A0A5K4F949_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F949, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 102 aa.

						>A0A5K4F949_SCHMA|A0A5K4F949
MEKNYLVSCLIVILFVLFTEINGSGKSPMLIRPYDLLPEETTTETTPITTEESQRPFEESQQPFEESQQPFEESQQPLTLNEIMLKLIYKLWAILQYLWKML
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.5	Low	78.4	Confident	221 Å²	221	121.8 Å²	121.8	100%	1.089	61%	0.611	S	S	*	*				0	-34.7	0	-75.3	-159.5	-77.5	0	0	113.1	K3 N4	M1-K3 PolarHBondContact O-N 3.4Å; M1-N4 PolarHBondContact O-N 3.33Å
2	E	69.9	Low	79.1	Confident	163 Å²	163	118.7 Å²	118.7	76%	0.762	60%	0.602	S	S	*	*	H	α-helix	trans	-61.8	-35.5	-174.6	-64.4	177.2	163.5	0	0	115.5	N4 Y5 L6	E2-N4 VanDerWaalsContact C-N 3.3Å; E2-N4 PolarHBondContact O-N 3.39Å; E2-Y5 PolarHBondContact O-N 3.16Å; E2-L6 PolarHBondContact O-N 3.45Å
3	K	72.8	Confident	79.9	Confident	174 Å²	174	117.2 Å²	117.2	76%	0.757	60%	0.595	S	S	*	*	H	α-helix	trans	-61.6	-36.1	-178.6	-65.3	-174.7	179.7	179.8	0	113	M1 Y5 V7	M1-K3 PolarHBondContact O-N 3.4Å; K3-Y5 VanDerWaalsContact C-N 3.35Å; K3-V7 WeakPolarHBondContact O-CG2 3.41Å; K3-V7 PolarHBondContact O-N 3.49Å
4	N	75.9	Confident	80.4	Confident	110 Å²	110	116.1 Å²	116.1	59%	0.588	59%	0.591	S	S	*	*	H	α-helix	trans	-72.8	-30.8	-178.7	-66.7	0.5	0	0	0	112	M1 E2 S8	M1-N4 PolarHBondContact O-N 3.33Å; E2-N4 VanDerWaalsContact C-N 3.3Å; E2-N4 PolarHBondContact O-N 3.39Å; N4-S8 WeakPolarHBondContact O-CB 3.28Å; N4-S8 PolarHBondContact O-N 3.2Å
5	Y	79.9	Confident	80.7	Confident	167 Å²	167	117.5 Å²	117.5	66%	0.655	59%	0.591	S	S	*	*	H	α-helix	trans	-69	-44.9	177.8	-169.7	-98.7	0	0	0	111.4	E2 K3 V7 S8 C9	E2-Y5 PolarHBondContact O-N 3.16Å; K3-Y5 VanDerWaalsContact C-N 3.35Å; Y5-V7 VanDerWaalsContact C-N 3.32Å; Y5-V7 PolarHBondContact O-N 3.28Å; Y5-S8 PolarHBondContact O-N 2.81Å; Y5-C9 WeakPolarHBondContact CE1-SG 3.18Å; Y5-C9 PolarHBondContact O-N 2.86Å; Y5-C9 PolarHBondContact O-SG 3.29Å; Y5-C9 VanDerWaalsContact O-SG 3.37Å
6	L	83	Confident	80.9	Confident	126 Å²	126	114.6 Å²	114.6	66%	0.66	58%	0.581	S	S	*	*	H	α-helix	trans	-61	-41.4	176.4	-70.1	173.9	0	0	0	112.1	E2 C9 L10	E2-L6 PolarHBondContact O-N 3.45Å; L6-C9 PolarHBondContact O-N 3.01Å; L6-L10 WeakPolarHBondContact O-CB 3.48Å; L6-L10 PolarHBondContact O-N 2.98Å
