A0A5K4F8Z7_SCHMA Loading...

Transposase

AlphaFold DB , UniProt , Accession A0A5K4F8Z7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 85 aa.

						>A0A5K4F8Z7_SCHMA|A0A5K4F8Z7
MGHLRFANKHNDVVNTGFRMDKRSAKYKISQRYSGTHVNSSFQIKSKTTIDNLSMISTSFDVVRTALIAYSMAELVIFHAFGKGS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43	Very low	41.4	Very low	193 Å²	193	115.7 Å²	115.7	95%	0.951	58%	0.578	S	S	*	*				0	123.8	0	-67	-176.7	-168.4	0	0	107
2	G	39.2	Very low	41.6	Very low	30 Å²	30	108.7 Å²	108.7	31%	0.309	54%	0.544	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.1	136.7	176.9	0	0	0	0	0	110.5
3	H	45.2	Very low	41.9	Very low	125 Å²	125	106.5 Å²	106.5	58%	0.579	54%	0.539	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-115.6	124.9	169.8	-70.1	-93.2	0	0	0	108	T16	H3-T16 WeakPolarHBondContact CA-O 3.32Å
4	L	38.4	Very low	42.1	Very low	42 Å²	42	99.2 Å²	99.2	22%	0.22	50%	0.503	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	127.9	168.1	-80.9	82.4	0	0	0	108.1	F6 T16 F18 M72	L4-F6 HydrophobicContact CB-CD2 4.25Å; L4-F6 HydrophobicContact CB-CE2 3.52Å; L4-F6 HydrophobicContact CB-CZ 3.87Å; L4-F6 HydrophobicContact CD2-CE1 4.24Å; L4-F6 HydrophobicContact CD2-CE2 3.91Å; L4-F6 HydrophobicContact CD2-CZ 3.38Å; L4-F6 HydrophobicContact CG-CE2 4.35Å; L4-F6 HydrophobicContact CG-CZ 4.24Å; L4-T16 WeakPolarHBondContact CB-OG1 3.4Å; L4-T16 PolarHBondContact N-O 2.83Å; L4-T16 PolarHBondContact O-N 2.88Å; L4-T16 PolarHBondContact O-OG1 2.8Å; L4-F18 HydrophobicContact CD1-CD1 3.88Å; L4-F18 HydrophobicContact CD1-CE1 3.25Å; L4-F18 HydrophobicContact CD1-CZ 4.13Å; L4-M72 HydrophobicContact CD2-CB 4.38Å
5	R	42.4	Very low	42.4	Very low	195 Å²	195	96.7 Å²	96.7	74%	0.736	49%	0.492	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.7	122.8	172.2	-70	-177.9	174	-170.8	-0.4	108.1	V14	R5-V14 WeakPolarHBondContact CA-O 3.5Å
6	F	40.2	Very low	42.6	Very low	54 Å²	54	91.1 Å²	91.1	24%	0.237	46%	0.463	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.7	131.5	172.6	-59.4	-81.6	0	0	0	108.4	L4 V14 T16 T65 A69 M72	L4-F6 HydrophobicContact CB-CD2 4.25Å; L4-F6 HydrophobicContact CB-CE2 3.52Å; L4-F6 HydrophobicContact CB-CZ 3.87Å; L4-F6 HydrophobicContact CD2-CE1 4.24Å; L4-F6 HydrophobicContact CD2-CE2 3.91Å; L4-F6 HydrophobicContact CD2-CZ 3.38Å; L4-F6 HydrophobicContact CG-CE2 4.35Å; L4-F6 HydrophobicContact CG-CZ 4.24Å; F6-V14 HydrophobicContact CB-CB 4.41Å; F6-V14 PolarHBondContact N-O 2.83Å; F6-V14 VanDerWaalsContact N-O 3.11Å; F6-V14 WeakPolarHBondContact O-CB 3.48Å; F6-V14 PolarHBondContact O-N 3.01Å; F6-T16 HydrophobicContact CD2-CG2 4.22Å; F6-T16 HydrophobicContact CE2-CG2 4.44Å; F6-T65 HydrophobicContact CD2-CG2 4.39Å; F6-A69 HydrophobicContact CE2-CB 4.03Å; F6-A69 HydrophobicContact CZ-CB 4.33Å; F6-M72 HydrophobicContact CE1-SD 4.4Å
7	A	37.3	Very low	42.8	Very low	81 Å²	81	86.9 Å²	86.9	67%	0.669	45%	0.449	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.7	121.1	166.3	0	0	0	0	0	107.4
8	N	40.3	Very low	43.1	Very low	79 Å²	79	84.9 Å²	84.9	42%	0.422	44%	0.436	S	S	.	.			trans	-77.1	163.2	169.2	-163.7	-4	0	0	0	109.2	H10 N11 D12	N8-H10 PolarHBondContact O-N 3.37Å; N8-N11 PolarHBondContact O-N 2.94Å; N8-D12 PolarHBondContact N-O 2.75Å
9	K	39.3	Very low	43.3	Very low	203 Å²	203	87.7 Å²	87.7	88%	0.883	44%	0.441	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.1	-13.4	177.1	-162	177	-178.5	-177.4	0	113.8
10	H	45.9	Very low	43.5	Very low	129 Å²	129	88.4 Å²	88.4	60%	0.597	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.5	8.1	176.3	-74.9	-118.6	0	0	0	114.5	N8 D12	N8-H10 PolarHBondContact O-N 3.37Å; H10-D12 PolarHBondContact O-N 3.08Å
11	N	43.9	Very low	43.9	Very low	142 Å²	142	87.8 Å²	87.8	76%	0.759	44%	0.441	S	S	*	.			trans	62.3	16.3	-175	-149.6	25.6	0	0	0	114.4	N8 V13	N8-N11 PolarHBondContact O-N 2.94Å; N11-V13 PolarHBondContact O-N 3.27Å
12	D	43.9	Very low	44.3	Very low	31 Å²	31	89.1 Å²	89.1	17%	0.166	44%	0.442	C	S	.	.			trans	-74.2	122.2	174.1	-70.7	-37.4	0	0	0	110	N8 H10 V14 R32 Y33	N8-D12 PolarHBondContact N-O 2.75Å; H10-D12 PolarHBondContact O-N 3.08Å; D12-V14 PolarHBondContact O-N 2.76Å; D12-R32 WeakPolarHBondContact CB-O 3.48Å; D12-Y33 VanDerWaalsContact OD2-CD2 3.32Å; D12-Y33 WeakPolarHBondContact OD2-CD2 3.44Å
13	V	45.3	Very low	44.9	Very low	80 Å²	80	98.5 Å²	98.5	49%	0.485	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.7	107.7	176.2	180	0	0	0	0	108.6	N11	N11-V13 PolarHBondContact O-N 3.27Å
