A0A5K4F8Y6_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F8Y6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 67 aa.

						>A0A5K4F8Y6_SCHMA|A0A5K4F8Y6
MKYYLEEEEEEEDEEEKKKTVKTEILTSSLYKRKLLILIKLVILYILFVIFDNSIHMHICLGIISYK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.9	Low	69.5	Low	200 Å²	200	141.5 Å²	141.5	99%	0.985	64%	0.642	S	S	*	*				0	-11.4	0	-148.8	162.4	176.3	0	0	113.5
2	K	59.3	Low	70.2	Confident	154 Å²	154	141.6 Å²	141.6	67%	0.67	65%	0.645	S	S	*	*			trans	-81.8	-42.2	175.3	-155.3	-179.6	177	-165.6	0	113.4	Y4 L5	K2-Y4 VanDerWaalsContact C-N 3.34Å; K2-Y4 PolarHBondContact O-N 3.29Å; K2-L5 PolarHBondContact O-N 3.25Å
3	Y	63.8	Low	71.2	Confident	184 Å²	184	136.4 Å²	136.4	72%	0.722	63%	0.625	S	S	*	*	H	α-helix	trans	-59.2	-38.5	179.8	-68.9	-75.6	0	0	0	114.3	L5 E6 E7	Y3-L5 VanDerWaalsContact C-N 3.27Å; Y3-L5 PolarHBondContact O-N 3.34Å; Y3-E6 PolarHBondContact O-N 3.36Å; Y3-E7 PolarHBondContact O-N 2.85Å
4	Y	65.7	Low	72.2	Confident	164 Å²	164	134.4 Å²	134.4	64%	0.643	62%	0.617	S	S	*	*	H	α-helix	trans	-64.2	-29.9	-179.4	-62.6	-69.4	0	0	0	113.6	K2 E8	K2-Y4 VanDerWaalsContact C-N 3.34Å; K2-Y4 PolarHBondContact O-N 3.29Å; Y4-E8 WeakPolarHBondContact O-CG 3.43Å; Y4-E8 PolarHBondContact O-N 3.31Å
5	L	69.6	Low	73	Confident	99 Å²	99	132.7 Å²	132.7	52%	0.518	61%	0.61	S	S	.	*	H	α-helix	trans	-74.3	-35.6	179.5	-69.7	170.8	0	0	0	111.9	K2 Y3 E8 E9	K2-L5 PolarHBondContact O-N 3.25Å; Y3-L5 VanDerWaalsContact C-N 3.27Å; Y3-L5 PolarHBondContact O-N 3.34Å; L5-E8 PolarHBondContact O-N 3.06Å; L5-E9 WeakPolarHBondContact O-CG 3.41Å; L5-E9 PolarHBondContact O-N 3.46Å
6	E	72.8	Confident	73.9	Confident	95 Å²	95	132.1 Å²	132.1	44%	0.444	61%	0.608	S	S	.	*	H	α-helix	trans	-67.8	-38.3	179.3	-68.4	171	-171.2	0	0	110.8	Y3 E10	Y3-E6 PolarHBondContact O-N 3.36Å; E6-E10 WeakPolarHBondContact O-CG 3.49Å; E6-E10 PolarHBondContact O-N 3.3Å; E6-E10 VanDerWaalsContact O-N 3.11Å
7	E	73.2	Confident	74.7	Confident	121 Å²	121	131 Å²	131	57%	0.565	60%	0.601	S	S	*	*	H	α-helix	trans	-66.1	-41.7	175	-69.3	177.1	177.5	0	0	112.3	Y3 E10 E11	Y3-E7 PolarHBondContact O-N 2.85Å; E7-E10 PolarHBondContact O-N 3.08Å; E7-E11 WeakPolarHBondContact O-CG 3.41Å; E7-E11 PolarHBondContact O-N 3.07Å; E7-E11 VanDerWaalsContact O-N 3.08Å
8	E	74.5	Confident	75.4	Confident	120 Å²	120	129.9 Å²	129.9	56%	0.561	60%	0.595	S	S	*	*	H	α-helix	trans	-64.3	-41.6	176.8	-73.8	177.1	-179.7	0	0	112.1	Y4 L5 E11 E12	Y4-E8 WeakPolarHBondContact O-CG 3.43Å; Y4-E8 PolarHBondContact O-N 3.31Å; L5-E8 PolarHBondContact O-N 3.06Å; E8-E11 PolarHBondContact O-N 3.1Å; E8-E12 WeakPolarHBondContact O-CG 3.48Å; E8-E12 PolarHBondContact O-N 3.11Å; E8-E12 VanDerWaalsContact O-N 3.1Å
9	E	75.5	Confident	76	Confident	136 Å²	136	129.3 Å²	129.3	64%	0.636	59%	0.59	S	S	*	*	H	α-helix	trans	-65.3	-38.8	177	-74.3	-180	-173.2	0	0	112.4	L5 D13	L5-E9 WeakPolarHBondContact O-CG 3.41Å; L5-E9 PolarHBondContact O-N 3.46Å; E9-D13 PolarHBondContact O-N 3.45Å; E9-D13 VanDerWaalsContact O-N 3.13Å
10	E	76.1	Confident	76.6	Confident	141 Å²	141	126 Å²	126	66%	0.659	58%	0.58	S	S	*	*	H	α-helix	trans	-67.8	-40.5	176.8	-75.3	-176.1	-177	0	0	112.3	E6 E7 E14	E6-E10 WeakPolarHBondContact O-CG 3.49Å; E6-E10 PolarHBondContact O-N 3.3Å; E6-E10 VanDerWaalsContact O-N 3.11Å; E7-E10 PolarHBondContact O-N 3.08Å; E10-E14 PolarHBondContact O-N 3.42Å
11	E	76.9	Confident	77.1	Confident	142 Å²	142	123.7 Å²	123.7	66%	0.664	58%	0.575	S	S	*	*	H	α-helix	trans	-64.4	-40.9	175.7	-74.1	-170.9	-179.9	0	0	112.1	E7 E8 E14 E15	E7-E11 WeakPolarHBondContact O-CG 3.41Å; E7-E11 PolarHBondContact O-N 3.07Å; E7-E11 VanDerWaalsContact O-N 3.08Å; E8-E11 PolarHBondContact O-N 3.1Å; E11-E14 PolarHBondContact O-N 3.38Å; E11-E15 PolarHBondContact O-N 2.95Å
12	E	78.6	Confident	78.6	Confident	143 Å²	143	120.9 Å²	120.9	67%	0.668	56%	0.557	S	S	*	*	H	α-helix	trans	-64.1	-44.3	176.6	-75.7	-169.9	178	0	0	112.5	E8 E14 E15 E16	E8-E12 WeakPolarHBondContact O-CG 3.48Å; E8-E12 PolarHBondContact O-N 3.11Å; E8-E12 VanDerWaalsContact O-N 3.1Å; E12-E14 PolarHBondContact O-N 2.93Å; E12-E15 PolarHBondContact O-N 3.26Å; E12-E16 PolarHBondContact O-N 3.5Å
13	D	83	Confident	79.9	Confident	74 Å²	74	117.5 Å²	117.5	40%	0.396	55%	0.55	S	S	.	.	H	α-helix	trans	-64.2	-39.6	177.4	179.2	46.8	0	0	0	111.7	E9 E16 K17	E9-D13 PolarHBondContact O-N 3.45Å; E9-D13 VanDerWaalsContact O-N 3.13Å; D13-E16 PolarHBondContact O-N 3.45Å; D13-K17 WeakPolarHBondContact O-CB 3.3Å; D13-K17 VanDerWaalsContact O-CG 3.29Å; D13-K17 WeakPolarHBondContact O-CG 3.29Å; D13-K17 PolarHBondContact O-N 2.6Å; D13-K17 WeakPolarHBondContact OD1-CE 3.43Å; D13-K17 IonicContact OD1-NZ 3.72Å; D13-K17 WeakPolarHBondContact OD2-CE 3.21Å; D13-K17 IonicContact OD2-NZ 2.6Å; D13-K17 PolarHBondContact OD2-NZ 2.9Å
