A0A5K4F931_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F931, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 116 aa.

						>A0A5K4F931_SCHMA|A0A5K4F931
MYPSLSTSSSSSSSSSPSSVSSSSSASLPKVLSSPSLPKSQLSIDEYLTLNNKFNDDDPFNPYSDYRSNYYKDYYYYNHHPKMSKRADLRDLSIHSDMAFIRKLFDQKNHELLRLG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	68.2	Low	62.6	Low	240 Å²	240	143.9 Å²	143.9	100%	1.182	85%	0.853	S	S	*	*				0	111.6	0	-69.1	176.2	89.6	0	0	108
2	Y	65.1	Low	62.1	Low	230 Å²	230	142.1 Å²	142.1	90%	0.902	85%	0.853	S	S	*	*			trans	-133.9	146.1	166.1	-81.7	-82.3	0	0	0	106.6
3	P	70.2	Confident	61.3	Low	123 Å²	123	139.6 Å²	139.6	80%	0.799	85%	0.847	S	S	*	*			trans	-74.6	130.7	-175.1	29.6	-31.7	0	0	0	110.9
4	S	71.2	Confident	60.4	Low	104 Å²	104	137.6 Å²	137.6	73%	0.727	84%	0.842	S	S	*	*			trans	-70.4	127.3	168.3	48.5	0	0	0	0	110.4	S6	S4-S6 PolarHBondContact O-N 3.35Å
5	L	67.7	Low	60	Low	176 Å²	176	136.5 Å²	136.5	92%	0.921	84%	0.842	S	S	*	*			trans	-78.4	105.9	166.5	-79.1	158.8	0	0	0	108.7
6	S	61.4	Low	59.3	Low	102 Å²	102	135.4 Å²	135.4	71%	0.713	84%	0.841	S	S	*	*			trans	-75.8	126	172.8	-55.6	0	0	0	0	110.4	S4 S8	S4-S6 PolarHBondContact O-N 3.35Å; S6-S8 PolarHBondContact O-N 3.49Å
7	T	56.7	Low	58.6	Low	133 Å²	133	134.2 Å²	134.2	82%	0.816	84%	0.836	S	S	*	*			trans	-75.3	113.9	170.7	47.8	0	0	0	0	110	S9	T7-S9 PolarHBondContact O-N 3.27Å
8	S	56	Low	57.8	Low	121 Å²	121	132.7 Å²	132.7	85%	0.846	83%	0.831	S	S	*	*			trans	-81.6	98.5	169.6	-47.8	0	0	0	0	109.5	S6	S6-S8 PolarHBondContact O-N 3.49Å
9	S	57.1	Low	56.8	Low	114 Å²	114	131.2 Å²	131.2	80%	0.797	83%	0.826	S	S	*	*			trans	-74.9	118.9	165.2	46.5	0	0	0	0	109.9	T7	T7-S9 PolarHBondContact O-N 3.27Å
10	S	59.1	Low	56.4	Low	119 Å²	119	132.3 Å²	132.3	83%	0.832	83%	0.831	S	S	*	*			trans	-117.9	100.1	162.6	55.6	0	0	0	0	109.1
11	S	56.2	Low	55.6	Low	121 Å²	121	131.1 Å²	131.1	85%	0.846	83%	0.827	S	S	*	*			trans	-68.9	128.5	165	46.8	0	0	0	0	110.5
12	S	56.1	Low	54.2	Low	122 Å²	122	125 Å²	125	85%	0.853	81%	0.808	S	S	*	*			trans	-129.4	116.3	158.4	54.9	0	0	0	0	108.7
13	S	51.8	Low	53.3	Low	110 Å²	110	119.5 Å²	119.5	77%	0.769	80%	0.803	S	S	*	*			trans	-83.7	138.4	-172.8	46.7	0	0	0	0	113.4
14	S	48.5	Very low	52.2	Low	111 Å²	111	118.6 Å²	118.6	78%	0.776	80%	0.8	S	S	*	*			trans	52.8	111.9	139.8	63.6	0	0	0	0	121
15	S	54.4	Low	51.1	Low	122 Å²	122	119.7 Å²	119.7	85%	0.853	81%	0.807	S	S	*	*			trans	-157.7	103.7	133.6	59.8	0	0	0	0	110.9
16	S	49.7	Very low	50.2	Low	118 Å²	118	115.6 Å²	115.6	83%	0.825	80%	0.799	S	S	*	*			trans	-109.5	167.7	156.1	-53	0	0	0	0	106.8
17	P	47.5	Very low	49.8	Very low	116 Å²	116	116.2 Å²	116.2	75%	0.753	80%	0.803	S	S	*	*			cis	-141.4	-176.3	7.4	38.7	-17.7	0	0	0	115.3
18	S	43.9	Very low	49.7	Very low	107 Å²	107	117.5 Å²	117.5	75%	0.748	80%	0.804	S	S	*	*			trans	124.9	117.9	138.4	72.2	0	0	0	0	118.7
19	S	39.5	Very low	49.7	Very low	104 Å²	104	117.3 Å²	117.3	73%	0.727	80%	0.8	S	S	*	*			trans	54.2	105.5	148.5	59.9	0	0	0	0	120.6
20	V	48.4	Very low	49.5	Very low	153 Å²	153	121.1 Å²	121.1	93%	0.927	80%	0.802	S	S	*	*			trans	-139.6	127.2	137.5	-80.7	0	0	0	0	110.5
21	S	39.3	Very low	49.3	Very low	107 Å²	107	121.8 Å²	121.8	75%	0.748	80%	0.801	S	S	*	*			trans	-77	158.8	-173	-48.3	0	0	0	0	112.8
22	S	39.5	Very low	49.3	Very low	111 Å²	111	123.8 Å²	123.8	78%	0.776	80%	0.802	S	S	*	*			trans	62.8	106.5	148.2	54.9	0	0	0	0	119
23	S	46	Very low	49	Very low	115 Å²	115	123.2 Å²	123.2	80%	0.804	80%	0.798	S	S	*	*				-172.2	134	122.2	39.5	0	0	0	0	113.1
24	S	47.6	Very low	49.5	Very low	105 Å²	105	123 Å²	123	73%	0.734	80%	0.796	S	S	*	*			trans	60.6	93.4	154.8	58	0	0	0	0	119.1	A26	S24-A26 VanDerWaalsContact C-N 3.31Å; S24-A26 PolarHBondContact O-N 3.25Å
25	S	46.1	Very low	49.8	Very low	126 Å²	126	123.5 Å²	123.5	88%	0.881	80%	0.797	S	S	*	*			trans	-58.5	93.8	145.8	52.5	0	0	0	0	109.3	S27	S25-S27 PolarHBondContact O-N 3.27Å; S25-S27 VanDerWaalsContact O-N 3.15Å
26	A	50.1	Low	50	Low	91 Å²	91	123 Å²	123	75%	0.752	79%	0.793	S	S	*	*			trans	-63.8	110.5	170.6	0	0	0	0	0	108.9	S24 L28	S24-A26 VanDerWaalsContact C-N 3.31Å; S24-A26 PolarHBondContact O-N 3.25Å; A26-L28 PolarHBondContact O-N 3.01Å