14	V	44.6	Very low	45	Very low	5 Å²	5	94 Å²	94	3%	0.03	45%	0.451	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	111.7	172.1	-173.9	0	0	0	0	108.4	R5 F6 D12 T16 I29 S30 Q31 T65	R5-V14 WeakPolarHBondContact CA-O 3.5Å; F6-V14 HydrophobicContact CB-CB 4.41Å; F6-V14 PolarHBondContact N-O 2.83Å; F6-V14 VanDerWaalsContact N-O 3.11Å; F6-V14 WeakPolarHBondContact O-CB 3.48Å; F6-V14 PolarHBondContact O-N 3.01Å; D12-V14 PolarHBondContact O-N 2.76Å; V14-T16 HydrophobicContact CG1-CG2 3.76Å; V14-I29 HydrophobicContact CG1-CG2 3.94Å; V14-S30 WeakPolarHBondContact CA-O 3.38Å; V14-Q31 HydrophobicContact CB-CG 4.42Å; V14-Q31 HydrophobicContact CG1-CG 3.9Å; V14-Q31 HydrophobicContact CG2-CG 3.93Å; V14-T65 HydrophobicContact CG1-CG2 4.25Å
15	N	46.5	Very low	45.6	Very low	62 Å²	62	92.2 Å²	92.2	33%	0.332	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.5	107.9	173.4	-165.1	1.7	0	0	0	108.6	S30	N15-S30 PolarHBondContact N-O 3.26Å; N15-S30 PolarHBondContact O-N 2.93Å
16	T	45.8	Very low	46.2	Very low	6 Å²	6	88.3 Å²	88.3	4%	0.037	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.7	128.9	175	67	0	0	0	0	110	H3 L4 F6 V14 K28 I29 T65	H3-T16 WeakPolarHBondContact CA-O 3.32Å; L4-T16 WeakPolarHBondContact CB-OG1 3.4Å; L4-T16 PolarHBondContact N-O 2.83Å; L4-T16 PolarHBondContact O-N 2.88Å; L4-T16 PolarHBondContact O-OG1 2.8Å; F6-T16 HydrophobicContact CD2-CG2 4.22Å; F6-T16 HydrophobicContact CE2-CG2 4.44Å; V14-T16 HydrophobicContact CG1-CG2 3.76Å; T16-K28 CarbonylContact C-O 3.55Å; T16-K28 VanDerWaalsContact CA-O 3.32Å; T16-K28 WeakPolarHBondContact CA-O 3.5Å; T16-I29 HydrophobicContact CG2-CG1 4.18Å; T16-I29 HydrophobicContact CG2-CG2 4.46Å; T16-T65 HydrophobicContact CG2-CG2 4.39Å
17	G	47.3	Very low	46.8	Very low	21 Å²	21	86.5 Å²	86.5	22%	0.216	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	128.8	168.3	0	0	0	0	0	108.6	Y27 K28	G17-Y27 WeakPolarHBondContact O-CA 3.18Å; G17-K28 PolarHBondContact N-O 2.92Å; G17-K28 PolarHBondContact O-N 2.89Å
18	F	47.2	Very low	47.6	Very low	51 Å²	51	88.4 Å²	88.4	22%	0.224	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.2	134.9	172.1	67.6	-75.4	0	0	0	108.7	L4 K26 Y27 A73	L4-F18 HydrophobicContact CD1-CD1 3.88Å; L4-F18 HydrophobicContact CD1-CE1 3.25Å; L4-F18 HydrophobicContact CD1-CZ 4.13Å; F18-K26 WeakPolarHBondContact CA-O 3.43Å; F18-Y27 HydrophobicContact CB-CD1 3.97Å; F18-Y27 HydrophobicContact CB-CE1 4.05Å; F18-A73 HydrophobicContact CD2-CB 4.32Å; F18-A73 HydrophobicContact CE2-CB 3.92Å; F18-A73 HydrophobicContact CZ-CB 4.26Å
19	R	48.1	Very low	48.2	Very low	138 Å²	138	84.8 Å²	84.8	52%	0.521	40%	0.396	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.6	116	171.4	-178.8	177.5	167.5	162.6	3.9	107.4	D21 A25 K26	R19-D21 IonicContact CZ-OD2 3.8Å; R19-D21 IonicContact NE-OD2 3Å; R19-D21 PolarHBondContact NE-OD2 2.94Å; R19-D21 IonicContact NH2-OD1 3.96Å; R19-D21 IonicContact NH2-OD2 3.76Å; R19-A25 CarbonylContact O-C 3.6Å; R19-A25 WeakPolarHBondContact O-CA 3.35Å; R19-K26 HydrophobicContact CB-CB 4.5Å; R19-K26 PolarHBondContact N-O 3.21Å; R19-K26 PolarHBondContact O-N 2.84Å
20	M	46.6	Very low	49	Very low	101 Å²	101	76.4 Å²	76.4	50%	0.498	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	124.6	177.5	-165.6	175.4	-170.5	0	0	108.4	I77	M20-I77 HydrophobicContact SD-CD1 4.37Å
21	D	51.2	Low	49.1	Very low	75 Å²	75	72.3 Å²	72.3	40%	0.401	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	158.4	170	-72.1	-79.4	0	0	0	107.2	R19 R23 S24	R19-D21 IonicContact CZ-OD2 3.8Å; R19-D21 IonicContact NE-OD2 3Å; R19-D21 PolarHBondContact NE-OD2 2.94Å; R19-D21 IonicContact NH2-OD1 3.96Å; R19-D21 IonicContact NH2-OD2 3.76Å; D21-R23 PolarHBondContact O-N 2.73Å; D21-S24 PolarHBondContact N-O 2.83Å; D21-S24 PolarHBondContact O-N 2.9Å; D21-S24 VanDerWaalsContact O-O 3.11Å
22	K	52.2	Low	49.2	Very low	222 Å²	222	72.6 Å²	72.6	97%	0.965	33%	0.334	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.3	-14.4	-175.1	-70.6	-176.1	178.4	-180	0	115.4
23	R	51.2	Low	49.3	Very low	227 Å²	227	77.7 Å²	77.7	86%	0.857	35%	0.352	S	S	*	.	T	Hydrogen-bonded Turn	trans	-126.7	-5	-177.4	-60.9	-176.9	-169.7	-175.6	2.3	114.5	D21	D21-R23 PolarHBondContact O-N 2.73Å