14	E	84.6	Confident	81.1	Confident	109 Å²	109	115 Å²	115	51%	0.509	54%	0.544	S	S	.	.	H	α-helix	trans	-62.3	-42.4	173.1	-84.8	-154	-170.5	0	0	113.1	E10 E11 E12 K18	E10-E14 PolarHBondContact O-N 3.42Å; E11-E14 PolarHBondContact O-N 3.38Å; E12-E14 PolarHBondContact O-N 2.93Å; E14-K18 WeakPolarHBondContact O-CD 3.4Å; E14-K18 VanDerWaalsContact O-CG 3.29Å; E14-K18 WeakPolarHBondContact O-CG 3.42Å; E14-K18 PolarHBondContact O-N 3.26Å; E14-K18 IonicContact OE2-NZ 2.85Å; E14-K18 PolarHBondContact OE2-NZ 3.5Å
15	E	85.1	Confident	82.1	Confident	108 Å²	108	111.8 Å²	111.8	51%	0.505	54%	0.537	S	S	.	.	H	α-helix	trans	-64.4	-42.3	175.9	-79.7	-155.1	174.1	0	0	112.2	E11 E12 K18 K19	E11-E15 PolarHBondContact O-N 2.95Å; E12-E15 PolarHBondContact O-N 3.26Å; E15-K18 PolarHBondContact O-N 3.02Å; E15-K19 VanDerWaalsContact O-CG 3.29Å; E15-K19 WeakPolarHBondContact O-CG 3.46Å; E15-K19 PolarHBondContact O-N 3.04Å; E15-K19 IonicContact OE2-NZ 2.9Å; E15-K19 PolarHBondContact OE2-NZ 3.34Å
16	E	86.8	Confident	82.9	Confident	124 Å²	124	112.5 Å²	112.5	58%	0.579	54%	0.541	S	S	*	.	H	α-helix	trans	-63.1	-46	177.6	-171.7	171.3	-174.5	0	0	110.8	E12 D13 K18 K19 T20	E12-E16 PolarHBondContact O-N 3.5Å; D13-E16 PolarHBondContact O-N 3.45Å; E16-K18 VanDerWaalsContact C-N 3.29Å; E16-K18 PolarHBondContact O-N 3.15Å; E16-K19 CarbonylContact O-C 3.57Å; E16-K19 WeakPolarHBondContact O-CA 3.26Å; E16-K19 WeakPolarHBondContact O-CB 3.45Å; E16-K19 PolarHBondContact O-N 3.25Å; E16-T20 HydrophobicContact CG-CG2 4.4Å; E16-T20 WeakPolarHBondContact O-CG2 3.29Å; E16-T20 PolarHBondContact O-N 3.48Å; E16-T20 PolarHBondContact O-OG1 3Å
17	K	86.6	Confident	83.6	Confident	113 Å²	113	111.8 Å²	111.8	49%	0.491	54%	0.543	S	S	.	.	H	α-helix	trans	-55.9	-41.4	172.9	-75.1	168.2	178.8	164.1	0	112.4	D13 K19 T20 V21	D13-K17 WeakPolarHBondContact O-CB 3.3Å; D13-K17 VanDerWaalsContact O-CG 3.29Å; D13-K17 WeakPolarHBondContact O-CG 3.29Å; D13-K17 PolarHBondContact O-N 2.6Å; D13-K17 WeakPolarHBondContact OD1-CE 3.43Å; D13-K17 IonicContact OD1-NZ 3.72Å; D13-K17 WeakPolarHBondContact OD2-CE 3.21Å; D13-K17 IonicContact OD2-NZ 2.6Å; D13-K17 PolarHBondContact OD2-NZ 2.9Å; K17-K19 VanDerWaalsContact C-N 3.34Å; K17-K19 PolarHBondContact O-N 2.95Å; K17-T20 WeakPolarHBondContact CA-OG1 3.29Å; K17-T20 PolarHBondContact O-OG1 3.13Å; K17-V21 VanDerWaalsContact O-CG2 3.3Å; K17-V21 WeakPolarHBondContact O-CG2 3.42Å; K17-V21 PolarHBondContact O-N 2.9Å; K17-V21 VanDerWaalsContact O-N 3.15Å
18	K	87.8	Confident	84.2	Confident	112 Å²	112	108.6 Å²	108.6	49%	0.487	53%	0.534	S	S	.	.	H	α-helix	trans	-66.3	-36.2	175.6	-71.6	162.6	-169.1	152.9	0	111.5	E14 E15 E16 K22	E14-K18 WeakPolarHBondContact O-CD 3.4Å; E14-K18 VanDerWaalsContact O-CG 3.29Å; E14-K18 WeakPolarHBondContact O-CG 3.42Å; E14-K18 PolarHBondContact O-N 3.26Å; E14-K18 IonicContact OE2-NZ 2.85Å; E14-K18 PolarHBondContact OE2-NZ 3.5Å; E15-K18 PolarHBondContact O-N 3.02Å; E16-K18 VanDerWaalsContact C-N 3.29Å; E16-K18 PolarHBondContact O-N 3.15Å; K18-K22 VanDerWaalsContact O-CG 3.26Å; K18-K22 WeakPolarHBondContact O-CG 3.45Å; K18-K22 PolarHBondContact O-N 3.41Å
19	K	87.9	Confident	84.7	Confident	117 Å²	117	105.1 Å²	105.1	51%	0.509	52%	0.523	S	S	.	.	H	α-helix	trans	-70.4	-40.9	177.2	-71.1	163.2	-170.4	155.7	0	111.9	E15 E16 K17 K22 T23	E15-K19 VanDerWaalsContact O-CG 3.29Å; E15-K19 WeakPolarHBondContact O-CG 3.46Å; E15-K19 PolarHBondContact O-N 3.04Å; E15-K19 IonicContact OE2-NZ 2.9Å; E15-K19 PolarHBondContact OE2-NZ 3.34Å; E16-K19 CarbonylContact O-C 3.57Å; E16-K19 WeakPolarHBondContact O-CA 3.26Å; E16-K19 WeakPolarHBondContact O-CB 3.45Å; E16-K19 PolarHBondContact O-N 3.25Å; K17-K19 VanDerWaalsContact C-N 3.34Å; K17-K19 PolarHBondContact O-N 2.95Å; K19-K22 PolarHBondContact O-N 3.5Å; K19-T23 WeakPolarHBondContact O-CB 3.24Å; K19-T23 PolarHBondContact O-N 3.38Å; K19-T23 PolarHBondContact O-OG1 3.32Å