27	S	52.3	Low	50.4	Low	114 Å²	114	124.8 Å²	124.8	80%	0.797	79%	0.793	S	S	*	*	P	Polyproline II helix	trans	-60.8	129.9	173.5	39.8	0	0	0	0	110.2	S25	S25-S27 PolarHBondContact O-N 3.27Å; S25-S27 VanDerWaalsContact O-N 3.15Å
28	L	55.3	Low	50.8	Low	161 Å²	161	124.5 Å²	124.5	84%	0.843	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-58.4	140.8	178.1	-67.9	167.4	0	0	0	110.6	A26 K30	A26-L28 PolarHBondContact O-N 3.01Å; L28-K30 PolarHBondContact O-N 3.29Å
29	P	54.6	Low	51.3	Low	117 Å²	117	129.7 Å²	129.7	76%	0.76	80%	0.8	S	S	*	*	P	Polyproline II helix	trans	-64.6	128.1	175.9	26.1	-30.5	0	0	0	109.5	V31	P29-V31 PolarHBondContact O-N 2.84Å
30	K	54.8	Low	52.1	Low	193 Å²	193	129 Å²	129	84%	0.839	80%	0.795	S	S	*	*	P	Polyproline II helix	trans	-52.6	116.6	176.4	-159.1	168.6	-176.9	175.7	0	108.9	L28 L32	L28-K30 PolarHBondContact O-N 3.29Å; K30-L32 PolarHBondContact O-N 3Å
31	V	54.2	Low	52.6	Low	134 Å²	134	131.1 Å²	131.1	81%	0.812	80%	0.795	S	S	*	*			trans	-52.9	104.9	174.7	174.9	0	0	0	0	108.3	P29 S33	P29-V31 PolarHBondContact O-N 2.84Å; V31-S33 PolarHBondContact O-N 2.85Å; V31-S33 VanDerWaalsContact O-N 3.08Å
32	L	55.7	Low	53.8	Low	163 Å²	163	130.2 Å²	130.2	85%	0.853	78%	0.781	S	S	*	*			trans	-67.6	104.6	166.1	-100.3	81.2	0	0	0	106.6	K30 S34	K30-L32 PolarHBondContact O-N 3Å; L32-S34 PolarHBondContact O-N 3.36Å; L32-S34 VanDerWaalsContact O-N 3.17Å
33	S	50.8	Low	55.4	Low	110 Å²	110	127.8 Å²	127.8	77%	0.769	76%	0.764	S	S	*	*	P	Polyproline II helix	trans	-51.4	117.7	166.5	46	0	0	0	0	109.2	V31	V31-S33 PolarHBondContact O-N 2.85Å; V31-S33 VanDerWaalsContact O-N 3.08Å
34	S	61.1	Low	56.5	Low	104 Å²	104	128.3 Å²	128.3	73%	0.727	76%	0.757	S	S	*	*	P	Polyproline II helix	trans	-61.4	147.4	173.5	35.8	0	0	0	0	110.7	L32 S36	L32-S34 PolarHBondContact O-N 3.36Å; L32-S34 VanDerWaalsContact O-N 3.17Å; S34-S36 PolarHBondContact O-N 2.95Å
35	P	55.9	Low	57.4	Low	123 Å²	123	128.7 Å²	128.7	80%	0.799	75%	0.75	S	S	*	*	P	Polyproline II helix	trans	-62.7	126.8	177.1	26	-31.7	0	0	0	108.9	L37	P35-L37 PolarHBondContact O-N 3.35Å
36	S	58.5	Low	58.4	Low	112 Å²	112	127.5 Å²	127.5	78%	0.783	73%	0.731	S	S	*	*	P	Polyproline II helix	trans	-58.3	124.1	173.9	54.3	0	0	0	0	109.5	S34	S34-S36 PolarHBondContact O-N 2.95Å
37	L	56.9	Low	59.1	Low	155 Å²	155	130.2 Å²	130.2	81%	0.812	72%	0.723	S	S	*	*	P	Polyproline II helix	trans	-52	140.3	169.5	-76.4	124	0	0	0	109.6	P35 K39	P35-L37 PolarHBondContact O-N 3.35Å; L37-K39 PolarHBondContact O-N 3.03Å
38	P	56.7	Low	59.7	Low	110 Å²	110	129 Å²	129	71%	0.714	71%	0.707	S	S	*	*	P	Polyproline II helix	trans	-59.3	118.5	175.2	23.8	-30.7	0	0	0	108.9	S40	P38-S40 PolarHBondContact O-N 3.25Å
39	K	54.3	Low	60.3	Low	216 Å²	216	125 Å²	125	94%	0.939	69%	0.689	S	S	*	*			trans	-71	81	169.2	-70.5	175.4	178.7	175.2	0	108.2	L37	L37-K39 PolarHBondContact O-N 3.03Å
40	S	56.1	Low	60.8	Low	90 Å²	90	123.9 Å²	123.9	63%	0.629	68%	0.676	S	S	*	*			trans	-141	65.2	164.9	65.4	0	0	0	0	108.9	P38 L42	P38-S40 PolarHBondContact O-N 3.25Å; S40-L42 VanDerWaalsContact C-N 3.26Å; S40-L42 PolarHBondContact O-N 3.15Å; S40-L42 VanDerWaalsContact O-N 3.08Å
41	Q	59.6	Low	61.1	Low	197 Å²	197	118.1 Å²	118.1	92%	0.921	66%	0.655	S	S	*	*			trans	-68.8	95.8	155.3	-86.6	175.5	-16.2	0	0	106	S43	Q41-S43 PolarHBondContact O-N 3.5Å
42	L	63.4	Low	61.4	Low	87 Å²	87	116.8 Å²	116.8	46%	0.455	64%	0.643	S	S	.	*			trans	-49.4	135.3	156.8	-77.6	154.8	0	0	0	106.8	S40 E46 L50	S40-L42 VanDerWaalsContact C-N 3.26Å; S40-L42 PolarHBondContact O-N 3.15Å; S40-L42 VanDerWaalsContact O-N 3.08Å; L42-E46 HydrophobicContact CB-CB 4.22Å; L42-E46 HydrophobicContact CD2-CB 3.9Å; L42-E46 VanDerWaalsContact CD2-CD 3.48Å; L42-E46 HydrophobicContact CD2-CG 3.98Å; L42-E46 WeakPolarHBondContact CD2-OE2 3.36Å; L42-L50 HydrophobicContact CD1-CD1 4.43Å
43	S	72.7	Confident	61.4	Low	60 Å²	60	115.9 Å²	115.9	42%	0.42	63%	0.632	S	S	.	*			trans	-58.3	149.5	172.9	62.3	0	0	0	0	109.2	Q41 D45 E46 Y47	Q41-S43 PolarHBondContact O-N 3.5Å; S43-D45 PolarHBondContact O-N 3.48Å; S43-D45 VanDerWaalsContact O-N 3.08Å; S43-E46 PolarHBondContact N-OE2 3.43Å; S43-E46 WeakPolarHBondContact O-CB 3.31Å; S43-E46 PolarHBondContact O-N 3.48Å; S43-E46 WeakPolarHBondContact OG-CB 3.24Å; S43-E46 PolarHBondContact OG-N 3.02Å; S43-Y47 PolarHBondContact O-N 2.87Å