24	S	48.6	Very low	49.4	Very low	30 Å²	30	79 Å²	79	21%	0.21	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-159.9	144.7	-177	62.5	0	0	0	0	113	D21 I44	D21-S24 PolarHBondContact N-O 2.83Å; D21-S24 PolarHBondContact O-N 2.9Å; D21-S24 VanDerWaalsContact O-O 3.11Å; S24-I44 CarbonylContact C-O 3.56Å; S24-I44 WeakPolarHBondContact CA-O 3.39Å; S24-I44 WeakPolarHBondContact CB-O 3.22Å
25	A	49.7	Very low	49.6	Very low	5 Å²	5	82.5 Å²	82.5	4%	0.041	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	124	169.1	0	0	0	0	0	109.1	R19 Y27 Q43 I44	R19-A25 CarbonylContact O-C 3.6Å; R19-A25 WeakPolarHBondContact O-CA 3.35Å; A25-Y27 HydrophobicContact CB-CD2 4.34Å; A25-Y27 HydrophobicContact CB-CE2 3.44Å; A25-Y27 VanDerWaalsContact CB-CE2 3.44Å; A25-Q43 WeakPolarHBondContact O-CA 3.4Å; A25-I44 PolarHBondContact N-O 3.25Å; A25-I44 PolarHBondContact O-N 3.02Å
26	K	55.6	Low	49.3	Very low	112 Å²	112	83.7 Å²	83.7	49%	0.487	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	125.8	174.6	-175.2	176.5	-177.2	174.3	0	108.7	F18 R19	F18-K26 WeakPolarHBondContact CA-O 3.43Å; R19-K26 HydrophobicContact CB-CB 4.5Å; R19-K26 PolarHBondContact N-O 3.21Å; R19-K26 PolarHBondContact O-N 2.84Å
27	Y	52	Low	49.5	Very low	17 Å²	17	88.7 Å²	88.7	7%	0.067	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	135.9	177.1	-60.4	-100.3	0	0	0	109.2	G17 F18 A25 S41 F42 I44 Y70	G17-Y27 WeakPolarHBondContact O-CA 3.18Å; F18-Y27 HydrophobicContact CB-CD1 3.97Å; F18-Y27 HydrophobicContact CB-CE1 4.05Å; A25-Y27 HydrophobicContact CB-CD2 4.34Å; A25-Y27 HydrophobicContact CB-CE2 3.44Å; A25-Y27 VanDerWaalsContact CB-CE2 3.44Å; Y27-S41 CarbonylContact O-C 3.53Å; Y27-S41 WeakPolarHBondContact O-CA 3.29Å; Y27-S41 WeakPolarHBondContact O-CB 3.45Å; Y27-F42 VanDerWaalsContact CB-CZ 3.41Å; Y27-F42 HydrophobicContact CD1-CE1 4.49Å; Y27-F42 AromaticContact CD1-CZ 3.91Å; Y27-F42 HydrophobicContact CD1-CZ 3.91Å; Y27-F42 AromaticContact CD2-CD2 3.77Å; Y27-F42 HydrophobicContact CD2-CD2 3.77Å; Y27-F42 HydrophobicContact CD2-CE1 4.08Å; Y27-F42 AromaticContact CD2-CE2 3.04Å; Y27-F42 HydrophobicContact CD2-CE2 3.04Å; Y27-F42 AromaticContact CD2-CZ 3.23Å; Y27-F42 HydrophobicContact CD2-CZ 3.23Å; Y27-F42 HydrophobicContact CE1-CZ 4.48Å; Y27-F42 AromaticContact CE2-CE2 3.57Å; Y27-F42 HydrophobicContact CE2-CE2 3.57Å; Y27-F42 AromaticContact CE2-CZ 3.88Å; Y27-F42 HydrophobicContact CE2-CZ 3.88Å; Y27-F42 HydrophobicContact CG-CD1 4.49Å; Y27-F42 HydrophobicContact CG-CD2 4.38Å; Y27-F42 AromaticContact CG-CE1 3.75Å; Y27-F42 HydrophobicContact CG-CE1 3.75Å; Y27-F42 AromaticContact CG-CE2 3.61Å; Y27-F42 HydrophobicContact CG-CE2 3.61Å; Y27-F42 AromaticContact CG-CZ 3.23Å; Y27-F42 HydrophobicContact CG-CZ 3.23Å; Y27-F42 PolarHBondContact N-O 2.82Å; Y27-F42 PolarHBondContact O-N 3.41Å; Y27-I44 HydrophobicContact CE2-CD1 4.41Å; Y27-Y70 HydrophobicContact CE1-CD2 4.41Å; Y27-Y70 AromaticContact CZ-CD2 3.96Å; Y27-Y70 WeakPolarHBondContact OH-CD2 3.32Å; Y27-Y70 VanDerWaalsContact OH-CE2 3.3Å; Y27-Y70 WeakPolarHBondContact OH-CE2 3.45Å
28	K	55.2	Low	49.5	Very low	120 Å²	120	90.8 Å²	90.8	52%	0.522	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.3	124.5	170.6	-173.3	176.4	-179	-180	0	107.3	T16 G17	T16-K28 CarbonylContact C-O 3.55Å; T16-K28 VanDerWaalsContact CA-O 3.32Å; T16-K28 WeakPolarHBondContact CA-O 3.5Å; G17-K28 PolarHBondContact N-O 2.92Å; G17-K28 PolarHBondContact O-N 2.89Å
29	I	51.9	Low	49.7	Very low	4 Å²	4	93.1 Å²	93.1	2%	0.021	46%	0.458	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.3	122.5	176.7	-58.9	173.2	0	0	0	106.1	V14 T16 Q31 S40 F42 V62 A66	V14-I29 HydrophobicContact CG1-CG2 3.94Å; T16-I29 HydrophobicContact CG2-CG1 4.18Å; T16-I29 HydrophobicContact CG2-CG2 4.46Å; I29-Q31 HydrophobicContact CG2-CG 3.87Å; I29-S40 PolarHBondContact N-O 2.87Å; I29-S40 PolarHBondContact O-N 3.48Å; I29-S40 VanDerWaalsContact O-O 3.05Å; I29-F42 HydrophobicContact CD1-CE1 4.28Å; I29-V62 HydrophobicContact CD1-CG1 3.52Å; I29-V62 HydrophobicContact CG2-CG1 4.37Å; I29-A66 HydrophobicContact CD1-CB 4.03Å
30	S	55.6	Low	49.7	Very low	27 Å²	27	88.7 Å²	88.7	19%	0.189	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.5	115.3	168.8	-170.8	0	0	0	0	107.2	V14 N15 V38 N39	V14-S30 WeakPolarHBondContact CA-O 3.38Å; N15-S30 PolarHBondContact N-O 3.26Å; N15-S30 PolarHBondContact O-N 2.93Å; S30-V38 WeakPolarHBondContact CA-O 3.34Å; S30-N39 WeakPolarHBondContact CB-OD1 3.47Å; S30-N39 PolarHBondContact OG-OD1 2.97Å