7	V	80	Confident	81	Confident	65 Å²	65	113 Å²	113	39%	0.394	57%	0.574	S	S	.	*	H	α-helix	trans	-63.5	-45.2	175.9	173.9	0	0	0	0	110.7	K3 Y5 C9 L10 I11 L102	K3-V7 WeakPolarHBondContact O-CG2 3.41Å; K3-V7 PolarHBondContact O-N 3.49Å; Y5-V7 VanDerWaalsContact C-N 3.32Å; Y5-V7 PolarHBondContact O-N 3.28Å; V7-C9 PolarHBondContact O-N 2.89Å; V7-L10 PolarHBondContact O-N 3.08Å; V7-I11 HydrophobicContact CG1-CD1 3.85Å; V7-I11 WeakPolarHBondContact O-CD1 3.42Å; V7-I11 VanDerWaalsContact O-CG1 3.26Å; V7-I11 WeakPolarHBondContact O-CG1 3.39Å; V7-I11 PolarHBondContact O-N 3.15Å; V7-L102 HydrophobicContact CG1-CD2 4.38Å
8	S	81.9	Confident	81	Confident	65 Å²	65	113.1 Å²	113.1	46%	0.455	57%	0.57	S	S	.	*	H	α-helix	trans	-60.7	-45.5	176.6	-176.8	0	0	0	0	112.1	N4 Y5 L10 I11 V12	N4-S8 WeakPolarHBondContact O-CB 3.28Å; N4-S8 PolarHBondContact O-N 3.2Å; Y5-S8 PolarHBondContact O-N 2.81Å; S8-L10 PolarHBondContact O-N 3.3Å; S8-I11 PolarHBondContact O-N 3.37Å; S8-V12 WeakPolarHBondContact O-CG2 3.41Å; S8-V12 PolarHBondContact O-N 2.73Å; S8-V12 VanDerWaalsContact O-N 3.09Å
9	C	85.4	Confident	80.9	Confident	44 Å²	44	110.4 Å²	110.4	30%	0.297	56%	0.56	S	S	.	*	H	α-helix	trans	-60.8	-44	175.7	-71.5	0	0	0	0	112.2	Y5 L6 V7 I11 V12 I13	Y5-C9 WeakPolarHBondContact CE1-SG 3.18Å; Y5-C9 PolarHBondContact O-N 2.86Å; Y5-C9 PolarHBondContact O-SG 3.29Å; Y5-C9 VanDerWaalsContact O-SG 3.37Å; L6-C9 PolarHBondContact O-N 3.01Å; V7-C9 PolarHBondContact O-N 2.89Å; C9-I11 VanDerWaalsContact C-N 3.32Å; C9-I11 PolarHBondContact O-N 2.75Å; C9-V12 PolarHBondContact O-N 2.82Å; C9-I13 VanDerWaalsContact O-CG1 3.27Å; C9-I13 WeakPolarHBondContact O-CG1 3.27Å; C9-I13 PolarHBondContact O-N 3.3Å
10	L	87.5	Confident	80.6	Confident	109 Å²	109	111.7 Å²	111.7	57%	0.571	56%	0.564	S	S	*	*	H	α-helix	trans	-61.2	-42	178.4	-165.6	83.6	0	0	0	111.3	L6 V7 S8 I13 L14	L6-L10 WeakPolarHBondContact O-CB 3.48Å; L6-L10 PolarHBondContact O-N 2.98Å; V7-L10 PolarHBondContact O-N 3.08Å; S8-L10 PolarHBondContact O-N 3.3Å; L10-I13 PolarHBondContact O-N 3.45Å; L10-L14 HydrophobicContact CD2-CD1 4.44Å; L10-L14 HydrophobicContact CG-CD1 4.26Å; L10-L14 WeakPolarHBondContact O-CB 3.34Å; L10-L14 VanDerWaalsContact O-CG 3.3Å; L10-L14 WeakPolarHBondContact O-CG 3.38Å; L10-L14 PolarHBondContact O-N 2.77Å
11	I	86.2	Confident	80	Confident	96 Å²	96	112.6 Å²	112.6	49%	0.492	57%	0.569	S	S	.	*	H	α-helix	trans	-62.3	-45	177.8	-68.7	164.5	0	0	0	111	V7 S8 C9 L14 F15	V7-I11 HydrophobicContact CG1-CD1 3.85Å; V7-I11 WeakPolarHBondContact O-CD1 3.42Å; V7-I11 VanDerWaalsContact O-CG1 3.26Å; V7-I11 WeakPolarHBondContact O-CG1 3.39Å; V7-I11 PolarHBondContact O-N 3.15Å; S8-I11 PolarHBondContact O-N 3.37Å; C9-I11 VanDerWaalsContact C-N 3.32Å; C9-I11 PolarHBondContact O-N 2.75Å; I11-L14 PolarHBondContact O-N 2.99Å; I11-F15 WeakPolarHBondContact O-CB 3.29Å; I11-F15 PolarHBondContact O-N 3.33Å