44	I	69.2	Low	61.7	Low	127 Å²	127	118.6 Å²	118.6	65%	0.651	63%	0.63	S	S	*	*	H	α-helix	trans	-51.2	-35.8	177.7	-106.4	75.6	0	0	0	110.5	Y47 L48	I44-Y47 PolarHBondContact O-N 2.77Å; I44-L48 HydrophobicContact CG2-CD1 3.83Å; I44-L48 WeakPolarHBondContact O-CB 3.17Å; I44-L48 WeakPolarHBondContact O-CG 3.36Å; I44-L48 PolarHBondContact O-N 3.15Å
45	D	66.6	Low	61.3	Low	112 Å²	112	120.1 Å²	120.1	60%	0.599	63%	0.63	S	S	*	*	H	α-helix	trans	-68.8	-38.5	179.7	-56.9	-30.5	0	0	0	112.3	S43 L48 T49	S43-D45 PolarHBondContact O-N 3.48Å; S43-D45 VanDerWaalsContact O-N 3.08Å; D45-L48 PolarHBondContact O-N 3.07Å; D45-T49 WeakPolarHBondContact O-CB 3.5Å; D45-T49 PolarHBondContact O-N 3.46Å; D45-T49 PolarHBondContact O-OG1 3.24Å
46	E	67.1	Low	61.3	Low	102 Å²	102	120.6 Å²	120.6	48%	0.477	63%	0.626	S	S	.	*	H	α-helix	trans	-65.1	-41.9	173	-118.3	171.5	162.4	0	0	111.3	L42 S43 T49 L50	L42-E46 HydrophobicContact CB-CB 4.22Å; L42-E46 HydrophobicContact CD2-CB 3.9Å; L42-E46 VanDerWaalsContact CD2-CD 3.48Å; L42-E46 HydrophobicContact CD2-CG 3.98Å; L42-E46 WeakPolarHBondContact CD2-OE2 3.36Å; S43-E46 PolarHBondContact N-OE2 3.43Å; S43-E46 WeakPolarHBondContact O-CB 3.31Å; S43-E46 PolarHBondContact O-N 3.48Å; S43-E46 WeakPolarHBondContact OG-CB 3.24Å; S43-E46 PolarHBondContact OG-N 3.02Å; E46-T49 PolarHBondContact O-N 3.5Å; E46-L50 VanDerWaalsContact O-CG 3.27Å; E46-L50 WeakPolarHBondContact O-CG 3.14Å; E46-L50 PolarHBondContact O-N 3.46Å
47	Y	65.1	Low	61.1	Low	148 Å²	148	121.7 Å²	121.7	58%	0.58	62%	0.624	S	S	*	*	H	α-helix	trans	-64.2	-42.4	176.5	-176.3	-96.8	0	0	0	111.8	S43 I44 N51	S43-Y47 PolarHBondContact O-N 2.87Å; I44-Y47 PolarHBondContact O-N 2.77Å; Y47-N51 WeakPolarHBondContact CD1-ND2 3.36Å; Y47-N51 WeakPolarHBondContact CE1-ND2 3.29Å; Y47-N51 WeakPolarHBondContact CE2-ND2 3.49Å; Y47-N51 PolarHBondContact O-N 3.28Å; Y47-N51 VanDerWaalsContact O-N 3.12Å; Y47-N51 PolarHBondContact O-ND2 3.02Å
48	L	64.6	Low	61	Low	88 Å²	88	119.5 Å²	119.5	46%	0.461	61%	0.612	S	S	.	*	H	α-helix	trans	-67.6	-39.9	176.8	-77.8	161.1	0	0	0	112.1	I44 D45 L50 N51 N52	I44-L48 HydrophobicContact CG2-CD1 3.83Å; I44-L48 WeakPolarHBondContact O-CB 3.17Å; I44-L48 WeakPolarHBondContact O-CG 3.36Å; I44-L48 PolarHBondContact O-N 3.15Å; D45-L48 PolarHBondContact O-N 3.07Å; L48-L50 VanDerWaalsContact C-N 3.33Å; L48-L50 PolarHBondContact O-N 3.03Å; L48-N51 PolarHBondContact O-N 2.93Å; L48-N52 WeakPolarHBondContact O-CB 3.32Å; L48-N52 PolarHBondContact O-N 2.85Å
49	T	69	Low	61.1	Low	77 Å²	77	119.9 Å²	119.9	47%	0.472	62%	0.615	S	S	.	*	H	α-helix	trans	-63.9	-39.6	177.6	-58.4	0	0	0	0	111.7	D45 E46 K53	D45-T49 WeakPolarHBondContact O-CB 3.5Å; D45-T49 PolarHBondContact O-N 3.46Å; D45-T49 PolarHBondContact O-OG1 3.24Å; E46-T49 PolarHBondContact O-N 3.5Å; T49-K53 WeakPolarHBondContact O-CG 3.4Å
50	L	65.6	Low	61.1	Low	93 Å²	93	117.9 Å²	117.9	49%	0.487	61%	0.606	S	S	.	*	H	α-helix	trans	-68.4	-38	176.7	-71	169.8	0	0	0	112.1	L42 E46 L48	L42-L50 HydrophobicContact CD1-CD1 4.43Å; E46-L50 VanDerWaalsContact O-CG 3.27Å; E46-L50 WeakPolarHBondContact O-CG 3.14Å; E46-L50 PolarHBondContact O-N 3.46Å; L48-L50 VanDerWaalsContact C-N 3.33Å; L48-L50 PolarHBondContact O-N 3.03Å
51	N	60.5	Low	60.9	Low	73 Å²	73	118 Å²	118	39%	0.39	60%	0.6	S	S	.	*	H	α-helix	trans	-80.6	-27.1	-178.5	-74.4	-60.3	0	0	0	113.9	Y47 L48	Y47-N51 WeakPolarHBondContact CD1-ND2 3.36Å; Y47-N51 WeakPolarHBondContact CE1-ND2 3.29Å; Y47-N51 WeakPolarHBondContact CE2-ND2 3.49Å; Y47-N51 PolarHBondContact O-N 3.28Å; Y47-N51 VanDerWaalsContact O-N 3.12Å; Y47-N51 PolarHBondContact O-ND2 3.02Å; L48-N51 PolarHBondContact O-N 2.93Å
52	N	59.4	Low	60.7	Low	106 Å²	106	113.5 Å²	113.5	57%	0.567	59%	0.588	S	S	*	*	H	α-helix	trans	-76.5	-23.4	176.3	-81.7	0.4	0	0	0	113.2	L48 F54 N55	L48-N52 WeakPolarHBondContact O-CB 3.32Å; L48-N52 PolarHBondContact O-N 2.85Å; N52-F54 PolarHBondContact O-N 2.92Å; N52-N55 PolarHBondContact O-N 2.96Å
53	K	57.3	Low	60.1	Low	143 Å²	143	118.9 Å²	118.9	62%	0.622	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.9	-10	177.9	-77.4	171.3	177.5	-82.3	0	114.7	T49	T49-K53 WeakPolarHBondContact O-CG 3.4Å