31	Q	48.5	Very low	49.9	Very low	43 Å²	43	88 Å²	88	20%	0.201	45%	0.453	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	131.5	172	-61.9	-170.3	-10.1	0	0	108.2	V14 I29 V38	V14-Q31 HydrophobicContact CB-CG 4.42Å; V14-Q31 HydrophobicContact CG1-CG 3.9Å; V14-Q31 HydrophobicContact CG2-CG 3.93Å; I29-Q31 HydrophobicContact CG2-CG 3.87Å; Q31-V38 PolarHBondContact N-O 3.22Å; Q31-V38 PolarHBondContact O-N 2.84Å
32	R	46.4	Very low	49.7	Very low	147 Å²	147	87.7 Å²	87.7	56%	0.555	45%	0.448	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94	126.5	162.1	-79.8	178.8	162.8	150.5	-7	107	D12 H37	D12-R32 WeakPolarHBondContact CB-O 3.48Å; R32-H37 PolarHBondContact NE-NE2 3.33Å; R32-H37 PolarHBondContact NH2-NE2 2.86Å
33	Y	46.4	Very low	49.6	Very low	139 Å²	139	81.9 Å²	81.9	55%	0.545	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.2	116.9	172	-176.3	-95.4	0	0	0	108.3	D12 G35 T36	D12-Y33 VanDerWaalsContact OD2-CD2 3.32Å; D12-Y33 WeakPolarHBondContact OD2-CD2 3.44Å; Y33-G35 VanDerWaalsContact C-N 3.31Å; Y33-G35 PolarHBondContact O-N 3.44Å; Y33-G35 VanDerWaalsContact O-N 3.08Å; Y33-T36 PolarHBondContact N-O 2.98Å; Y33-T36 WeakPolarHBondContact O-CA 3.46Å; Y33-T36 WeakPolarHBondContact O-CB 3.38Å; Y33-T36 PolarHBondContact O-N 2.81Å
34	S	47.1	Very low	49.5	Very low	108 Å²	108	72 Å²	72	76%	0.755	39%	0.388	S	S	*	.	T	Hydrogen-bonded Turn	trans	41.2	51.9	172.9	-155.7	0	0	0	0	114.7	T36	S34-T36 VanDerWaalsContact C-N 3.33Å; S34-T36 PolarHBondContact O-N 2.87Å
35	G	49.7	Very low	49.7	Very low	78 Å²	78	77.9 Å²	77.9	80%	0.804	41%	0.41	S	S	*	.	T	Hydrogen-bonded Turn	trans	82.7	-5.3	179.7	0	0	0	0	0	116.4	Y33	Y33-G35 VanDerWaalsContact C-N 3.31Å; Y33-G35 PolarHBondContact O-N 3.44Å; Y33-G35 VanDerWaalsContact O-N 3.08Å
36	T	38.6	Very low	49.4	Very low	87 Å²	87	80 Å²	80	53%	0.534	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101	129.4	174.9	-53.9	0	0	0	0	110.6	Y33 S34 V38	Y33-T36 PolarHBondContact N-O 2.98Å; Y33-T36 WeakPolarHBondContact O-CA 3.46Å; Y33-T36 WeakPolarHBondContact O-CB 3.38Å; Y33-T36 PolarHBondContact O-N 2.81Å; S34-T36 VanDerWaalsContact C-N 3.33Å; S34-T36 PolarHBondContact O-N 2.87Å; T36-V38 HydrophobicContact CG2-CG2 4.32Å
37	H	51.2	Low	49	Very low	110 Å²	110	83.2 Å²	83.2	51%	0.509	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	112.3	171.4	-66.7	75.5	0	0	0	109.9	R32	R32-H37 PolarHBondContact NE-NE2 3.33Å; R32-H37 PolarHBondContact NH2-NE2 2.86Å
38	V	46.4	Very low	48.5	Very low	65 Å²	65	86.9 Å²	86.9	39%	0.394	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	112.9	172.2	-177.9	0	0	0	0	108.3	S30 Q31 T36	S30-V38 WeakPolarHBondContact CA-O 3.34Å; Q31-V38 PolarHBondContact N-O 3.22Å; Q31-V38 PolarHBondContact O-N 2.84Å; T36-V38 HydrophobicContact CG2-CG2 4.32Å
39	N	52	Low	48	Very low	101 Å²	101	84.3 Å²	84.3	54%	0.54	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.9	110.2	174.2	-76.9	-2	0	0	0	109.5	S30	S30-N39 WeakPolarHBondContact CB-OD1 3.47Å; S30-N39 PolarHBondContact OG-OD1 2.97Å
40	S	47	Very low	47.6	Very low	45 Å²	45	86.4 Å²	86.4	32%	0.315	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.7	134.8	173.4	-63.7	0	0	0	0	109.3	I29	I29-S40 PolarHBondContact N-O 2.87Å; I29-S40 PolarHBondContact O-N 3.48Å; I29-S40 VanDerWaalsContact O-O 3.05Å
41	S	51.9	Low	46.9	Very low	85 Å²	85	91.1 Å²	91.1	59%	0.594	49%	0.491	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-134.9	136.1	170	65	0	0	0	0	110.1	Y27	Y27-S41 CarbonylContact O-C 3.53Å; Y27-S41 WeakPolarHBondContact O-CA 3.29Å; Y27-S41 WeakPolarHBondContact O-CB 3.45Å
42	F	46.5	Very low	46.5	Very low	69 Å²	69	93.7 Å²	93.7	30%	0.303	51%	0.506	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.3	145.7	173.8	69.2	-91.5	0	0	0	110.1	Y27 I29 I44 A66	Y27-F42 VanDerWaalsContact CB-CZ 3.41Å; Y27-F42 HydrophobicContact CD1-CE1 4.49Å; Y27-F42 AromaticContact CD1-CZ 3.91Å; Y27-F42 HydrophobicContact CD1-CZ 3.91Å; Y27-F42 AromaticContact CD2-CD2 3.77Å; Y27-F42 HydrophobicContact CD2-CD2 3.77Å; Y27-F42 HydrophobicContact CD2-CE1 4.08Å; Y27-F42 AromaticContact CD2-CE2 3.04Å; Y27-F42 HydrophobicContact CD2-CE2 3.04Å; Y27-F42 AromaticContact CD2-CZ 3.23Å; Y27-F42 HydrophobicContact CD2-CZ 3.23Å; Y27-F42 HydrophobicContact CE1-CZ 4.48Å; Y27-F42 AromaticContact CE2-CE2 3.57Å; Y27-F42 HydrophobicContact CE2-CE2 3.57Å; Y27-F42 AromaticContact CE2-CZ 3.88Å; Y27-F42 HydrophobicContact CE2-CZ 3.88Å; Y27-F42 HydrophobicContact CG-CD1 4.49Å; Y27-F42 HydrophobicContact CG-CD2 4.38Å; Y27-F42 AromaticContact CG-CE1 3.75Å; Y27-F42 HydrophobicContact CG-CE1 3.75Å; Y27-F42 AromaticContact CG-CE2 3.61Å; Y27-F42 HydrophobicContact CG-CE2 3.61Å; Y27-F42 AromaticContact CG-CZ 3.23Å; Y27-F42 HydrophobicContact CG-CZ 3.23Å; Y27-F42 PolarHBondContact N-O 2.82Å; Y27-F42 PolarHBondContact O-N 3.41Å; I29-F42 HydrophobicContact CD1-CE1 4.28Å; F42-I44 HydrophobicContact CD2-CD1 4.05Å; F42-I44 HydrophobicContact CD2-CG1 3.76Å; F42-I44 HydrophobicContact CE2-CD1 3.64Å; F42-I44 HydrophobicContact CE2-CG1 3.83Å; F42-A66 HydrophobicContact CE1-CB 3.74Å; F42-A66 HydrophobicContact CZ-CB 3.78Å