12	V	87.5	Confident	80.3	Confident	84 Å²	84	106.6 Å²	106.6	51%	0.509	54%	0.541	S	S	.	.	H	α-helix	trans	-63.2	-44	178.4	174.3	0	0	0	0	111	S8 C9 L14 F15 V16	S8-V12 WeakPolarHBondContact O-CG2 3.41Å; S8-V12 PolarHBondContact O-N 2.73Å; S8-V12 VanDerWaalsContact O-N 3.09Å; C9-V12 PolarHBondContact O-N 2.82Å; V12-L14 PolarHBondContact O-N 2.92Å; V12-F15 PolarHBondContact O-N 2.96Å; V12-V16 WeakPolarHBondContact O-CG2 3.38Å; V12-V16 PolarHBondContact O-N 3.49Å
13	I	88.9	Confident	79.9	Confident	100 Å²	100	101.8 Å²	101.8	51%	0.513	54%	0.536	S	S	.	.	H	α-helix	trans	-61.3	-46.7	178	-68.3	164.9	0	0	0	110.7	C9 L10 F15 V16 L17	C9-I13 VanDerWaalsContact O-CG1 3.27Å; C9-I13 WeakPolarHBondContact O-CG1 3.27Å; C9-I13 PolarHBondContact O-N 3.3Å; L10-I13 PolarHBondContact O-N 3.45Å; I13-F15 VanDerWaalsContact C-N 3.31Å; I13-F15 PolarHBondContact O-N 3.04Å; I13-V16 PolarHBondContact O-N 3.47Å; I13-L17 HydrophobicContact CG2-CD1 3.95Å; I13-L17 HydrophobicContact CG2-CG 4.49Å; I13-L17 WeakPolarHBondContact O-CG 3.25Å; I13-L17 PolarHBondContact O-N 3.39Å
14	L	87.6	Confident	79	Confident	101 Å²	101	98 Å²	98	53%	0.529	53%	0.531	S	S	.	.	H	α-helix	trans	-63.2	-37.9	177.9	-71.6	172.7	0	0	0	112.1	L10 I11 V12 F18	L10-L14 HydrophobicContact CD2-CD1 4.44Å; L10-L14 HydrophobicContact CG-CD1 4.26Å; L10-L14 WeakPolarHBondContact O-CB 3.34Å; L10-L14 VanDerWaalsContact O-CG 3.3Å; L10-L14 WeakPolarHBondContact O-CG 3.38Å; L10-L14 PolarHBondContact O-N 2.77Å; I11-L14 PolarHBondContact O-N 2.99Å; V12-L14 PolarHBondContact O-N 2.92Å; L14-F18 VanDerWaalsContact O-CB 3.27Å; L14-F18 WeakPolarHBondContact O-CB 3.39Å; L14-F18 PolarHBondContact O-N 3.26Å
15	F	84.6	Confident	77.8	Confident	137 Å²	137	95.6 Å²	95.6	60%	0.601	53%	0.533	S	S	*	.	H	α-helix	trans	-64.2	-46.6	176.5	-175.7	-98.2	0	0	0	111.8	I11 V12 I13 F18 T19	I11-F15 WeakPolarHBondContact O-CB 3.29Å; I11-F15 PolarHBondContact O-N 3.33Å; V12-F15 PolarHBondContact O-N 2.96Å; I13-F15 VanDerWaalsContact C-N 3.31Å; I13-F15 PolarHBondContact O-N 3.04Å; F15-F18 PolarHBondContact O-N 2.98Å; F15-T19 HydrophobicContact CD1-CG2 4.23Å; F15-T19 HydrophobicContact CE1-CG2 3.85Å; F15-T19 HydrophobicContact CE2-CG2 4.45Å; F15-T19 HydrophobicContact CZ-CG2 3.98Å; F15-T19 WeakPolarHBondContact O-CG2 3.27Å; F15-T19 PolarHBondContact O-N 3.5Å; F15-T19 PolarHBondContact O-OG1 3.3Å