20	T	87.2	Confident	85.1	Confident	64 Å²	64	103.2 Å²	103.2	39%	0.393	52%	0.517	S	S	.	.	H	α-helix	trans	-65.2	-48.3	177.8	54.7	0	0	0	0	111.5	E16 K17 K22 T23 E24	E16-T20 HydrophobicContact CG-CG2 4.4Å; E16-T20 WeakPolarHBondContact O-CG2 3.29Å; E16-T20 PolarHBondContact O-N 3.48Å; E16-T20 PolarHBondContact O-OG1 3Å; K17-T20 WeakPolarHBondContact CA-OG1 3.29Å; K17-T20 PolarHBondContact O-OG1 3.13Å; T20-K22 VanDerWaalsContact C-N 3.33Å; T20-K22 PolarHBondContact O-N 3.04Å; T20-T23 WeakPolarHBondContact O-CA 3.47Å; T20-T23 WeakPolarHBondContact O-CB 3.32Å; T20-T23 PolarHBondContact O-N 3.41Å; T20-E24 PolarHBondContact O-N 3.01Å
21	V	87.7	Confident	85.7	Confident	77 Å²	77	104 Å²	104	47%	0.467	52%	0.515	S	S	.	.	H	α-helix	trans	-58.1	-44.1	176.7	173.4	0	0	0	0	111.6	K17 T23 E24 I25	K17-V21 VanDerWaalsContact O-CG2 3.3Å; K17-V21 WeakPolarHBondContact O-CG2 3.42Å; K17-V21 PolarHBondContact O-N 2.9Å; K17-V21 VanDerWaalsContact O-N 3.15Å; V21-T23 VanDerWaalsContact C-N 3.31Å; V21-T23 PolarHBondContact O-N 2.84Å; V21-E24 PolarHBondContact O-N 3.32Å; V21-I25 HydrophobicContact CG1-CD1 3.79Å; V21-I25 WeakPolarHBondContact O-CD1 3.49Å; V21-I25 VanDerWaalsContact O-CG1 3.24Å; V21-I25 WeakPolarHBondContact O-CG1 3.5Å; V21-I25 PolarHBondContact O-N 2.83Å
22	K	87.5	Confident	86.2	Confident	142 Å²	142	103.7 Å²	103.7	62%	0.617	51%	0.511	S	S	*	.	H	α-helix	trans	-60.7	-40.9	175.4	-75.3	174.4	-177.2	176.9	0	111.9	K18 K19 T20 I25 L26	K18-K22 VanDerWaalsContact O-CG 3.26Å; K18-K22 WeakPolarHBondContact O-CG 3.45Å; K18-K22 PolarHBondContact O-N 3.41Å; K19-K22 PolarHBondContact O-N 3.5Å; T20-K22 VanDerWaalsContact C-N 3.33Å; T20-K22 PolarHBondContact O-N 3.04Å; K22-I25 PolarHBondContact O-N 3.02Å; K22-L26 VanDerWaalsContact O-CG 3.32Å; K22-L26 WeakPolarHBondContact O-CG 3.28Å; K22-L26 PolarHBondContact O-N 3.07Å
23	T	86.6	Confident	86.9	Confident	83 Å²	83	105.1 Å²	105.1	51%	0.509	51%	0.511	S	S	.	.	H	α-helix	trans	-65.7	-42.4	179.2	-57.6	0	0	0	0	111.8	K19 T20 V21 I25 L26 T27	K19-T23 WeakPolarHBondContact O-CB 3.24Å; K19-T23 PolarHBondContact O-N 3.38Å; K19-T23 PolarHBondContact O-OG1 3.32Å; T20-T23 WeakPolarHBondContact O-CA 3.47Å; T20-T23 WeakPolarHBondContact O-CB 3.32Å; T20-T23 PolarHBondContact O-N 3.41Å; V21-T23 VanDerWaalsContact C-N 3.31Å; V21-T23 PolarHBondContact O-N 2.84Å; T23-I25 PolarHBondContact O-N 3.03Å; T23-L26 PolarHBondContact O-N 3.45Å; T23-T27 HydrophobicContact CG2-CG2 4.34Å; T23-T27 WeakPolarHBondContact O-CB 3.33Å; T23-T27 VanDerWaalsContact O-CG2 3.28Å; T23-T27 WeakPolarHBondContact O-CG2 3.46Å; T23-T27 PolarHBondContact O-N 2.92Å; T23-T27 PolarHBondContact O-OG1 2.95Å
24	E	88.7	Confident	87.2	Confident	131 Å²	131	108.4 Å²	108.4	61%	0.612	52%	0.522	S	S	*	.	H	α-helix	trans	-64	-39.7	175.6	-69.3	-178.2	175.1	0	0	112.5	T20 V21 T27 S28	T20-E24 PolarHBondContact O-N 3.01Å; V21-E24 PolarHBondContact O-N 3.32Å; E24-T27 WeakPolarHBondContact CA-OG1 3.42Å; E24-T27 PolarHBondContact O-OG1 3.35Å; E24-S28 VanDerWaalsContact O-CB 3.28Å; E24-S28 WeakPolarHBondContact O-CB 3.49Å; E24-S28 PolarHBondContact O-N 2.94Å; E24-S28 PolarHBondContact O-OG 3.27Å
25	I	86.3	Confident	87.4	Confident	97 Å²	97	106.6 Å²	106.6	50%	0.497	52%	0.515	S	S	.	.	H	α-helix	trans	-65	-42.8	176	-66.9	165.7	0	0	0	111	V21 K22 T23 S28 S29	V21-I25 HydrophobicContact CG1-CD1 3.79Å; V21-I25 WeakPolarHBondContact O-CD1 3.49Å; V21-I25 VanDerWaalsContact O-CG1 3.24Å; V21-I25 WeakPolarHBondContact O-CG1 3.5Å; V21-I25 PolarHBondContact O-N 2.83Å; K22-I25 PolarHBondContact O-N 3.02Å; T23-I25 PolarHBondContact O-N 3.03Å; I25-S28 PolarHBondContact O-OG 2.96Å; I25-S29 VanDerWaalsContact O-CB 3.32Å; I25-S29 WeakPolarHBondContact O-CB 3.45Å; I25-S29 PolarHBondContact O-N 2.78Å; I25-S29 VanDerWaalsContact O-N 3.08Å; I25-S29 PolarHBondContact O-OG 3.08Å
26	L	86.6	Confident	87.8	Confident	114 Å²	114	106.6 Å²	106.6	60%	0.597	52%	0.518	S	S	*	.	H	α-helix	trans	-67.2	-45.8	177.8	-71.7	172.8	0	0	0	111.7	K22 T23 S29 L30	K22-L26 VanDerWaalsContact O-CG 3.32Å; K22-L26 WeakPolarHBondContact O-CG 3.28Å; K22-L26 PolarHBondContact O-N 3.07Å; T23-L26 PolarHBondContact O-N 3.45Å; L26-S29 WeakPolarHBondContact O-CB 3.33Å; L26-S29 PolarHBondContact O-N 3.19Å; L26-L30 WeakPolarHBondContact O-CG 3.37Å; L26-L30 PolarHBondContact O-N 2.89Å
27	T	88.6	Confident	88.2	Confident	80 Å²	80	105.7 Å²	105.7	49%	0.491	52%	0.516	S	S	.	.	H	α-helix	trans	-64.3	-44.2	179.9	51.7	0	0	0	0	111.9	T23 E24 S29 L30 Y31	T23-T27 HydrophobicContact CG2-CG2 4.34Å; T23-T27 WeakPolarHBondContact O-CB 3.33Å; T23-T27 VanDerWaalsContact O-CG2 3.28Å; T23-T27 WeakPolarHBondContact O-CG2 3.46Å; T23-T27 PolarHBondContact O-N 2.92Å; T23-T27 PolarHBondContact O-OG1 2.95Å; E24-T27 WeakPolarHBondContact CA-OG1 3.42Å; E24-T27 PolarHBondContact O-OG1 3.35Å; T27-S29 VanDerWaalsContact C-N 3.32Å; T27-S29 PolarHBondContact O-N 3.42Å; T27-L30 PolarHBondContact O-N 2.91Å; T27-Y31 PolarHBondContact O-N 3.24Å