54	F	55.2	Low	59	Low	167 Å²	167	120.8 Å²	120.8	73%	0.732	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.9	-4.8	178.5	-86.8	-83.9	0	0	0	114	N52	N52-F54 PolarHBondContact O-N 2.92Å
55	N	53.9	Low	57.9	Low	136 Å²	136	120.9 Å²	120.9	73%	0.727	62%	0.619	S	S	*	*	S	Bend	trans	-105.7	0.2	-178.2	-78.3	-29.9	0	0	0	114.1	N52	N52-N55 PolarHBondContact O-N 2.96Å
56	D	55	Low	57.1	Low	133 Å²	133	126.4 Å²	126.4	71%	0.711	63%	0.633	S	S	*	*			trans	-92.3	0.8	177.6	-67.6	-32.7	0	0	0	113.2	D58	D56-D58 PolarHBondContact O-N 3.25Å; D56-D58 VanDerWaalsContact O-N 3.13Å
57	D	55	Low	56.2	Low	136 Å²	136	132.6 Å²	132.6	73%	0.727	65%	0.652	S	S	*	*	S	Bend	trans	-87.1	83.1	174.7	-70.4	-39.9	0	0	0	110.5
58	D	54.6	Low	55.3	Low	108 Å²	108	130.9 Å²	130.9	58%	0.578	66%	0.661	S	S	*	*			trans	-36.8	119.2	169.3	-170.6	-6.1	0	0	0	113.6	D56 F60	D56-D58 PolarHBondContact O-N 3.25Å; D56-D58 VanDerWaalsContact O-N 3.13Å; D58-F60 PolarHBondContact O-N 3.39Å; D58-F60 PolarHBondContact OD1-N 3.28Å
59	P	58.2	Low	54.6	Low	118 Å²	118	131.2 Å²	131.2	77%	0.766	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.6	1.9	-179.1	26.8	-32.4	0	0	0	114.6
60	F	55.8	Low	53.9	Low	174 Å²	174	138 Å²	138	76%	0.763	68%	0.682	S	S	*	*	T	Hydrogen-bonded Turn	trans	-112.2	24.8	-176.5	-78.9	-82.4	0	0	0	115.5	D58 P62	D58-F60 PolarHBondContact O-N 3.39Å; D58-F60 PolarHBondContact OD1-N 3.28Å; F60-P62 WeakPolarHBondContact O-CD 3.24Å
61	N	50.7	Low	53.3	Low	94 Å²	94	144 Å²	144	50%	0.503	70%	0.7	S	S	.	*			trans	-97.8	93.7	173.5	-169.3	3	0	0	0	112.9	Y63	N61-Y63 PolarHBondContact O-N 3.31Å; N61-Y63 VanDerWaalsContact O-N 3.13Å; N61-Y63 PolarHBondContact OD1-N 3.07Å
62	P	56.1	Low	53	Low	102 Å²	102	148 Å²	148	66%	0.662	71%	0.714	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.7	15.2	177.1	32.8	-37.8	0	0	0	114.4	F60	F60-P62 WeakPolarHBondContact O-CD 3.24Å
63	Y	49.9	Very low	52.7	Low	200 Å²	200	147.4 Å²	147.4	78%	0.784	71%	0.711	S	S	*	*	T	Hydrogen-bonded Turn	trans	-117.3	16.1	-175.6	-67.4	-77	0	0	0	115.3	N61	N61-Y63 PolarHBondContact O-N 3.31Å; N61-Y63 VanDerWaalsContact O-N 3.13Å; N61-Y63 PolarHBondContact OD1-N 3.07Å
64	S	50.1	Low	52.6	Low	99 Å²	99	149.5 Å²	149.5	69%	0.692	72%	0.716	S	S	*	*			trans	-87.5	-3	178.5	61.1	0	0	0	0	114.8
65	D	46.6	Very low	52.6	Low	130 Å²	130	150 Å²	150	70%	0.695	71%	0.714	S	S	*	*			trans	-73.7	137.1	166.7	-70.6	-33.2	0	0	0	109.4
66	Y	50.2	Low	52.7	Low	227 Å²	227	150.8 Å²	150.8	89%	0.89	71%	0.708	S	S	*	*	S	Bend	trans	86.3	67.5	-179.4	-61.9	-93.5	0	0	0	117.2
67	R	46.5	Very low	52.8	Low	233 Å²	233	153.5 Å²	153.5	88%	0.879	71%	0.71	S	S	*	*	S	Bend	trans	-170.3	109.4	134.7	-110.4	161.5	168.8	-149	-3.1	113.3
68	S	47	Very low	53	Low	111 Å²	111	153 Å²	153	78%	0.776	71%	0.707	S	S	*	*			trans	60.7	82.4	137.4	177.4	0	0	0	0	117.8
69	N	49.9	Very low	53.2	Low	96 Å²	96	154.8 Å²	154.8	51%	0.513	71%	0.712	S	S	.	*			trans	-139.3	13.1	164.2	-85.8	-38.3	0	0	0	116.9	Y71 K72	N69-Y71 PolarHBondContact O-N 3.39Å; N69-K72 PolarHBondContact O-N 3.33Å
70	Y	53.9	Low	53.2	Low	219 Å²	219	154.1 Å²	154.1	86%	0.859	70%	0.698	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.9	-9.7	179.3	-84.7	-79.9	0	0	0	115.8
71	Y	53.8	Low	53.5	Low	219 Å²	219	151.3 Å²	151.3	86%	0.859	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105	-13.8	-179.3	-99.4	-85.2	0	0	0	115.5	N69	N69-Y71 PolarHBondContact O-N 3.39Å
72	K	54.3	Low	54.3	Low	158 Å²	158	156.6 Å²	156.6	69%	0.687	72%	0.715	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.4	-19.2	-178.5	-79.2	-172.2	176.3	-178.7	0	114	N69 Y74	N69-K72 PolarHBondContact O-N 3.33Å; K72-Y74 VanDerWaalsContact C-N 3.32Å; K72-Y74 PolarHBondContact O-N 3.45Å
73	D	53.3	Low	54.4	Low	93 Å²	93	160.4 Å²	160.4	50%	0.497	73%	0.727	S	S	.	*	H	α-helix	trans	-72.4	-25.1	-177	-63.7	-20	0	0	0	113.2	Y75 Y76	D73-Y75 VanDerWaalsContact C-N 3.34Å; D73-Y75 PolarHBondContact O-N 3.07Å; D73-Y76 PolarHBondContact O-N 2.92Å
74	Y	54.1	Low	54.7	Low	186 Å²	186	156.1 Å²	156.1	73%	0.729	73%	0.726	S	S	*	*	H	α-helix	trans	-69.9	-26.9	-178.3	-110.2	-86.5	0	0	0	114.3	K72 N78	K72-Y74 VanDerWaalsContact C-N 3.32Å; K72-Y74 PolarHBondContact O-N 3.45Å; Y74-N78 PolarHBondContact O-ND2 3.46Å