43	Q	50.7	Low	46.3	Very low	101 Å²	101	88.4 Å²	88.4	47%	0.472	49%	0.489	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	120.1	177.1	-174.8	-178.3	8.2	0	0	108.6	A25 K45	A25-Q43 WeakPolarHBondContact O-CA 3.4Å; Q43-K45 HydrophobicContact CG-CG 3.97Å; Q43-K45 VanDerWaalsContact NE2-CE 3.32Å
44	I	49.5	Very low	45.9	Very low	18 Å²	18	86.5 Å²	86.5	9%	0.092	50%	0.496	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.1	120.1	173	-55.2	-173.6	0	0	0	107.3	S24 A25 Y27 F42 T49 I50 L53	S24-I44 CarbonylContact C-O 3.56Å; S24-I44 WeakPolarHBondContact CA-O 3.39Å; S24-I44 WeakPolarHBondContact CB-O 3.22Å; A25-I44 PolarHBondContact N-O 3.25Å; A25-I44 PolarHBondContact O-N 3.02Å; Y27-I44 HydrophobicContact CE2-CD1 4.41Å; F42-I44 HydrophobicContact CD2-CD1 4.05Å; F42-I44 HydrophobicContact CD2-CG1 3.76Å; F42-I44 HydrophobicContact CE2-CD1 3.64Å; F42-I44 HydrophobicContact CE2-CG1 3.83Å; I44-T49 HydrophobicContact CG2-CG2 4.24Å; I44-I50 HydrophobicContact CG2-CG1 4.29Å; I44-L53 HydrophobicContact CD1-CD1 3.42Å; I44-L53 VanDerWaalsContact CD1-CD1 3.42Å; I44-L53 HydrophobicContact CD1-CD2 4.44Å; I44-L53 HydrophobicContact CD1-CG 4.41Å
45	K	51	Low	45.4	Very low	154 Å²	154	88.6 Å²	88.6	67%	0.67	50%	0.495	S	S	*	.			trans	-107.2	9.2	-175.5	-68.5	-173.4	178.9	177.6	0	114.2	Q43	Q43-K45 HydrophobicContact CG-CG 3.97Å; Q43-K45 VanDerWaalsContact NE2-CE 3.32Å
46	S	44.2	Very low	44.7	Very low	50 Å²	50	89.2 Å²	89.2	35%	0.35	48%	0.48	S	S	.	.			trans	-143.3	135.2	-178	-175.5	0	0	0	0	112.6	T48 T49	S46-T48 PolarHBondContact O-N 3.03Å; S46-T48 PolarHBondContact OG-N 3.27Å; S46-T48 PolarHBondContact OG-OG1 3.28Å; S46-T49 PolarHBondContact O-N 3.44Å; S46-T49 VanDerWaalsContact O-N 3.16Å
47	K	47	Very low	44.4	Very low	179 Å²	179	90 Å²	90	78%	0.778	49%	0.489	S	S	*	.	H	α-helix	trans	-55.2	-33.5	172.3	-171.1	176.2	179.4	179.9	0	111.3	T49 I50	K47-T49 VanDerWaalsContact C-N 3.34Å; K47-T49 PolarHBondContact O-N 3.24Å; K47-I50 PolarHBondContact O-N 3.09Å
48	T	42.7	Very low	43.5	Very low	94 Å²	94	90.6 Å²	90.6	58%	0.577	50%	0.5	S	S	*	.	H	α-helix	trans	-72.4	-24.4	-178.9	-37.4	0	0	0	0	113.5	S46 I50	S46-T48 PolarHBondContact O-N 3.03Å; S46-T48 PolarHBondContact OG-N 3.27Å; S46-T48 PolarHBondContact OG-OG1 3.28Å; T48-I50 VanDerWaalsContact C-N 3.29Å
49	T	43.4	Very low	42.9	Very low	66 Å²	66	91.5 Å²	91.5	41%	0.405	51%	0.509	S	S	.	.	H	α-helix	trans	-79.3	-18.5	178.6	-44.1	0	0	0	0	111.6	I44 S46 K47 L53	I44-T49 HydrophobicContact CG2-CG2 4.24Å; S46-T49 PolarHBondContact O-N 3.44Å; S46-T49 VanDerWaalsContact O-N 3.16Å; K47-T49 VanDerWaalsContact C-N 3.34Å; K47-T49 PolarHBondContact O-N 3.24Å; T49-L53 WeakPolarHBondContact O-CD1 3.33Å; T49-L53 WeakPolarHBondContact O-CG 3.43Å; T49-L53 PolarHBondContact O-N 2.86Å
50	I	43.4	Very low	42.3	Very low	49 Å²	49	95.4 Å²	95.4	25%	0.251	52%	0.522	S	S	.	.	H	α-helix	trans	-71.8	-40.4	178.6	-61.3	175.8	0	0	0	111	I44 K47 T48 L53 Y70	I44-I50 HydrophobicContact CG2-CG1 4.29Å; K47-I50 PolarHBondContact O-N 3.09Å; T48-I50 VanDerWaalsContact C-N 3.29Å; I50-L53 WeakPolarHBondContact O-CB 3.17Å; I50-L53 PolarHBondContact O-N 3.02Å; I50-Y70 HydrophobicContact CG2-CE1 3.84Å; I50-Y70 VanDerWaalsContact CG2-OH 3.32Å; I50-Y70 WeakPolarHBondContact CG2-OH 3.45Å
51	D	40.9	Very low	42.3	Very low	126 Å²	126	98.1 Å²	98.1	67%	0.674	53%	0.533	S	S	*	.	H	α-helix	trans	-70.9	-34.3	177.2	-72.5	-44.4	0	0	0	112.5	L53 S54	D51-L53 VanDerWaalsContact C-N 3.32Å; D51-L53 PolarHBondContact O-N 3.04Å; D51-S54 PolarHBondContact O-OG 2.95Å
52	N	40.5	Very low	41.9	Very low	97 Å²	97	95.7 Å²	95.7	52%	0.519	51%	0.514	S	S	.	.	G	3₁₀ helix	trans	-82.2	-3.6	178.9	-73.6	-20.7	0	0	0	114.3	S54 M55	N52-S54 PolarHBondContact O-N 3.11Å; N52-M55 PolarHBondContact O-N 2.75Å; N52-M55 VanDerWaalsContact O-N 3.09Å