28	S	85.8	Confident	88.5	Confident	53 Å²	53	105.4 Å²	105.4	37%	0.371	52%	0.519	S	S	.	.	H	α-helix	trans	-61.7	-39.4	175.1	63.9	0	0	0	0	112.2	E24 I25 Y31 K32	E24-S28 VanDerWaalsContact O-CB 3.28Å; E24-S28 WeakPolarHBondContact O-CB 3.49Å; E24-S28 PolarHBondContact O-N 2.94Å; E24-S28 PolarHBondContact O-OG 3.27Å; I25-S28 PolarHBondContact O-OG 2.96Å; S28-Y31 PolarHBondContact O-N 2.95Å; S28-K32 WeakPolarHBondContact O-CG 3.32Å; S28-K32 PolarHBondContact O-N 3.01Å; S28-K32 VanDerWaalsContact O-N 3.07Å
29	S	84.3	Confident	88.9	Confident	48 Å²	48	103.9 Å²	103.9	34%	0.336	52%	0.516	S	S	.	.	H	α-helix	trans	-64	-42.8	175.7	-64	0	0	0	0	112.4	I25 L26 T27 R33	I25-S29 VanDerWaalsContact O-CB 3.32Å; I25-S29 WeakPolarHBondContact O-CB 3.45Å; I25-S29 PolarHBondContact O-N 2.78Å; I25-S29 VanDerWaalsContact O-N 3.08Å; I25-S29 PolarHBondContact O-OG 3.08Å; L26-S29 WeakPolarHBondContact O-CB 3.33Å; L26-S29 PolarHBondContact O-N 3.19Å; T27-S29 VanDerWaalsContact C-N 3.32Å; T27-S29 PolarHBondContact O-N 3.42Å; S29-R33 WeakPolarHBondContact O-CG 3.28Å; S29-R33 PolarHBondContact O-N 3.29Å
30	L	84.1	Confident	89.2	Confident	95 Å²	95	105.2 Å²	105.2	50%	0.497	52%	0.521	S	S	.	.	H	α-helix	trans	-66.9	-40.4	177.1	-69.3	173.6	0	0	0	112.1	L26 T27 R33 K34	L26-L30 WeakPolarHBondContact O-CG 3.37Å; L26-L30 PolarHBondContact O-N 2.89Å; T27-L30 PolarHBondContact O-N 2.91Å; L30-R33 PolarHBondContact O-N 3.27Å; L30-K34 WeakPolarHBondContact O-CG 3.3Å; L30-K34 PolarHBondContact O-N 2.87Å
31	Y	88.4	Confident	89.6	Confident	157 Å²	157	107.1 Å²	107.1	62%	0.616	53%	0.529	S	S	*	.	H	α-helix	trans	-61	-46.8	176.2	-179	-98.1	0	0	0	111.5	T27 S28 R33 K34 L35	T27-Y31 PolarHBondContact O-N 3.24Å; S28-Y31 PolarHBondContact O-N 2.95Å; Y31-R33 VanDerWaalsContact C-N 3.34Å; Y31-R33 PolarHBondContact O-N 3Å; Y31-K34 PolarHBondContact O-N 2.94Å; Y31-L35 HydrophobicContact CE1-CD2 3.97Å; Y31-L35 VanDerWaalsContact O-CB 3.3Å; Y31-L35 WeakPolarHBondContact O-CB 3.3Å; Y31-L35 PolarHBondContact O-N 3.46Å
32	K	88.1	Confident	90	Very high	136 Å²	136	107.7 Å²	107.7	59%	0.591	53%	0.532	S	S	*	.	H	α-helix	trans	-57.3	-45	176.2	-73.2	174.4	-177.7	177	0	112	S28 L35 L36	S28-K32 WeakPolarHBondContact O-CG 3.32Å; S28-K32 PolarHBondContact O-N 3.01Å; S28-K32 VanDerWaalsContact O-N 3.07Å; K32-L35 PolarHBondContact O-N 3.1Å; K32-L36 VanDerWaalsContact O-CG 3.3Å; K32-L36 WeakPolarHBondContact O-CG 3.43Å; K32-L36 PolarHBondContact O-N 3.49Å; K32-L36 VanDerWaalsContact O-N 3.1Å
33	R	92	Very high	90.4	Very high	174 Å²	174	105.2 Å²	105.2	66%	0.657	52%	0.524	S	S	*	.	H	α-helix	trans	-62.6	-47.1	177.5	-70.7	-179.2	-170.8	178.3	3.7	112	S29 L30 Y31 L36 I37	S29-R33 WeakPolarHBondContact O-CG 3.28Å; S29-R33 PolarHBondContact O-N 3.29Å; L30-R33 PolarHBondContact O-N 3.27Å; Y31-R33 VanDerWaalsContact C-N 3.34Å; Y31-R33 PolarHBondContact O-N 3Å; R33-L36 PolarHBondContact O-N 3.38Å; R33-I37 WeakPolarHBondContact O-CG1 3.34Å; R33-I37 PolarHBondContact O-N 3.34Å
34	K	90.2	Very high	90.7	Very high	143 Å²	143	106.5 Å²	106.5	62%	0.622	53%	0.528	S	S	*	.	H	α-helix	trans	-62.8	-43.9	178.4	-73.1	-179	179.1	-178.7	0	111.9	L30 Y31 L36 I37 L38	L30-K34 WeakPolarHBondContact O-CG 3.3Å; L30-K34 PolarHBondContact O-N 2.87Å; Y31-K34 PolarHBondContact O-N 2.94Å; K34-L36 PolarHBondContact O-N 3.46Å; K34-I37 PolarHBondContact O-N 3.24Å; K34-L38 WeakPolarHBondContact O-CG 3.47Å; K34-L38 PolarHBondContact O-N 3.38Å
35	L	89.9	Confident	91.1	Very high	70 Å²	70	107.7 Å²	107.7	37%	0.366	53%	0.528	S	S	.	.	H	α-helix	trans	-60.4	-45.3	179.3	-177.8	62.5	0	0	0	111.8	Y31 K32 I37 L38 I39	Y31-L35 HydrophobicContact CE1-CD2 3.97Å; Y31-L35 VanDerWaalsContact O-CB 3.3Å; Y31-L35 WeakPolarHBondContact O-CB 3.3Å; Y31-L35 PolarHBondContact O-N 3.46Å; K32-L35 PolarHBondContact O-N 3.1Å; L35-I37 VanDerWaalsContact C-N 3.31Å; L35-I37 PolarHBondContact O-N 3.07Å; L35-L38 PolarHBondContact O-N 3.23Å; L35-I39 HydrophobicContact CD1-CD1 4.31Å; L35-I39 HydrophobicContact CG-CD1 4Å; L35-I39 WeakPolarHBondContact O-CG1 3.31Å; L35-I39 PolarHBondContact O-N 3.17Å