75	Y	56.8	Low	55.5	Low	179 Å²	179	160.8 Å²	160.8	70%	0.702	73%	0.734	S	S	*	*	H	α-helix	trans	-92.1	-26.1	178.6	-81.8	-84	0	0	0	113	D73	D73-Y75 VanDerWaalsContact C-N 3.34Å; D73-Y75 PolarHBondContact O-N 3.07Å
76	Y	55.5	Low	56.3	Low	152 Å²	152	166 Å²	166	60%	0.596	74%	0.744	S	S	*	*	H	α-helix	trans	-70.9	-43	-178.7	-164.6	-104.4	0	0	0	111.5	D73 N78 H80	D73-Y76 PolarHBondContact O-N 2.92Å; Y76-N78 VanDerWaalsContact C-N 3.35Å; Y76-N78 PolarHBondContact O-N 3.3Å; Y76-H80 AromaticContact CD1-NE2 3.84Å; Y76-H80 AromaticContact CE1-NE2 3.44Å; Y76-H80 WeakPolarHBondContact CE1-NE2 3.42Å; Y76-H80 AromaticContact CE2-NE2 3.68Å; Y76-H80 AromaticContact CZ-CE1 3.99Å; Y76-H80 AromaticContact CZ-NE2 3.34Å; Y76-H80 VanDerWaalsContact CZ-NE2 3.34Å; Y76-H80 PolarHBondContact O-CD2 2.94Å
77	Y	57.2	Low	57.1	Low	190 Å²	190	159 Å²	159	75%	0.745	73%	0.733	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.2	-14.3	-174.6	-90	-83.5	0	0	0	116
78	N	58.5	Low	58	Low	125 Å²	125	152.3 Å²	152.3	67%	0.668	72%	0.715	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.5	-10.6	-175.3	-79.9	-40.9	0	0	0	115.1	Y74 Y76	Y74-N78 PolarHBondContact O-ND2 3.46Å; Y76-N78 VanDerWaalsContact C-N 3.35Å; Y76-N78 PolarHBondContact O-N 3.3Å
79	H	59.9	Low	58.7	Low	146 Å²	146	153.3 Å²	153.3	68%	0.676	71%	0.711	S	S	*	*	S	Bend	trans	-109.6	-2	-175.9	-75.9	-61.9	0	0	0	115	P81	H79-P81 VanDerWaalsContact O-CD 3.27Å; H79-P81 WeakPolarHBondContact O-CD 3.36Å
80	H	56.3	Low	59.4	Low	104 Å²	104	159.1 Å²	159.1	48%	0.481	73%	0.725	S	S	.	*	S	Bend	trans	-74	120.5	170.4	-71.2	-72.5	0	0	0	109.3	Y76 K82	Y76-H80 AromaticContact CD1-NE2 3.84Å; Y76-H80 AromaticContact CE1-NE2 3.44Å; Y76-H80 WeakPolarHBondContact CE1-NE2 3.42Å; Y76-H80 AromaticContact CE2-NE2 3.68Å; Y76-H80 AromaticContact CZ-CE1 3.99Å; Y76-H80 AromaticContact CZ-NE2 3.34Å; Y76-H80 VanDerWaalsContact CZ-NE2 3.34Å; Y76-H80 PolarHBondContact O-CD2 2.94Å; H80-K82 PolarHBondContact O-N 3.47Å
81	P	63.1	Low	59.6	Low	114 Å²	114	155.5 Å²	155.5	74%	0.74	72%	0.721	S	S	*	*			trans	-56.6	114.5	164.9	21.1	-25.9	0	0	0	106.3	H79 M83	H79-P81 VanDerWaalsContact O-CD 3.27Å; H79-P81 WeakPolarHBondContact O-CD 3.36Å; P81-M83 PolarHBondContact O-N 3.34Å
82	K	66.6	Low	59.8	Low	205 Å²	205	148.8 Å²	148.8	89%	0.891	70%	0.699	S	S	*	*			trans	-43.7	117.3	177	-69.7	-179.9	179.2	178.6	0	107	H80 S84	H80-K82 PolarHBondContact O-N 3.47Å; K82-S84 PolarHBondContact O-N 3.12Å; K82-S84 VanDerWaalsContact O-N 3.14Å
83	M	58.4	Low	60.1	Low	182 Å²	182	144.1 Å²	144.1	90%	0.897	69%	0.687	S	S	*	*			trans	-41.1	122.4	-168.2	-74.7	170.7	64.5	0	0	110.6	P81 K85	P81-M83 PolarHBondContact O-N 3.34Å; M83-K85 PolarHBondContact O-N 2.73Å
84	S	57.3	Low	60.4	Low	110 Å²	110	145.8 Å²	145.8	77%	0.769	69%	0.694	S	S	*	*			trans	-0.3	106.5	157.7	-170.7	0	0	0	0	112.8	K82 R86	K82-S84 PolarHBondContact O-N 3.12Å; K82-S84 VanDerWaalsContact O-N 3.14Å; S84-R86 PolarHBondContact O-N 2.91Å
85	K	66	Low	60.5	Low	198 Å²	198	143.6 Å²	143.6	86%	0.861	69%	0.69	S	S	*	*			trans	-48.1	114.1	166.1	-79.4	-175.8	175.3	-176.1	0	106.6	M83 A87	M83-K85 PolarHBondContact O-N 2.73Å; K85-A87 PolarHBondContact O-N 3.33Å
86	R	63.5	Low	60.6	Low	239 Å²	239	137.9 Å²	137.9	90%	0.902	68%	0.677	S	S	*	*			trans	-53.5	118.9	163.8	-80.3	179	141.6	154.3	-4.6	105.4	S84 D88	S84-R86 PolarHBondContact O-N 2.91Å; R86-D88 PolarHBondContact O-N 2.97Å
87	A	66.6	Low	61.1	Low	80 Å²	80	134 Å²	134	66%	0.661	67%	0.666	S	S	*	*			trans	-54.4	116.2	171.6	0	0	0	0	0	106.5	K85 L89	K85-A87 PolarHBondContact O-N 3.33Å; A87-L89 PolarHBondContact O-N 3.45Å; A87-L89 VanDerWaalsContact O-N 3.09Å
88	D	65.1	Low	61.5	Low	93 Å²	93	129 Å²	129	50%	0.497	65%	0.65	S	S	.	*			trans	-71.7	107.5	177.6	-159.7	-15.7	0	0	0	106.3	R86 R90 D91	R86-D88 PolarHBondContact O-N 2.97Å; D88-R90 PolarHBondContact O-N 3.34Å; D88-R90 WeakPolarHBondContact OD1-CB 3.49Å; D88-R90 WeakPolarHBondContact OD1-CG 3.15Å; D88-R90 PolarHBondContact OD1-N 3.08Å; D88-D91 PolarHBondContact O-N 2.87Å