53	L	41.9	Very low	41.9	Very low	35 Å²	35	95 Å²	95	18%	0.183	52%	0.515	C	S	.	.	G	3₁₀ helix	trans	-65.8	-20	175.7	-94.4	150.5	0	0	0	112.9	I44 T49 I50 D51 M55 I56	I44-L53 HydrophobicContact CD1-CD1 3.42Å; I44-L53 VanDerWaalsContact CD1-CD1 3.42Å; I44-L53 HydrophobicContact CD1-CD2 4.44Å; I44-L53 HydrophobicContact CD1-CG 4.41Å; T49-L53 WeakPolarHBondContact O-CD1 3.33Å; T49-L53 WeakPolarHBondContact O-CG 3.43Å; T49-L53 PolarHBondContact O-N 2.86Å; I50-L53 WeakPolarHBondContact O-CB 3.17Å; I50-L53 PolarHBondContact O-N 3.02Å; D51-L53 VanDerWaalsContact C-N 3.32Å; D51-L53 PolarHBondContact O-N 3.04Å; L53-M55 PolarHBondContact O-N 2.94Å; L53-I56 HydrophobicContact CD2-CD1 4.04Å; L53-I56 PolarHBondContact O-N 2.86Å
54	S	37.7	Very low	41.7	Very low	99 Å²	99	98.8 Å²	98.8	69%	0.692	53%	0.526	S	S	*	.	G	3₁₀ helix	trans	-62.2	-20.5	171.2	65.2	0	0	0	0	113.2	D51 N52	D51-S54 PolarHBondContact O-OG 2.95Å; N52-S54 PolarHBondContact O-N 3.11Å
55	M	36.4	Very low	41.7	Very low	152 Å²	152	99.1 Å²	99.1	75%	0.749	53%	0.528	S	S	*	.	G	3₁₀ helix	trans	-92.7	-6.3	179.7	-66.4	-174.9	79.4	0	0	114.3	N52 L53 S57	N52-M55 PolarHBondContact O-N 2.75Å; N52-M55 VanDerWaalsContact O-N 3.09Å; L53-M55 PolarHBondContact O-N 2.94Å; M55-S57 PolarHBondContact O-N 2.81Å
56	I	37	Very low	41.7	Very low	92 Å²	92	92.2 Å²	92.2	47%	0.472	50%	0.5	S	S	.	.			trans	-83.5	62.1	176.3	-52.6	-178.5	0	0	0	109	L53 V63	L53-I56 HydrophobicContact CD2-CD1 4.04Å; L53-I56 PolarHBondContact O-N 2.86Å; I56-V63 HydrophobicContact CG2-CG1 4.18Å
57	S	31.8	Very low	41.9	Very low	104 Å²	104	93.5 Å²	93.5	73%	0.727	50%	0.502	S	S	*	.			trans	-94.8	75.6	166.2	-179.1	0	0	0	0	107.7	M55	M55-S57 PolarHBondContact O-N 2.81Å
58	T	32.2	Very low	42.1	Very low	122 Å²	122	89 Å²	89	75%	0.748	49%	0.486	S	S	*	.	S	Bend	trans	168.5	100.6	162.7	24.7	0	0	0	0	108.6
59	S	33	Very low	42.6	Very low	83 Å²	83	84.7 Å²	84.7	58%	0.58	46%	0.46	S	S	*	.	S	Bend	trans	148	97.9	151.6	-69.7	0	0	0	0	109.6	V63	S59-V63 WeakPolarHBondContact O-CG2 3.43Å
60	F	39	Very low	42.9	Very low	183 Å²	183	83 Å²	83	80%	0.803	45%	0.446	S	S	*	.	H	α-helix	trans	69.4	134.2	158.9	-70.2	-99.5	0	0	0	117.4	V62 V63	F60-V62 PolarHBondContact O-N 3.16Å; F60-V63 PolarHBondContact O-N 2.93Å
61	D	48.4	Very low	43.2	Very low	102 Å²	102	83.8 Å²	83.8	55%	0.545	46%	0.456	S	S	.	.	H	α-helix	trans	-37.2	-24	177.2	-113	-41.9	0	0	0	116.4	T65	D61-T65 PolarHBondContact O-N 3.42Å; D61-T65 PolarHBondContact O-OG1 2.98Å
62	V	43.8	Very low	43.6	Very low	34 Å²	34	81.8 Å²	81.8	21%	0.206	44%	0.444	C	S	.	.	H	α-helix	trans	-64.4	-41.5	177.2	-175.6	0	0	0	0	112.7	I29 F60 T65 A66	I29-V62 HydrophobicContact CD1-CG1 3.52Å; I29-V62 HydrophobicContact CG2-CG1 4.37Å; F60-V62 PolarHBondContact O-N 3.16Å; V62-T65 PolarHBondContact O-N 3.27Å; V62-A66 WeakPolarHBondContact O-CB 3.3Å; V62-A66 PolarHBondContact O-N 3.38Å
63	V	45.8	Very low	44	Very low	54 Å²	54	77.6 Å²	77.6	33%	0.327	42%	0.423	S	S	.	.	H	α-helix	trans	-69.8	-38.3	178.9	178.8	0	0	0	0	110.5	I56 S59 F60 A66 L67	I56-V63 HydrophobicContact CG2-CG1 4.18Å; S59-V63 WeakPolarHBondContact O-CG2 3.43Å; F60-V63 PolarHBondContact O-N 2.93Å; V63-A66 WeakPolarHBondContact O-CB 2.79Å; V63-A66 PolarHBondContact O-N 3.45Å; V63-L67 WeakPolarHBondContact O-CB 3.46Å; V63-L67 PolarHBondContact O-N 3.23Å
64	R	46.6	Very low	44.2	Very low	182 Å²	182	80.7 Å²	80.7	69%	0.687	44%	0.436	S	S	*	.	H	α-helix	trans	-63.2	-42.6	175	-161.5	178.7	-164	164.6	5.2	111.5	A66 L67 I68	R64-A66 VanDerWaalsContact C-N 3.32Å; R64-A66 PolarHBondContact O-N 3.43Å; R64-L67 PolarHBondContact O-N 3.32Å; R64-I68 HydrophobicContact CG-CD1 4.38Å; R64-I68 VanDerWaalsContact O-CG1 3.29Å; R64-I68 WeakPolarHBondContact O-CG1 3.38Å; R64-I68 PolarHBondContact O-N 3.34Å
65	T	49	Very low	44.4	Very low	25 Å²	25	80.9 Å²	80.9	15%	0.153	43%	0.429	C	S	.	.	H	α-helix	trans	-63.7	-39	174.8	-54.6	0	0	0	0	111.6	F6 V14 T16 D61 V62 A69	F6-T65 HydrophobicContact CD2-CG2 4.39Å; V14-T65 HydrophobicContact CG1-CG2 4.25Å; T16-T65 HydrophobicContact CG2-CG2 4.39Å; D61-T65 PolarHBondContact O-N 3.42Å; D61-T65 PolarHBondContact O-OG1 2.98Å; V62-T65 PolarHBondContact O-N 3.27Å; T65-A69 WeakPolarHBondContact O-CB 3.43Å; T65-A69 PolarHBondContact O-N 2.89Å