36	L	92.1	Very high	91.5	Very high	109 Å²	109	107.3 Å²	107.3	57%	0.571	53%	0.526	S	S	*	.	H	α-helix	trans	-62.1	-36.8	177.4	-71.2	172.5	0	0	0	112.8	K32 R33 K34 K40	K32-L36 VanDerWaalsContact O-CG 3.3Å; K32-L36 WeakPolarHBondContact O-CG 3.43Å; K32-L36 PolarHBondContact O-N 3.49Å; K32-L36 VanDerWaalsContact O-N 3.1Å; R33-L36 PolarHBondContact O-N 3.38Å; K34-L36 PolarHBondContact O-N 3.46Å; L36-K40 WeakPolarHBondContact O-CG 3.27Å; L36-K40 PolarHBondContact O-N 2.99Å; L36-K40 VanDerWaalsContact O-N 3.17Å
37	I	94.6	Very high	91.6	Very high	105 Å²	105	106.8 Å²	106.8	54%	0.538	52%	0.523	S	S	.	.	H	α-helix	trans	-64.6	-46.7	175.9	-66.3	164.1	0	0	0	110.3	R33 K34 L35 I39 K40 L41	R33-I37 WeakPolarHBondContact O-CG1 3.34Å; R33-I37 PolarHBondContact O-N 3.34Å; K34-I37 PolarHBondContact O-N 3.24Å; L35-I37 VanDerWaalsContact C-N 3.31Å; L35-I37 PolarHBondContact O-N 3.07Å; I37-I39 VanDerWaalsContact C-N 3.34Å; I37-I39 PolarHBondContact O-N 3.44Å; I37-K40 PolarHBondContact O-N 2.93Å; I37-L41 HydrophobicContact CG2-CD1 4.48Å; I37-L41 PolarHBondContact O-N 3.44Å; I37-L41 VanDerWaalsContact O-N 3.15Å
38	L	93.5	Very high	91.8	Very high	107 Å²	107	108.8 Å²	108.8	56%	0.56	53%	0.525	S	S	*	.	H	α-helix	trans	-60.4	-43.9	178.4	-69.1	172.7	0	0	0	111.8	K34 L35 K40 L41 V42	K34-L38 WeakPolarHBondContact O-CG 3.47Å; K34-L38 PolarHBondContact O-N 3.38Å; L35-L38 PolarHBondContact O-N 3.23Å; L38-K40 VanDerWaalsContact C-N 3.31Å; L38-K40 PolarHBondContact O-N 3.49Å; L38-L41 PolarHBondContact O-N 3.11Å; L38-V42 WeakPolarHBondContact O-CG2 3.46Å; L38-V42 PolarHBondContact O-N 3Å; L38-V42 VanDerWaalsContact O-N 3.11Å
39	I	96.6	Very high	91.9	Very high	80 Å²	80	108.7 Å²	108.7	41%	0.41	52%	0.522	S	S	.	.	H	α-helix	trans	-59	-43.3	177.5	-69.1	166.3	0	0	0	111	L35 I37 L41 V42 I43	L35-I39 HydrophobicContact CD1-CD1 4.31Å; L35-I39 HydrophobicContact CG-CD1 4Å; L35-I39 WeakPolarHBondContact O-CG1 3.31Å; L35-I39 PolarHBondContact O-N 3.17Å; I37-I39 VanDerWaalsContact C-N 3.34Å; I37-I39 PolarHBondContact O-N 3.44Å; I39-L41 VanDerWaalsContact C-N 3.35Å; I39-L41 PolarHBondContact O-N 3.3Å; I39-V42 PolarHBondContact O-N 3.19Å; I39-I43 HydrophobicContact CG2-CD1 3.7Å; I39-I43 HydrophobicContact CG2-CG1 4.38Å; I39-I43 VanDerWaalsContact O-CG1 3.31Å; I39-I43 WeakPolarHBondContact O-CG1 3.49Å; I39-I43 PolarHBondContact O-N 3.15Å
40	K	94.4	Very high	92.1	Very high	144 Å²	144	111.5 Å²	111.5	63%	0.626	53%	0.532	S	S	*	.	H	α-helix	trans	-61.4	-41.6	177.3	-73.2	-178.8	-179.9	-174.1	0	112.5	L36 I37 L38 V42 I43 L44	L36-K40 WeakPolarHBondContact O-CG 3.27Å; L36-K40 PolarHBondContact O-N 2.99Å; L36-K40 VanDerWaalsContact O-N 3.17Å; I37-K40 PolarHBondContact O-N 2.93Å; L38-K40 VanDerWaalsContact C-N 3.31Å; L38-K40 PolarHBondContact O-N 3.49Å; K40-V42 VanDerWaalsContact C-N 3.34Å; K40-V42 PolarHBondContact O-N 3.38Å; K40-I43 PolarHBondContact O-N 3.43Å; K40-L44 WeakPolarHBondContact O-CB 3.33Å; K40-L44 VanDerWaalsContact O-CG 3.27Å; K40-L44 WeakPolarHBondContact O-CG 3.26Å; K40-L44 PolarHBondContact O-N 3.23Å
41	L	95.5	Very high	92.2	Very high	105 Å²	105	113 Å²	113	55%	0.55	54%	0.535	S	S	.	.	H	α-helix	trans	-62.6	-41.8	178	-68.5	173.3	0	0	0	111.7	I37 L38 I39 L44 Y45	I37-L41 HydrophobicContact CG2-CD1 4.48Å; I37-L41 PolarHBondContact O-N 3.44Å; I37-L41 VanDerWaalsContact O-N 3.15Å; L38-L41 PolarHBondContact O-N 3.11Å; I39-L41 VanDerWaalsContact C-N 3.35Å; I39-L41 PolarHBondContact O-N 3.3Å; L41-L44 PolarHBondContact O-N 3.25Å; L41-Y45 WeakPolarHBondContact O-CB 3.41Å; L41-Y45 PolarHBondContact O-N 3.43Å
42	V	96.3	Very high	92	Very high	88 Å²	88	109.3 Å²	109.3	53%	0.533	53%	0.526	S	S	.	.	H	α-helix	trans	-65.2	-45.2	177.4	174.5	0	0	0	0	111.2	L38 I39 K40 L44 Y45 I46	L38-V42 WeakPolarHBondContact O-CG2 3.46Å; L38-V42 PolarHBondContact O-N 3Å; L38-V42 VanDerWaalsContact O-N 3.11Å; I39-V42 PolarHBondContact O-N 3.19Å; K40-V42 VanDerWaalsContact C-N 3.34Å; K40-V42 PolarHBondContact O-N 3.38Å; V42-L44 VanDerWaalsContact C-N 3.34Å; V42-L44 PolarHBondContact O-N 2.94Å; V42-Y45 PolarHBondContact O-N 2.98Å; V42-I46 HydrophobicContact CG1-CD1 3.94Å; V42-I46 WeakPolarHBondContact O-CG1 3.35Å; V42-I46 PolarHBondContact O-N 3.31Å
43	I	96.3	Very high	91.5	Very high	90 Å²	90	107.3 Å²	107.3	46%	0.462	52%	0.522	S	S	.	.	H	α-helix	trans	-60.4	-46.1	177	-66.8	167.7	0	0	0	110.5	I39 K40 Y45 I46 L47	I39-I43 HydrophobicContact CG2-CD1 3.7Å; I39-I43 HydrophobicContact CG2-CG1 4.38Å; I39-I43 VanDerWaalsContact O-CG1 3.31Å; I39-I43 WeakPolarHBondContact O-CG1 3.49Å; I39-I43 PolarHBondContact O-N 3.15Å; K40-I43 PolarHBondContact O-N 3.43Å; I43-Y45 VanDerWaalsContact C-N 3.32Å; I43-Y45 PolarHBondContact O-N 2.97Å; I43-I46 PolarHBondContact O-N 3.4Å; I43-L47 HydrophobicContact CG2-CD1 3.97Å; I43-L47 HydrophobicContact CG2-CG 4.41Å; I43-L47 VanDerWaalsContact O-CG 3.31Å; I43-L47 WeakPolarHBondContact O-CG 3.36Å; I43-L47 PolarHBondContact O-N 2.85Å