89	L	63.4	Low	62.1	Low	132 Å²	132	125.9 Å²	125.9	69%	0.691	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.2	-7.1	179.7	-64	174.6	0	0	0	111.8	A87 D91 L92	A87-L89 PolarHBondContact O-N 3.45Å; A87-L89 VanDerWaalsContact O-N 3.09Å; L89-D91 VanDerWaalsContact C-N 3.33Å; L89-L92 HydrophobicContact CD2-CD1 4.25Å; L89-L92 HydrophobicContact CD2-CD2 4.49Å; L89-L92 PolarHBondContact O-N 3.43Å
90	R	63.8	Low	62.6	Low	218 Å²	218	125.1 Å²	125.1	82%	0.823	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.3	-24.6	171.4	-64.6	-177.5	173.5	-169.7	-0.4	113.4	D88 L92	D88-R90 PolarHBondContact O-N 3.34Å; D88-R90 WeakPolarHBondContact OD1-CB 3.49Å; D88-R90 WeakPolarHBondContact OD1-CG 3.15Å; D88-R90 PolarHBondContact OD1-N 3.08Å; R90-L92 VanDerWaalsContact C-N 3.34Å
91	D	59	Low	63.4	Low	142 Å²	142	124 Å²	124	76%	0.759	63%	0.634	S	S	*	*	S	Bend	trans	-84.8	-11.1	173.8	-72.9	-15	0	0	0	112.2	D88 L89 S93	D88-D91 PolarHBondContact O-N 2.87Å; L89-D91 VanDerWaalsContact C-N 3.33Å; D91-S93 VanDerWaalsContact C-N 3.35Å; D91-S93 PolarHBondContact O-N 2.84Å
92	L	58.1	Low	63.8	Low	79 Å²	79	126.5 Å²	126.5	41%	0.414	63%	0.629	S	S	.	*	S	Bend	trans	-73.8	93.5	164.4	-93.1	81.7	0	0	0	108.3	L89 R90 I94	L89-L92 HydrophobicContact CD2-CD1 4.25Å; L89-L92 HydrophobicContact CD2-CD2 4.49Å; L89-L92 PolarHBondContact O-N 3.43Å; R90-L92 VanDerWaalsContact C-N 3.34Å; L92-I94 PolarHBondContact O-N 3.27Å
93	S	60.3	Low	64.2	Low	60 Å²	60	122.9 Å²	122.9	42%	0.42	61%	0.613	S	S	.	*			trans	-54	130.7	170.3	173.8	0	0	0	0	110	D91 H95 S96	D91-S93 VanDerWaalsContact C-N 3.35Å; D91-S93 PolarHBondContact O-N 2.84Å; S93-H95 PolarHBondContact O-N 2.83Å; S93-H95 WeakPolarHBondContact OG-CB 3.39Å; S93-H95 PolarHBondContact OG-N 3.21Å; S93-H95 PolarHBondContact OG-ND1 3.06Å; S93-S96 PolarHBondContact O-N 3.02Å; S93-S96 PolarHBondContact O-OG 3.41Å
94	I	59.3	Low	64.9	Low	127 Å²	127	117.7 Å²	117.7	65%	0.651	59%	0.589	S	S	*	*	H	α-helix	trans	-48	-24.3	172	-61.9	165.8	0	0	0	111.9	L92 M98	L92-I94 PolarHBondContact O-N 3.27Å; I94-M98 HydrophobicContact CG2-CE 4.43Å; I94-M98 PolarHBondContact O-N 3.39Å
95	H	56.5	Low	65.7	Low	140 Å²	140	118.7 Å²	118.7	65%	0.648	58%	0.579	S	S	*	*	H	α-helix	trans	-77.6	-27.9	179.1	-59.5	72.7	0	0	0	113.8	S93 A99	S93-H95 PolarHBondContact O-N 2.83Å; S93-H95 WeakPolarHBondContact OG-CB 3.39Å; S93-H95 PolarHBondContact OG-N 3.21Å; S93-H95 PolarHBondContact OG-ND1 3.06Å; H95-A99 PolarHBondContact O-N 3.45Å
96	S	59.3	Low	66	Low	60 Å²	60	113.8 Å²	113.8	42%	0.42	56%	0.562	S	S	.	*	H	α-helix	trans	-72.7	-37	172.7	60.1	0	0	0	0	111.6	S93 A99 F100	S93-S96 PolarHBondContact O-N 3.02Å; S93-S96 PolarHBondContact O-OG 3.41Å; S96-A99 PolarHBondContact O-N 2.81Å; S96-F100 PolarHBondContact O-N 3.02Å; S96-F100 VanDerWaalsContact O-N 3.07Å
97	D	64.2	Low	66	Low	71 Å²	71	107.7 Å²	107.7	38%	0.38	54%	0.544	S	S	.	.	H	α-helix	trans	-68	-41.4	179.6	-75	4.5	0	0	0	111.4	A99 F100 I101	D97-A99 VanDerWaalsContact C-N 3.33Å; D97-A99 PolarHBondContact O-N 3.29Å; D97-F100 PolarHBondContact O-N 3.42Å; D97-I101 VanDerWaalsContact O-CB 3.32Å; D97-I101 WeakPolarHBondContact O-CB 3.34Å; D97-I101 WeakPolarHBondContact O-CD1 3.46Å; D97-I101 WeakPolarHBondContact O-CG1 3.38Å; D97-I101 PolarHBondContact O-N 3.33Å
98	M	66	Low	65.9	Low	83 Å²	83	110.1 Å²	110.1	41%	0.409	54%	0.54	S	S	.	.	H	α-helix	trans	-62.9	-37.1	174.9	-79.8	-165.4	-71.2	0	0	113	I94 R102	I94-M98 HydrophobicContact CG2-CE 4.43Å; I94-M98 PolarHBondContact O-N 3.39Å; M98-R102 WeakPolarHBondContact O-CB 3.43Å; M98-R102 VanDerWaalsContact O-CG 3.24Å; M98-R102 WeakPolarHBondContact O-CG 3.41Å; M98-R102 PolarHBondContact O-N 3.13Å
99	A	70.5	Confident	65.7	Low	61 Å²	61	109.6 Å²	109.6	50%	0.504	54%	0.537	S	S	.	.	H	α-helix	trans	-68.2	-40.8	177.3	0	0	0	0	0	111.9	H95 S96 D97 K103	H95-A99 PolarHBondContact O-N 3.45Å; S96-A99 PolarHBondContact O-N 2.81Å; D97-A99 VanDerWaalsContact C-N 3.33Å; D97-A99 PolarHBondContact O-N 3.29Å; A99-K103 WeakPolarHBondContact O-CB 3.49Å; A99-K103 PolarHBondContact O-N 3.04Å