66	A	50.3	Low	44.7	Very low	8 Å²	8	78 Å²	78	7%	0.066	42%	0.42	C	S	.	.	H	α-helix	trans	-68	-39.4	177	0	0	0	0	0	112.9	I29 F42 V62 V63 R64 A69 Y70	I29-A66 HydrophobicContact CD1-CB 4.03Å; F42-A66 HydrophobicContact CE1-CB 3.74Å; F42-A66 HydrophobicContact CZ-CB 3.78Å; V62-A66 WeakPolarHBondContact O-CB 3.3Å; V62-A66 PolarHBondContact O-N 3.38Å; V63-A66 WeakPolarHBondContact O-CB 2.79Å; V63-A66 PolarHBondContact O-N 3.45Å; R64-A66 VanDerWaalsContact C-N 3.32Å; R64-A66 PolarHBondContact O-N 3.43Å; A66-A69 PolarHBondContact O-N 3.31Å; A66-Y70 WeakPolarHBondContact O-CB 3.36Å; A66-Y70 PolarHBondContact O-N 3Å
67	L	49.3	Very low	45	Very low	78 Å²	78	77.3 Å²	77.3	41%	0.408	42%	0.416	S	S	.	.	H	α-helix	trans	-64.4	-45.3	176.2	-166.3	76.6	0	0	0	110.9	V63 R64 Y70 S71	V63-L67 WeakPolarHBondContact O-CB 3.46Å; V63-L67 PolarHBondContact O-N 3.23Å; R64-L67 PolarHBondContact O-N 3.32Å; L67-Y70 PolarHBondContact O-N 2.75Å; L67-S71 PolarHBondContact O-N 3.34Å; L67-S71 PolarHBondContact O-OG 3.45Å
68	I	51.8	Low	45.5	Very low	85 Å²	85	79.7 Å²	79.7	44%	0.436	41%	0.414	S	S	.	.	H	α-helix	trans	-61.4	-46.4	175.3	-67.1	165.6	0	0	0	110.5	R64 Y70 S71 M72	R64-I68 HydrophobicContact CG-CD1 4.38Å; R64-I68 VanDerWaalsContact O-CG1 3.29Å; R64-I68 WeakPolarHBondContact O-CG1 3.38Å; R64-I68 PolarHBondContact O-N 3.34Å; I68-Y70 VanDerWaalsContact C-N 3.26Å; I68-Y70 PolarHBondContact O-N 3.43Å; I68-S71 PolarHBondContact O-N 3.19Å; I68-M72 HydrophobicContact CG2-CG 4.39Å; I68-M72 WeakPolarHBondContact O-CB 3.5Å; I68-M72 VanDerWaalsContact O-CG 3.29Å; I68-M72 WeakPolarHBondContact O-CG 3.41Å; I68-M72 PolarHBondContact O-N 3.31Å
69	A	52	Low	45.9	Very low	3 Å²	3	81.3 Å²	81.3	3%	0.025	41%	0.412	C	S	.	.	H	α-helix	trans	-61.4	-35.7	177.8	0	0	0	0	0	112.4	F6 T65 A66 A73	F6-A69 HydrophobicContact CE2-CB 4.03Å; F6-A69 HydrophobicContact CZ-CB 4.33Å; T65-A69 WeakPolarHBondContact O-CB 3.43Å; T65-A69 PolarHBondContact O-N 2.89Å; A66-A69 PolarHBondContact O-N 3.31Å; A69-A73 WeakPolarHBondContact O-CB 3.42Å; A69-A73 PolarHBondContact O-N 2.91Å
70	Y	49.9	Very low	46.2	Very low	30 Å²	30	80.6 Å²	80.6	12%	0.118	41%	0.412	C	S	.	.	H	α-helix	trans	-71.8	-48.2	176.5	-174.8	-111	0	0	0	112.7	Y27 I50 A66 L67 I68 M72 A73 E74	Y27-Y70 HydrophobicContact CE1-CD2 4.41Å; Y27-Y70 AromaticContact CZ-CD2 3.96Å; Y27-Y70 WeakPolarHBondContact OH-CD2 3.32Å; Y27-Y70 VanDerWaalsContact OH-CE2 3.3Å; Y27-Y70 WeakPolarHBondContact OH-CE2 3.45Å; I50-Y70 HydrophobicContact CG2-CE1 3.84Å; I50-Y70 VanDerWaalsContact CG2-OH 3.32Å; I50-Y70 WeakPolarHBondContact CG2-OH 3.45Å; A66-Y70 WeakPolarHBondContact O-CB 3.36Å; A66-Y70 PolarHBondContact O-N 3Å; L67-Y70 PolarHBondContact O-N 2.75Å; I68-Y70 VanDerWaalsContact C-N 3.26Å; I68-Y70 PolarHBondContact O-N 3.43Å; Y70-M72 PolarHBondContact O-N 2.93Å; Y70-A73 WeakPolarHBondContact O-CA 3.32Å; Y70-A73 WeakPolarHBondContact O-CB 3.45Å; Y70-A73 PolarHBondContact O-N 3.4Å; Y70-E74 HydrophobicContact CE1-CG 4.12Å; Y70-E74 HydrophobicContact CE2-CG 4.46Å; Y70-E74 PolarHBondContact O-N 3.03Å; Y70-E74 PolarHBondContact OH-OE1 3Å
71	S	49.1	Very low	46.5	Very low	66 Å²	66	80.1 Å²	80.1	46%	0.462	41%	0.41	S	S	.	.	H	α-helix	trans	-60.5	-35.4	176	-60.6	0	0	0	0	112.1	L67 I68 L75	L67-S71 PolarHBondContact O-N 3.34Å; L67-S71 PolarHBondContact O-OG 3.45Å; I68-S71 PolarHBondContact O-N 3.19Å; S71-L75 WeakPolarHBondContact O-CB 3.38Å; S71-L75 PolarHBondContact O-N 2.86Å
72	M	50.7	Low	45.9	Very low	84 Å²	84	77.4 Å²	77.4	41%	0.414	41%	0.406	S	S	.	.	H	α-helix	trans	-71.5	-35	173.2	-68.7	-153.1	83.5	0	0	112.6	L4 F6 I68 Y70 L75 V76	L4-M72 HydrophobicContact CD2-CB 4.38Å; F6-M72 HydrophobicContact CE1-SD 4.4Å; I68-M72 HydrophobicContact CG2-CG 4.39Å; I68-M72 WeakPolarHBondContact O-CB 3.5Å; I68-M72 VanDerWaalsContact O-CG 3.29Å; I68-M72 WeakPolarHBondContact O-CG 3.41Å; I68-M72 PolarHBondContact O-N 3.31Å; Y70-M72 PolarHBondContact O-N 2.93Å; M72-L75 PolarHBondContact O-N 3.46Å; M72-V76 WeakPolarHBondContact O-CB 3.42Å; M72-V76 WeakPolarHBondContact O-CG2 3.29Å; M72-V76 PolarHBondContact O-N 3.42Å
73	A	48	Very low	45.6	Very low	9 Å²	9	85.7 Å²	85.7	7%	0.074	44%	0.439	C	S	.	.	H	α-helix	trans	-65.7	-40.2	173.6	0	0	0	0	0	111.7	F18 A69 Y70 V76 I77	F18-A73 HydrophobicContact CD2-CB 4.32Å; F18-A73 HydrophobicContact CE2-CB 3.92Å; F18-A73 HydrophobicContact CZ-CB 4.26Å; A69-A73 WeakPolarHBondContact O-CB 3.42Å; A69-A73 PolarHBondContact O-N 2.91Å; Y70-A73 WeakPolarHBondContact O-CA 3.32Å; Y70-A73 WeakPolarHBondContact O-CB 3.45Å; Y70-A73 PolarHBondContact O-N 3.4Å; A73-V76 PolarHBondContact O-N 2.9Å; A73-I77 WeakPolarHBondContact O-CB 3.39Å; A73-I77 WeakPolarHBondContact O-CD1 3.2Å; A73-I77 WeakPolarHBondContact O-CG1 3.33Å; A73-I77 PolarHBondContact O-N 2.99Å