44	L	93.2	Very high	90.8	Very high	111 Å²	111	101.9 Å²	101.9	58%	0.581	51%	0.51	S	S	*	.	H	α-helix	trans	-60.3	-41.5	177.1	-75.1	170.5	0	0	0	112.1	K40 L41 V42 L47 F48	K40-L44 WeakPolarHBondContact O-CB 3.33Å; K40-L44 VanDerWaalsContact O-CG 3.27Å; K40-L44 WeakPolarHBondContact O-CG 3.26Å; K40-L44 PolarHBondContact O-N 3.23Å; L41-L44 PolarHBondContact O-N 3.25Å; V42-L44 VanDerWaalsContact C-N 3.34Å; V42-L44 PolarHBondContact O-N 2.94Å; L44-L47 PolarHBondContact O-N 3.44Å; L44-F48 VanDerWaalsContact O-CB 3.26Å; L44-F48 WeakPolarHBondContact O-CB 3.31Å; L44-F48 PolarHBondContact O-N 3.47Å
45	Y	95.9	Very high	90	Very high	156 Å²	156	97.9 Å²	97.9	61%	0.612	50%	0.495	S	S	*	.	H	α-helix	trans	-63.7	-44.8	176.9	177.6	-103.5	0	0	0	112.2	L41 V42 I43 L47 F48 V49	L41-Y45 WeakPolarHBondContact O-CB 3.41Å; L41-Y45 PolarHBondContact O-N 3.43Å; V42-Y45 PolarHBondContact O-N 2.98Å; I43-Y45 VanDerWaalsContact C-N 3.32Å; I43-Y45 PolarHBondContact O-N 2.97Å; Y45-L47 PolarHBondContact O-N 3.49Å; Y45-F48 WeakPolarHBondContact O-CB 3.19Å; Y45-F48 PolarHBondContact O-N 3.25Å; Y45-V49 HydrophobicContact CD1-CG2 4.3Å; Y45-V49 HydrophobicContact CD2-CG2 4.4Å; Y45-V49 HydrophobicContact CE1-CG2 3.85Å; Y45-V49 HydrophobicContact CE2-CG2 3.96Å; Y45-V49 WeakPolarHBondContact O-CG2 3.45Å; Y45-V49 PolarHBondContact O-N 3.32Å
46	I	94.4	Very high	89	Confident	89 Å²	89	99.7 Å²	99.7	46%	0.456	50%	0.501	S	S	.	.	H	α-helix	trans	-61.4	-46.5	177	-66.8	166.6	0	0	0	110.6	V42 I43 F48 V49 I50	V42-I46 HydrophobicContact CG1-CD1 3.94Å; V42-I46 WeakPolarHBondContact O-CG1 3.35Å; V42-I46 PolarHBondContact O-N 3.31Å; I43-I46 PolarHBondContact O-N 3.4Å; I46-F48 VanDerWaalsContact C-N 3.29Å; I46-F48 PolarHBondContact O-N 2.96Å; I46-V49 PolarHBondContact O-N 3.41Å; I46-I50 HydrophobicContact CG2-CD1 3.87Å; I46-I50 WeakPolarHBondContact O-CG1 3.42Å; I46-I50 PolarHBondContact O-N 2.89Å
47	L	89.9	Confident	87.7	Confident	103 Å²	103	100 Å²	100	54%	0.539	50%	0.502	S	S	.	.	H	α-helix	trans	-59.9	-42	176.1	-70.8	173.6	0	0	0	111.4	I43 L44 Y45 I50 F51	I43-L47 HydrophobicContact CG2-CD1 3.97Å; I43-L47 HydrophobicContact CG2-CG 4.41Å; I43-L47 VanDerWaalsContact O-CG 3.31Å; I43-L47 WeakPolarHBondContact O-CG 3.36Å; I43-L47 PolarHBondContact O-N 2.85Å; L44-L47 PolarHBondContact O-N 3.44Å; Y45-L47 PolarHBondContact O-N 3.49Å; L47-I50 PolarHBondContact O-N 2.87Å; L47-F51 WeakPolarHBondContact O-CB 3.35Å; L47-F51 PolarHBondContact O-N 3.22Å
48	F	91.5	Very high	86.5	Confident	122 Å²	122	101.4 Å²	101.4	54%	0.535	51%	0.505	S	S	.	.	H	α-helix	trans	-61.4	-45.5	176	-179.8	-97.3	0	0	0	111.6	L44 Y45 I46 F51 D52	L44-F48 VanDerWaalsContact O-CB 3.26Å; L44-F48 WeakPolarHBondContact O-CB 3.31Å; L44-F48 PolarHBondContact O-N 3.47Å; Y45-F48 WeakPolarHBondContact O-CB 3.19Å; Y45-F48 PolarHBondContact O-N 3.25Å; I46-F48 VanDerWaalsContact C-N 3.29Å; I46-F48 PolarHBondContact O-N 2.96Å; F48-F51 PolarHBondContact O-N 3.02Å; F48-D52 VanDerWaalsContact O-CB 3.27Å; F48-D52 WeakPolarHBondContact O-CB 3.27Å; F48-D52 PolarHBondContact O-N 3.42Å
49	V	88.9	Confident	85.4	Confident	50 Å²	50	100.5 Å²	100.5	30%	0.303	50%	0.5	S	S	.	.	H	α-helix	trans	-63.8	-42.6	177.8	170.7	0	0	0	0	111.4	Y45 I46 F51 D52 N53	Y45-V49 HydrophobicContact CD1-CG2 4.3Å; Y45-V49 HydrophobicContact CD2-CG2 4.4Å; Y45-V49 HydrophobicContact CE1-CG2 3.85Å; Y45-V49 HydrophobicContact CE2-CG2 3.96Å; Y45-V49 WeakPolarHBondContact O-CG2 3.45Å; Y45-V49 PolarHBondContact O-N 3.32Å; I46-V49 PolarHBondContact O-N 3.41Å; V49-F51 VanDerWaalsContact C-N 3.34Å; V49-D52 PolarHBondContact O-N 3.41Å; V49-N53 PolarHBondContact O-N 3.42Å; V49-N53 PolarHBondContact O-ND2 2.78Å
50	I	88.1	Confident	84	Confident	107 Å²	107	98.6 Å²	98.6	55%	0.549	49%	0.494	S	S	.	.	H	α-helix	trans	-64	-44.1	177	-67.1	168.3	0	0	0	110.4	I46 L47 N53 S54	I46-I50 HydrophobicContact CG2-CD1 3.87Å; I46-I50 WeakPolarHBondContact O-CG1 3.42Å; I46-I50 PolarHBondContact O-N 2.89Å; L47-I50 PolarHBondContact O-N 2.87Å; I50-N53 PolarHBondContact O-N 2.79Å; I50-S54 PolarHBondContact O-N 3.07Å