100	F	72.2	Confident	65.6	Low	129 Å²	129	109.6 Å²	109.6	57%	0.566	53%	0.533	S	S	*	.	H	α-helix	trans	-64.6	-45.1	174.3	178.9	-106.2	0	0	0	111.9	S96 D97 K103 L104	S96-F100 PolarHBondContact O-N 3.02Å; S96-F100 VanDerWaalsContact O-N 3.07Å; D97-F100 PolarHBondContact O-N 3.42Å; F100-K103 PolarHBondContact O-N 3.08Å; F100-L104 HydrophobicContact CD1-CD1 3.92Å; F100-L104 HydrophobicContact CE1-CD1 3.38Å; F100-L104 HydrophobicContact CE1-CG 4.13Å; F100-L104 HydrophobicContact CZ-CD1 3.76Å; F100-L104 HydrophobicContact CZ-CD2 4.39Å; F100-L104 HydrophobicContact CZ-CG 4.12Å; F100-L104 PolarHBondContact O-N 2.91Å
101	I	71.8	Confident	65.5	Low	80 Å²	80	103 Å²	103	41%	0.41	51%	0.512	S	S	.	.	H	α-helix	trans	-62.2	-44.1	177.6	-69.6	165.7	0	0	0	110.9	D97 K103 L104 F105	D97-I101 VanDerWaalsContact O-CB 3.32Å; D97-I101 WeakPolarHBondContact O-CB 3.34Å; D97-I101 WeakPolarHBondContact O-CD1 3.46Å; D97-I101 WeakPolarHBondContact O-CG1 3.38Å; D97-I101 PolarHBondContact O-N 3.33Å; I101-K103 PolarHBondContact O-N 3.02Å; I101-L104 WeakPolarHBondContact O-CB 3.48Å; I101-L104 PolarHBondContact O-N 3.02Å; I101-F105 HydrophobicContact CG2-CD2 3.69Å; I101-F105 HydrophobicContact CG2-CE2 3.4Å; I101-F105 WeakPolarHBondContact O-CD2 3.27Å; I101-F105 PolarHBondContact O-N 3.09Å
102	R	71.9	Confident	65.5	Low	167 Å²	167	101.3 Å²	101.3	63%	0.63	50%	0.502	S	S	*	.	H	α-helix	trans	-59.5	-44.7	174.5	-74.8	175	-168.6	-170.8	4.1	111.9	M98 L104 F105 D106	M98-R102 WeakPolarHBondContact O-CB 3.43Å; M98-R102 VanDerWaalsContact O-CG 3.24Å; M98-R102 WeakPolarHBondContact O-CG 3.41Å; M98-R102 PolarHBondContact O-N 3.13Å; R102-L104 VanDerWaalsContact C-N 3.31Å; R102-L104 PolarHBondContact O-N 3Å; R102-F105 PolarHBondContact O-N 2.92Å; R102-F105 VanDerWaalsContact O-N 3.15Å; R102-D106 PolarHBondContact O-N 3.48Å
103	K	75.4	Confident	65.6	Low	130 Å²	130	104.1 Å²	104.1	57%	0.565	52%	0.517	S	S	*	.	H	α-helix	trans	-62.1	-37.4	177.1	-170.8	177.2	-179.1	179.9	0	112.6	A99 F100 I101 D106 Q107	A99-K103 WeakPolarHBondContact O-CB 3.49Å; A99-K103 PolarHBondContact O-N 3.04Å; F100-K103 PolarHBondContact O-N 3.08Å; I101-K103 PolarHBondContact O-N 3.02Å; K103-D106 PolarHBondContact O-N 3.15Å; K103-Q107 WeakPolarHBondContact O-CG 3.48Å; K103-Q107 PolarHBondContact O-N 3.19Å
104	L	72.7	Confident	66.2	Low	73 Å²	73	109.6 Å²	109.6	38%	0.382	53%	0.528	S	S	.	.	H	α-helix	trans	-64.6	-42.3	173.8	-78.2	175.3	0	0	0	111.9	F100 I101 R102 Q107 K108	F100-L104 HydrophobicContact CD1-CD1 3.92Å; F100-L104 HydrophobicContact CE1-CD1 3.38Å; F100-L104 HydrophobicContact CE1-CG 4.13Å; F100-L104 HydrophobicContact CZ-CD1 3.76Å; F100-L104 HydrophobicContact CZ-CD2 4.39Å; F100-L104 HydrophobicContact CZ-CG 4.12Å; F100-L104 PolarHBondContact O-N 2.91Å; I101-L104 WeakPolarHBondContact O-CB 3.48Å; I101-L104 PolarHBondContact O-N 3.02Å; R102-L104 VanDerWaalsContact C-N 3.31Å; R102-L104 PolarHBondContact O-N 3Å; L104-Q107 PolarHBondContact O-N 3.28Å; L104-K108 WeakPolarHBondContact O-CG 3.39Å; L104-K108 PolarHBondContact O-N 3.04Å
105	F	74	Confident	66.6	Low	130 Å²	130	110 Å²	110	57%	0.57	53%	0.531	S	S	*	.	H	α-helix	trans	-66.3	-40.9	175.7	-77.2	-62.2	0	0	0	112.4	I101 R102 Q107 K108 N109	I101-F105 HydrophobicContact CG2-CD2 3.69Å; I101-F105 HydrophobicContact CG2-CE2 3.4Å; I101-F105 WeakPolarHBondContact O-CD2 3.27Å; I101-F105 PolarHBondContact O-N 3.09Å; R102-F105 PolarHBondContact O-N 2.92Å; R102-F105 VanDerWaalsContact O-N 3.15Å; F105-Q107 PolarHBondContact O-N 3.26Å; F105-K108 PolarHBondContact O-N 2.97Å; F105-N109 WeakPolarHBondContact O-CB 3.36Å; F105-N109 VanDerWaalsContact O-CG 3.32Å; F105-N109 PolarHBondContact O-N 3.27Å
106	D	71.5	Confident	66.6	Low	95 Å²	95	109.1 Å²	109.1	51%	0.508	56%	0.56	S	S	.	*	H	α-helix	trans	-62.3	-43.5	176.4	-68.8	-21.2	0	0	0	111.2	R102 K103 K108 N109 H110	R102-D106 PolarHBondContact O-N 3.48Å; K103-D106 PolarHBondContact O-N 3.15Å; D106-K108 PolarHBondContact O-N 3.17Å; D106-N109 PolarHBondContact O-N 3.06Å; D106-H110 PolarHBondContact O-CD2 2.92Å; D106-H110 PolarHBondContact O-N 3.08Å
107	Q	65.3	Low	67	Low	111 Å²	111	111.6 Å²	111.6	52%	0.519	57%	0.567	S	S	.	*	H	α-helix	trans	-62.1	-41.9	175.8	-76.8	-178.8	-28.8	0	0	112.6	K103 L104 F105 H110 E111	K103-Q107 WeakPolarHBondContact O-CG 3.48Å; K103-Q107 PolarHBondContact O-N 3.19Å; L104-Q107 PolarHBondContact O-N 3.28Å; F105-Q107 PolarHBondContact O-N 3.26Å; Q107-H110 PolarHBondContact O-N 3.26Å; Q107-E111 PolarHBondContact O-N 2.96Å; Q107-E111 VanDerWaalsContact O-N 3.15Å
