix	trans	-66.7	-41.7	176.3	-70.1	-28.6	0	0	0	112.1	G54 N55 H56 K61 L62	G54-D58 PolarHBondContact O-N 2.94Å; N55-D58 PolarHBondContact O-N 3.4Å; H56-D58 VanDerWaalsContact C-N 3.32Å; D58-K61 PolarHBondContact O-N 2.97Å; D58-L62 WeakPolarHBondContact O-CB 3.42Å; D58-L62 PolarHBondContact O-N 3.2Å
59	E	79.5	Confident	85.1	Confident	121 Å²	121	105.6 Å²	105.6	57%	0.565	55%	0.551	S	S	*	*	H	α-helix	trans	-63.2	-40.8	174.8	-76	176.5	-178.9	0	0	112.3	N55 H56 S63	N55-E59 WeakPolarHBondContact O-CG 3.42Å; N55-E59 PolarHBondContact O-N 3.46Å; H56-E59 IonicContact ND1-OE2 3.71Å; H56-E59 PolarHBondContact O-N 3.17Å; E59-S63 WeakPolarHBondContact O-CB 3.41Å; E59-S63 PolarHBondContact O-N 3.17Å; E59-S63 PolarHBondContact O-OG 3.21Å
60	I	77	Confident	84.9	Confident	103 Å²	103	105.4 Å²	105.4	53%	0.528	55%	0.55	S	S	.	*	H	α-helix	trans	-64.9	-46.7	175.3	-69.3	166.1	0	0	0	110.1	H56 L57 L62 S63 V64	H56-I60 WeakPolarHBondContact O-CD1 3.48Å; H56-I60 VanDerWaalsContact O-CG1 3.23Å; H56-I60 WeakPolarHBondContact O-CG1 3.37Å; H56-I60 PolarHBondContact O-N 2.78Å; L57-I60 PolarHBondContact O-N 3.02Å; I60-L62 PolarHBondContact O-N 3.03Å; I60-S63 WeakPolarHBondContact O-CB 3.44Å; I60-S63 PolarHBondContact O-N 2.86Å; I60-S63 VanDerWaalsContact O-N 3.12Å; I60-V64 HydrophobicContact CG2-CG2 4.48Å; I60-V64 WeakPolarHBondContact O-CG2 3.45Å; I60-V64 PolarHBondContact O-N 2.93Å
61	K	84.9	Confident	84.8	Confident	133 Å²	133	105.6 Å²	105.6	58%	0.578	55%	0.55	S	S	*	*	H	α-helix	trans	-59.2	-46.3	178.3	-175.1	178.4	177.3	-175.2	0	111.6	L57 D58 S63 V64 D65	L57-K61 WeakPolarHBondContact O-CB 3.44Å; L57-K61 PolarHBondContact O-N 3.37Å; D58-K61 PolarHBondContact O-N 2.97Å; K61-S63 VanDerWaalsContact C-N 3.26Å; K61-S63 PolarHBondContact O-N 3.07Å; K61-V64 PolarHBondContact O-N 3.32Å; K61-D65 PolarHBondContact O-N 2.98Å
62	L	88.4	Confident	84.5	Confident	99 Å²	99	103.8 Å²	103.8	52%	0.518	55%	0.548	S	S	.	.	H	α-helix	trans	-61.2	-34.7	176.2	-176.3	67.3	0	0	0	112.5	D58 I60 K66	D58-L62 WeakPolarHBondContact O-CB 3.42Å; D58-L62 PolarHBondContact O-N 3.2Å; I60-L62 PolarHBondContact O-N 3.03Å; L62-K66 WeakPolarHBondContact O-CG 3.26Å; L62-K66 PolarHBondContact O-N 3.49Å
63	S	85.3	Confident	84.3	Confident	68 Å²	68	105.8 Å²	105.8	48%	0.476	56%	0.555	S	S	.	*	H	α-helix	trans	-71.6	-38.4	177.4	-58.9	0	0	0	0	112	E59 I60 K61 L67	E59-S63 WeakPolarHBondContact O-CB 3.41Å; E59-S63 PolarHBondContact O-N 3.17Å; E59-S63 PolarHBondContact O-OG 3.21Å; I60-S63 WeakPolarHBondContact O-CB 3.44Å; I60-S63 PolarHBondContact O-N 2.86Å; I60-S63 VanDerWaalsContact O-N 3.12Å; K61-S63 VanDerWaalsContact C-N 3.26Å; K61-S63 PolarHBondContact O-N 3.07Å; S63-L67 WeakPolarHBondContact O-CG 3.42Å
64	V	86.2	Confident	84.2	Confident	76 Å²	76	104.7 Å²	104.7	46%	0.461	55%	0.554	S	S	.	*	H	α-helix	trans	-68.1	-42.8	174.6	173.6	0	0	0	0	111.4	I60 K61 K66 L67 V68	I60-V64 HydrophobicContact CG2-CG2 4.48Å; I60-V64 WeakPolarHBondContact O-CG2 3.45Å; I60-V64 PolarHBondContact O-N 2.93Å; K61-V64 PolarHBondContact O-N 3.32Å; V64-K66 PolarHBondContact O-N 3.11Å; V64-L67 WeakPolarHBondContact O-CB 3.3Å; V64-L67 PolarHBondContact O-N 3.13Å; V64-V68 PolarHBondContact O-N 2.86Å
65	D	88.5	Confident	84.1	Confident	101 Å²	101	110.3 Å²	110.3	54%	0.54	57%	0.574	S	S	.	*	H	α-helix	trans	-62.6	-23.1	178.9	-72.4	-17.1	0	0	0	113.1	K61	K61-D65 PolarHBondContact O-N 2.98Å
66	K	90.7	Very high	84.5	Confident	160 Å²	160	114.1 Å²	114.1	70%	0.696	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.9	-18.2	174.1	-72.5	174.8	-177.1	175.2	0	113.9	L62 V64	L62-K66 WeakPolarHBondContact O-CG 3.26Å; L62-K66 PolarHBondContact O-N 3.49Å; V64-K66 PolarHBondContact O-N 3.11Å
67	L	87	Confident	84.8	Confident	151 Å²	151	115.3 Å²	115.3	79%	0.791	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.7	-23	-177.7	-77.4	164.6	0	0	0	112.7	S63 V64	S63-L67 WeakPolarHBondContact O-CG 3.42Å; V64-L67 WeakPolarHBondContact O-CB 3.3Å; V64-L67 PolarHBondContact O-N 3.13Å
68	V	84	Confident	85.2	Confident	174 Å²	174	117.2 Å²	117.2	100%	1.055	61%	0.614	S	S	*	*			trans	-90.8	0	177.5	-179.3	0	0	0	0	110.2	V64	V64-V68 PolarHBondContact O-N 2.86Å

Retrieved 68 of 68 residues in 38.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).