51	F	86	Confident	82.6	Confident	127 Å²	127	96.7 Å²	96.7	56%	0.557	49%	0.49	S	S	*	.	H	α-helix	trans	-63.8	-44.1	178.5	-175.8	-110	0	0	0	111.9	L47 F48 V49 S54 I55	L47-F51 WeakPolarHBondContact O-CB 3.35Å; L47-F51 PolarHBondContact O-N 3.22Å; F48-F51 PolarHBondContact O-N 3.02Å; V49-F51 VanDerWaalsContact C-N 3.34Å; F51-S54 PolarHBondContact O-N 3.37Å; F51-I55 HydrophobicContact CD1-CD1 3.68Å; F51-I55 HydrophobicContact CD1-CG1 4.42Å; F51-I55 HydrophobicContact CD2-CD1 4.36Å; F51-I55 HydrophobicContact CE1-CD1 3.12Å; F51-I55 HydrophobicContact CE1-CG1 4.21Å; F51-I55 HydrophobicContact CE2-CD1 3.87Å; F51-I55 HydrophobicContact CE2-CG1 4.31Å; F51-I55 HydrophobicContact CG-CD1 4.29Å; F51-I55 HydrophobicContact CZ-CD1 3.25Å; F51-I55 HydrophobicContact CZ-CG1 4.17Å; F51-I55 WeakPolarHBondContact O-CB 3.11Å; F51-I55 WeakPolarHBondContact O-CG1 3.29Å; F51-I55 PolarHBondContact O-N 2.72Å
52	D	83.8	Confident	81.3	Confident	79 Å²	79	93.7 Å²	93.7	42%	0.422	48%	0.484	S	S	.	.	H	α-helix	trans	-62.3	-43.5	177.1	-170	61.5	0	0	0	111.2	F48 V49 S54 I55 H56	F48-D52 VanDerWaalsContact O-CB 3.27Å; F48-D52 WeakPolarHBondContact O-CB 3.27Å; F48-D52 PolarHBondContact O-N 3.42Å; V49-D52 PolarHBondContact O-N 3.41Å; D52-S54 VanDerWaalsContact C-N 3.34Å; D52-S54 PolarHBondContact O-N 2.83Å; D52-I55 PolarHBondContact O-N 3.48Å; D52-H56 WeakPolarHBondContact O-CA 3.46Å; D52-H56 WeakPolarHBondContact O-CB 3.44Å; D52-H56 PolarHBondContact O-N 3.24Å
53	N	78.8	Confident	79.7	Confident	95 Å²	95	95.1 Å²	95.1	51%	0.508	49%	0.488	S	S	.	.	H	α-helix	trans	-62.5	-40.5	174.9	-75.5	-57.8	0	0	0	112.6	V49 I50 M57	V49-N53 PolarHBondContact O-N 3.42Å; V49-N53 PolarHBondContact O-ND2 2.78Å; I50-N53 PolarHBondContact O-N 2.79Å; N53-M57 WeakPolarHBondContact O-CB 3.44Å; N53-M57 VanDerWaalsContact O-CG 3.29Å; N53-M57 WeakPolarHBondContact O-CG 3.43Å; N53-M57 PolarHBondContact O-N 2.85Å
54	S	77.7	Confident	78.1	Confident	59 Å²	59	96.7 Å²	96.7	41%	0.413	50%	0.496	S	S	.	.	H	α-helix	trans	-66	-46.8	177.2	179.6	0	0	0	0	111.3	I50 F51 D52 M57 H58	I50-S54 PolarHBondContact O-N 3.07Å; F51-S54 PolarHBondContact O-N 3.37Å; D52-S54 VanDerWaalsContact C-N 3.34Å; D52-S54 PolarHBondContact O-N 2.83Å; S54-M57 WeakPolarHBondContact O-CB 3.45Å; S54-M57 PolarHBondContact O-N 2.99Å; S54-H58 PolarHBondContact O-CD2 3.01Å; S54-H58 PolarHBondContact O-N 3.09Å; S54-H58 VanDerWaalsContact O-N 3.09Å
55	I	72.8	Confident	76.7	Confident	60 Å²	60	96.1 Å²	96.1	31%	0.308	50%	0.501	S	S	.	.	H	α-helix	trans	-64.3	-45.3	176.3	-75.5	-173.9	0	0	0	111	F51 D52 M57 H58 I59	F51-I55 HydrophobicContact CD1-CD1 3.68Å; F51-I55 HydrophobicContact CD1-CG1 4.42Å; F51-I55 HydrophobicContact CD2-CD1 4.36Å; F51-I55 HydrophobicContact CE1-CD1 3.12Å; F51-I55 HydrophobicContact CE1-CG1 4.21Å; F51-I55 HydrophobicContact CE2-CD1 3.87Å; F51-I55 HydrophobicContact CE2-CG1 4.31Å; F51-I55 HydrophobicContact CG-CD1 4.29Å; F51-I55 HydrophobicContact CZ-CD1 3.25Å; F51-I55 HydrophobicContact CZ-CG1 4.17Å; F51-I55 WeakPolarHBondContact O-CB 3.11Å; F51-I55 WeakPolarHBondContact O-CG1 3.29Å; F51-I55 PolarHBondContact O-N 2.72Å; D52-I55 PolarHBondContact O-N 3.48Å; I55-M57 PolarHBondContact O-N 3Å; I55-H58 CarbonylContact O-C 3.51Å; I55-H58 WeakPolarHBondContact O-CA 3.35Å; I55-H58 WeakPolarHBondContact O-CB 3.19Å; I55-H58 PolarHBondContact O-N 3.33Å; I55-I59 HydrophobicContact CG2-CD1 3.45Å; I55-I59 VanDerWaalsContact CG2-CD1 3.45Å; I55-I59 HydrophobicContact CG2-CG1 3.96Å; I55-I59 WeakPolarHBondContact O-CG1 3.49Å; I55-I59 PolarHBondContact O-N 3.19Å
56	H	67.8	Low	75.1	Confident	107 Å²	107	99 Å²	99	50%	0.495	51%	0.512	S	S	.	.	H	α-helix	trans	-61.5	-37.1	-179.8	-166.5	66.2	0	0	0	110.6	D52 I59 C60	D52-H56 WeakPolarHBondContact O-CA 3.46Å; D52-H56 WeakPolarHBondContact O-CB 3.44Å; D52-H56 PolarHBondContact O-N 3.24Å; H56-I59 PolarHBondContact O-N 2.78Å; H56-C60 WeakPolarHBondContact O-CB 3.47Å; H56-C60 PolarHBondContact O-N 2.75Å; H56-C60 PolarHBondContact O-SG 3.4Å
57	M	66.6	Low	73	Confident	117 Å²	117	106.4 Å²	106.4	58%	0.576	54%	0.541	S	S	*	.	H	α-helix	trans	-61.4	-44.8	169.9	-78.5	-95.9	68.6	0	0	112.5	N53 S54 I55 C60 L61	N53-M57 WeakPolarHBondContact O-CB 3.44Å; N53-M57 VanDerWaalsContact O-CG 3.29Å; N53-M57 WeakPolarHBondContact O-CG 3.43Å; N53-M57 PolarHBondContact O-N 2.85Å; S54-M57 WeakPolarHBondContact O-CB 3.45Å; S54-M57 PolarHBondContact O-N 2.99Å; I55-M57 PolarHBondContact O-N 3Å; M57-C60 PolarHBondContact O-N 2.83Å; M57-L61 WeakPolarHBondContact O-CB 3.47Å; M57-L61 WeakPolarHBondContact O-CG 3.22Å; M57-L61 PolarHBondContact O-N 3.16Å