108	K	62.8	Low	67.1	Low	131 Å²	131	113.7 Å²	113.7	57%	0.57	58%	0.577	S	S	*	*	H	α-helix	trans	-70.6	-36	178	-69.6	-68.1	177.5	-173.5	0	112.4	L104 F105 D106 E111 L112	L104-K108 WeakPolarHBondContact O-CG 3.39Å; L104-K108 PolarHBondContact O-N 3.04Å; F105-K108 PolarHBondContact O-N 2.97Å; D106-K108 PolarHBondContact O-N 3.17Å; K108-E111 PolarHBondContact O-N 3.14Å; K108-L112 PolarHBondContact O-N 3.09Å
109	N	62.2	Low	67.2	Low	83 Å²	83	115.4 Å²	115.4	44%	0.444	59%	0.586	S	S	.	*	H	α-helix	trans	-66.4	-37.1	173.4	-76.9	-15.2	0	0	0	111.9	F105 D106 E111 L112 L113	F105-N109 WeakPolarHBondContact O-CB 3.36Å; F105-N109 VanDerWaalsContact O-CG 3.32Å; F105-N109 PolarHBondContact O-N 3.27Å; D106-N109 PolarHBondContact O-N 3.06Å; N109-E111 VanDerWaalsContact C-N 3.33Å; N109-E111 PolarHBondContact O-N 3.13Å; N109-L112 PolarHBondContact O-N 2.93Å; N109-L113 WeakPolarHBondContact O-CB 3.27Å; N109-L113 VanDerWaalsContact O-CG 3.31Å; N109-L113 WeakPolarHBondContact O-CG 3.44Å; N109-L113 PolarHBondContact O-N 2.97Å
110	H	60.4	Low	67	Low	131 Å²	131	118.6 Å²	118.6	61%	0.606	59%	0.591	S	S	*	*	H	α-helix	trans	-65.6	-34.4	172.8	-77.7	-58.9	0	0	0	112.8	D106 Q107 R114	D106-H110 PolarHBondContact O-CD2 2.92Å; D106-H110 PolarHBondContact O-N 3.08Å; Q107-H110 PolarHBondContact O-N 3.26Å; H110-R114 VanDerWaalsContact O-CB 3.29Å; H110-R114 WeakPolarHBondContact O-CB 3.38Å; H110-R114 PolarHBondContact O-N 3.34Å
111	E	61.1	Low	66.7	Low	80 Å²	80	118 Å²	118	37%	0.374	59%	0.592	S	S	.	*	H	α-helix	trans	-71.2	-38.6	172.7	-69.7	-140.3	129.1	0	0	112.7	Q107 K108 N109 R114 L115	Q107-E111 PolarHBondContact O-N 2.96Å; Q107-E111 VanDerWaalsContact O-N 3.15Å; K108-E111 PolarHBondContact O-N 3.14Å; N109-E111 VanDerWaalsContact C-N 3.33Å; N109-E111 PolarHBondContact O-N 3.13Å; E111-R114 WeakPolarHBondContact O-CB 3.43Å; E111-R114 PolarHBondContact O-N 3.5Å; E111-R114 IonicContact OE1-CZ 3.54Å; E111-R114 IonicContact OE1-NH1 3.71Å; E111-R114 IonicContact OE1-NH2 2.77Å; E111-R114 PolarHBondContact OE1-NH2 3.4Å; E111-L115 VanDerWaalsContact O-CG 3.24Å; E111-L115 WeakPolarHBondContact O-CG 2.93Å; E111-L115 PolarHBondContact O-N 3.19Å
112	L	59	Low	66.3	Low	107 Å²	107	120.5 Å²	120.5	56%	0.56	61%	0.605	S	S	*	*	H	α-helix	trans	-62.5	-48.3	172.6	-90.6	146.3	0	0	0	111.6	K108 N109 R114 L115 G116	K108-L112 PolarHBondContact O-N 3.09Å; N109-L112 PolarHBondContact O-N 2.93Å; L112-R114 PolarHBondContact O-N 3.41Å; L112-L115 PolarHBondContact O-N 3.32Å; L112-G116 PolarHBondContact O-N 3.31Å
113	L	60.6	Low	65.9	Low	137 Å²	137	117.2 Å²	117.2	72%	0.717	60%	0.603	S	S	*	*	H	α-helix	trans	-62.4	-28.3	175.1	-73.5	168.5	0	0	0	112.9	N109	N109-L113 WeakPolarHBondContact O-CB 3.27Å; N109-L113 VanDerWaalsContact O-CG 3.31Å; N109-L113 WeakPolarHBondContact O-CG 3.44Å; N109-L113 PolarHBondContact O-N 2.97Å
114	R	72.7	Confident	65.2	Low	176 Å²	176	116.2 Å²	116.2	66%	0.664	61%	0.606	S	S	*	*	H	α-helix	trans	-73.9	-30.2	173.1	-171.4	-178.3	72.9	-164.7	-7.3	112.2	H110 E111 L112	H110-R114 VanDerWaalsContact O-CB 3.29Å; H110-R114 WeakPolarHBondContact O-CB 3.38Å; H110-R114 PolarHBondContact O-N 3.34Å; E111-R114 WeakPolarHBondContact O-CB 3.43Å; E111-R114 PolarHBondContact O-N 3.5Å; E111-R114 IonicContact OE1-CZ 3.54Å; E111-R114 IonicContact OE1-NH1 3.71Å; E111-R114 IonicContact OE1-NH2 2.77Å; E111-R114 PolarHBondContact OE1-NH2 3.4Å; L112-R114 PolarHBondContact O-N 3.41Å
115	L	69.3	Low	64.6	Low	136 Å²	136	119.8 Å²	119.8	71%	0.712	62%	0.624	S	S	*	*	H	α-helix	trans	-83.6	-11.6	-177.8	-71.9	168	0	0	0	113.5	E111 L112	E111-L115 VanDerWaalsContact O-CG 3.24Å; E111-L115 WeakPolarHBondContact O-CG 2.93Å; E111-L115 PolarHBondContact O-N 3.19Å; L112-L115 PolarHBondContact O-N 3.32Å
116	G	56.4	Low	63.7	Low	121 Å²	121	118.9 Å²	118.9	100%	1.247	63%	0.629	S	S	*	*			trans	78	0	178.2	0	0	0	0	0	112.2	L112	L112-G116 PolarHBondContact O-N 3.31Å

Retrieved 116 of 116 residues in 136.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).