74	E	46.4	Very low	45	Very low	100 Å²	100	86.9 Å²	86.9	47%	0.467	46%	0.462	S	S	.	.	H	α-helix	trans	-65.3	-41.4	173.2	-73.6	-162.4	123.6	0	0	112.1	Y70 V76 I77 F78	Y70-E74 HydrophobicContact CE1-CG 4.12Å; Y70-E74 HydrophobicContact CE2-CG 4.46Å; Y70-E74 PolarHBondContact O-N 3.03Å; Y70-E74 PolarHBondContact OH-OE1 3Å; E74-V76 VanDerWaalsContact C-N 3.34Å; E74-V76 PolarHBondContact O-N 3.42Å; E74-I77 PolarHBondContact O-N 2.8Å; E74-F78 WeakPolarHBondContact O-CB 3.19Å; E74-F78 PolarHBondContact O-N 3.27Å
75	L	42.8	Very low	44.6	Very low	103 Å²	103	87.3 Å²	87.3	54%	0.539	49%	0.493	S	S	.	.	H	α-helix	trans	-62.9	-41	175.3	-172	66.6	0	0	0	111.9	S71 M72 F78 H79	S71-L75 WeakPolarHBondContact O-CB 3.38Å; S71-L75 PolarHBondContact O-N 2.86Å; M72-L75 PolarHBondContact O-N 3.46Å; L75-F78 PolarHBondContact O-N 3.45Å; L75-H79 WeakPolarHBondContact O-CB 3.39Å; L75-H79 PolarHBondContact O-N 3.46Å
76	V	42.7	Very low	44.3	Very low	91 Å²	91	90.5 Å²	90.5	55%	0.552	51%	0.51	S	S	*	.	H	α-helix	trans	-69	-36.5	176	171.8	0	0	0	0	111.3	M72 A73 E74 H79 A80	M72-V76 WeakPolarHBondContact O-CB 3.42Å; M72-V76 WeakPolarHBondContact O-CG2 3.29Å; M72-V76 PolarHBondContact O-N 3.42Å; A73-V76 PolarHBondContact O-N 2.9Å; E74-V76 VanDerWaalsContact C-N 3.34Å; E74-V76 PolarHBondContact O-N 3.42Å; V76-H79 PolarHBondContact O-N 2.92Å; V76-A80 WeakPolarHBondContact O-CA 3.49Å; V76-A80 WeakPolarHBondContact O-CB 3.46Å; V76-A80 PolarHBondContact O-N 2.85Å
77	I	43.3	Very low	44	Very low	77 Å²	77	94.8 Å²	94.8	40%	0.395	53%	0.533	S	S	.	.	H	α-helix	trans	-68.6	-40.9	174	-70	164.2	0	0	0	110.6	M20 A73 E74 H79 A80 F81	M20-I77 HydrophobicContact SD-CD1 4.37Å; A73-I77 WeakPolarHBondContact O-CB 3.39Å; A73-I77 WeakPolarHBondContact O-CD1 3.2Å; A73-I77 WeakPolarHBondContact O-CG1 3.33Å; A73-I77 PolarHBondContact O-N 2.99Å; E74-I77 PolarHBondContact O-N 2.8Å; I77-H79 VanDerWaalsContact C-N 3.32Å; I77-H79 PolarHBondContact O-N 3.43Å; I77-A80 PolarHBondContact O-N 2.85Å; I77-F81 HydrophobicContact CG2-CD2 4.17Å; I77-F81 WeakPolarHBondContact O-CB 2.99Å; I77-F81 PolarHBondContact O-N 3.38Å
78	F	41.1	Very low	43.7	Very low	155 Å²	155	95.7 Å²	95.7	68%	0.68	54%	0.54	S	S	*	.	H	α-helix	trans	-64	-36.8	175.7	-157.1	-90.2	0	0	0	111.4	E74 L75 G82	E74-F78 WeakPolarHBondContact O-CB 3.19Å; E74-F78 PolarHBondContact O-N 3.27Å; L75-F78 PolarHBondContact O-N 3.45Å; F78-G82 WeakPolarHBondContact O-CA 3.03Å; F78-G82 PolarHBondContact O-N 2.77Å
79	H	40.7	Very low	43.3	Very low	155 Å²	155	96.4 Å²	96.4	72%	0.718	55%	0.546	S	S	*	.	H	α-helix	trans	-79.6	-32.8	174.3	-95.7	-127.9	0	0	0	114.3	L75 V76 I77	L75-H79 WeakPolarHBondContact O-CB 3.39Å; L75-H79 PolarHBondContact O-N 3.46Å; V76-H79 PolarHBondContact O-N 2.92Å; I77-H79 VanDerWaalsContact C-N 3.32Å; I77-H79 PolarHBondContact O-N 3.43Å
80	A	39.6	Very low	42.7	Very low	69 Å²	69	102.2 Å²	102.2	57%	0.57	58%	0.579	S	S	*	*	H	α-helix	trans	-82.3	-28.5	-178.1	0	0	0	0	0	113	V76 I77	V76-A80 WeakPolarHBondContact O-CA 3.49Å; V76-A80 WeakPolarHBondContact O-CB 3.46Å; V76-A80 PolarHBondContact O-N 2.85Å; I77-A80 PolarHBondContact O-N 2.85Å
81	F	45.4	Very low	42.2	Very low	173 Å²	173	107 Å²	107	76%	0.759	61%	0.61	S	S	*	*	H	α-helix	trans	-121.1	-12.3	-177.9	-65.8	-84.6	0	0	0	113.8	I77 K83	I77-F81 HydrophobicContact CG2-CD2 4.17Å; I77-F81 WeakPolarHBondContact O-CB 2.99Å; I77-F81 PolarHBondContact O-N 3.38Å; F81-K83 VanDerWaalsContact C-N 3.33Å; F81-K83 PolarHBondContact O-N 3.25Å
82	G	34.9	Very low	41.7	Very low	45 Å²	45	109.9 Å²	109.9	46%	0.464	62%	0.62	S	S	.	*			trans	-89.9	61	171.6	0	0	0	0	0	112.5	F78	F78-G82 WeakPolarHBondContact O-CA 3.03Å; F78-G82 PolarHBondContact O-N 2.77Å
83	K	39.1	Very low	41.1	Very low	208 Å²	208	111.9 Å²	111.9	90%	0.904	64%	0.636	S	S	*	*			trans	-102	93.8	144.1	-81.6	-168.4	176.4	178.9	0	105.5	F81	F81-K83 VanDerWaalsContact C-N 3.33Å; F81-K83 PolarHBondContact O-N 3.25Å
84	G	32.5	Very low	40.5	Very low	78 Å²	78	120.5 Å²	120.5	80%	0.804	68%	0.683	S	S	*	*			trans	171.5	44.1	-175.4	0	0	0	0	0	116.5
85	S	37.4	Very low	39.9	Very low	192 Å²	192	122.4 Å²	122.4	100%	1.343	70%	0.702	S	S	*	*			trans	-154.2	0	134.7	-166	0	0	0	0	109.3

Retrieved 85 of 85 residues in 17.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).