58	H	68.2	Low	72.2	Confident	133 Å²	133	106.6 Å²	106.6	62%	0.616	54%	0.541	S	S	*	.	H	α-helix	trans	-65.3	-39.2	175.8	-75.5	-67.7	0	0	0	112.9	S54 I55 G62	S54-H58 PolarHBondContact O-CD2 3.01Å; S54-H58 PolarHBondContact O-N 3.09Å; S54-H58 VanDerWaalsContact O-N 3.09Å; I55-H58 CarbonylContact O-C 3.51Å; I55-H58 WeakPolarHBondContact O-CA 3.35Å; I55-H58 WeakPolarHBondContact O-CB 3.19Å; I55-H58 PolarHBondContact O-N 3.33Å; H58-G62 PolarHBondContact O-N 3.38Å
59	I	70.1	Confident	71.2	Confident	89 Å²	89	105.7 Å²	105.7	46%	0.456	54%	0.541	S	S	.	.	H	α-helix	trans	-67.9	-44.6	176	-66.9	174.4	0	0	0	110.1	I55 H56 L61 G62 I63	I55-I59 HydrophobicContact CG2-CD1 3.45Å; I55-I59 VanDerWaalsContact CG2-CD1 3.45Å; I55-I59 HydrophobicContact CG2-CG1 3.96Å; I55-I59 WeakPolarHBondContact O-CG1 3.49Å; I55-I59 PolarHBondContact O-N 3.19Å; H56-I59 PolarHBondContact O-N 2.78Å; I59-L61 VanDerWaalsContact C-N 3.34Å; I59-L61 PolarHBondContact O-N 2.96Å; I59-G62 PolarHBondContact O-N 3.46Å; I59-G62 VanDerWaalsContact O-N 3.16Å; I59-I63 HydrophobicContact CG2-CD1 3.91Å; I59-I63 HydrophobicContact CG2-CG1 4.45Å; I59-I63 WeakPolarHBondContact O-CG1 3.37Å; I59-I63 PolarHBondContact O-N 2.87Å
60	C	67.9	Low	70.2	Confident	40 Å²	40	108.8 Å²	108.8	27%	0.27	56%	0.555	S	S	.	*	H	α-helix	trans	-59.5	-44	176.1	-77.8	0	0	0	0	111.5	H56 M57 I63 I64	H56-C60 WeakPolarHBondContact O-CB 3.47Å; H56-C60 PolarHBondContact O-N 2.75Å; H56-C60 PolarHBondContact O-SG 3.4Å; M57-C60 PolarHBondContact O-N 2.83Å; C60-I63 PolarHBondContact O-N 3.31Å; C60-I64 WeakPolarHBondContact O-CD1 3.3Å; C60-I64 WeakPolarHBondContact O-CG1 3.47Å; C60-I64 PolarHBondContact O-N 3.48Å
61	L	64.1	Low	69.1	Low	104 Å²	104	108.9 Å²	108.9	55%	0.545	56%	0.555	S	S	.	*	H	α-helix	trans	-67.2	-38.5	173.7	-76.6	168.6	0	0	0	112.4	M57 I59 I63 I64 S65	M57-L61 WeakPolarHBondContact O-CB 3.47Å; M57-L61 WeakPolarHBondContact O-CG 3.22Å; M57-L61 PolarHBondContact O-N 3.16Å; I59-L61 VanDerWaalsContact C-N 3.34Å; I59-L61 PolarHBondContact O-N 2.96Å; L61-I63 VanDerWaalsContact C-N 3.34Å; L61-I63 PolarHBondContact O-N 3.45Å; L61-I64 PolarHBondContact O-N 2.98Å; L61-S65 VanDerWaalsContact O-CB 3.3Å; L61-S65 WeakPolarHBondContact O-CB 3.45Å; L61-S65 PolarHBondContact O-N 3.47Å
62	G	69.4	Low	68.1	Low	42 Å²	42	107.8 Å²	107.8	43%	0.433	56%	0.555	S	S	.	*	H	α-helix	trans	-60.1	-42.5	175	0	0	0	0	0	112.3	H58 I59 S65 Y66	H58-G62 PolarHBondContact O-N 3.38Å; I59-G62 PolarHBondContact O-N 3.46Å; I59-G62 VanDerWaalsContact O-N 3.16Å; G62-S65 PolarHBondContact O-N 3.48Å; G62-Y66 VanDerWaalsContact O-CB 3.28Å; G62-Y66 WeakPolarHBondContact O-CB 3.28Å; G62-Y66 PolarHBondContact O-N 2.95Å
63	I	63.2	Low	67	Low	118 Å²	118	109.7 Å²	109.7	61%	0.605	56%	0.564	S	S	*	*	H	α-helix	trans	-69.9	-40.5	175.8	-64.1	168.3	0	0	0	111.2	I59 C60 L61 S65 Y66	I59-I63 HydrophobicContact CG2-CD1 3.91Å; I59-I63 HydrophobicContact CG2-CG1 4.45Å; I59-I63 WeakPolarHBondContact O-CG1 3.37Å; I59-I63 PolarHBondContact O-N 2.87Å; C60-I63 PolarHBondContact O-N 3.31Å; L61-I63 VanDerWaalsContact C-N 3.34Å; L61-I63 PolarHBondContact O-N 3.45Å; I63-S65 VanDerWaalsContact C-N 3.33Å; I63-S65 PolarHBondContact O-N 3.49Å; I63-Y66 PolarHBondContact O-N 3.37Å
64	I	60.9	Low	66.2	Low	122 Å²	122	110.8 Å²	110.8	63%	0.626	57%	0.568	S	S	*	*	H	α-helix	trans	-63.1	-40.1	175.5	-68.8	164	0	0	0	110.9	C60 L61	C60-I64 WeakPolarHBondContact O-CD1 3.3Å; C60-I64 WeakPolarHBondContact O-CG1 3.47Å; C60-I64 PolarHBondContact O-N 3.48Å; L61-I64 PolarHBondContact O-N 2.98Å
65	S	64.9	Low	65.3	Low	99 Å²	99	114.8 Å²	114.8	69%	0.692	58%	0.58	S	S	*	*	H	α-helix	trans	-81.2	-13.1	179.5	-171.1	0	0	0	0	114.3	L61 G62 I63 K67	L61-S65 VanDerWaalsContact O-CB 3.3Å; L61-S65 WeakPolarHBondContact O-CB 3.45Å; L61-S65 PolarHBondContact O-N 3.47Å; G62-S65 PolarHBondContact O-N 3.48Å; I63-S65 VanDerWaalsContact C-N 3.33Å; I63-S65 PolarHBondContact O-N 3.49Å; S65-K67 VanDerWaalsContact C-N 3.26Å
66	Y	62.1	Low	64.7	Low	216 Å²	216	119.3 Å²	119.3	85%	0.847	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.2	-12.3	175.5	-175.9	-102	0	0	0	112.4	G62 I63	G62-Y66 VanDerWaalsContact O-CB 3.28Å; G62-Y66 WeakPolarHBondContact O-CB 3.28Å; G62-Y66 PolarHBondContact O-N 2.95Å; I63-Y66 PolarHBondContact O-N 3.37Å
67	K	50.8	Low	64.4	Low	245 Å²	245	120.5 Å²	120.5	100%	1.065	61%	0.612	S	S	*	*			trans	-93.8	0	176	-144.4	-177.9	-170.3	-179.5	0	111	S65	S65-K67 VanDerWaalsContact C-N 3.26Å

Retrieved 67 of 67 residues in 96.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).