16	V	83.7	Confident	76.6	Confident	71 Å²	71	96.9 Å²	96.9	43%	0.43	54%	0.542	S	S	.	.	H	α-helix	trans	-60.5	-48.7	177.1	173	0	0	0	0	110.7	V12 I13 F18 T19 E20	V12-V16 WeakPolarHBondContact O-CG2 3.38Å; V12-V16 PolarHBondContact O-N 3.49Å; I13-V16 PolarHBondContact O-N 3.47Å; V16-F18 VanDerWaalsContact C-N 3.31Å; V16-F18 PolarHBondContact O-N 3.06Å; V16-T19 WeakPolarHBondContact CA-OG1 3.34Å; V16-T19 PolarHBondContact O-N 3.45Å; V16-T19 VanDerWaalsContact O-N 3.15Å; V16-T19 PolarHBondContact O-OG1 3.37Å; V16-E20 PolarHBondContact O-N 2.99Å
17	L	83.3	Confident	75.1	Confident	88 Å²	88	95.7 Å²	95.7	46%	0.461	54%	0.544	S	S	.	.	H	α-helix	trans	-59.2	-42.8	177.2	-71.5	172.3	0	0	0	111.8	I13 E20 I21	I13-L17 HydrophobicContact CG2-CD1 3.95Å; I13-L17 HydrophobicContact CG2-CG 4.49Å; I13-L17 WeakPolarHBondContact O-CG 3.25Å; I13-L17 PolarHBondContact O-N 3.39Å; L17-E20 PolarHBondContact O-N 3.43Å; L17-I21 WeakPolarHBondContact O-CB 3.42Å; L17-I21 WeakPolarHBondContact O-CD1 3.17Å; L17-I21 WeakPolarHBondContact O-CG1 3.4Å; L17-I21 PolarHBondContact O-N 3.36Å
18	F	79.8	Confident	73.7	Confident	114 Å²	114	98.1 Å²	98.1	50%	0.5	56%	0.561	S	S	.	*	H	α-helix	trans	-63.3	-42.8	176.5	-173.7	-97.4	0	0	0	111.6	L14 F15 V16 E20 I21 N22	L14-F18 VanDerWaalsContact O-CB 3.27Å; L14-F18 WeakPolarHBondContact O-CB 3.39Å; L14-F18 PolarHBondContact O-N 3.26Å; F15-F18 PolarHBondContact O-N 2.98Å; V16-F18 VanDerWaalsContact C-N 3.31Å; V16-F18 PolarHBondContact O-N 3.06Å; F18-E20 VanDerWaalsContact C-N 3.3Å; F18-E20 PolarHBondContact O-N 2.99Å; F18-I21 PolarHBondContact O-N 3.43Å; F18-N22 VanDerWaalsContact CD1-ND2 3.25Å; F18-N22 WeakPolarHBondContact CD1-ND2 3.07Å; F18-N22 VanDerWaalsContact CD2-ND2 3.34Å; F18-N22 WeakPolarHBondContact CD2-ND2 3.19Å; F18-N22 WeakPolarHBondContact CE1-ND2 3.3Å; F18-N22 WeakPolarHBondContact CE2-ND2 3.14Å; F18-N22 WeakPolarHBondContact CG-ND2 3.42Å; F18-N22 WeakPolarHBondContact CZ-ND2 3.41Å; F18-N22 WeakPolarHBondContact O-CB 3.38Å; F18-N22 PolarHBondContact O-N 2.93Å; F18-N22 PolarHBondContact O-ND2 3.27Å
19	T	78.9	Confident	72.2	Confident	63 Å²	63	102.9 Å²	102.9	39%	0.387	58%	0.578	S	S	.	*	H	α-helix	trans	-66.1	-32.9	176.8	54.9	0	0	0	0	112.7	F15 V16 G23	F15-T19 HydrophobicContact CD1-CG2 4.23Å; F15-T19 HydrophobicContact CE1-CG2 3.85Å; F15-T19 HydrophobicContact CE2-CG2 4.45Å; F15-T19 HydrophobicContact CZ-CG2 3.98Å; F15-T19 WeakPolarHBondContact O-CG2 3.27Å; F15-T19 PolarHBondContact O-N 3.5Å; F15-T19 PolarHBondContact O-OG1 3.3Å; V16-T19 WeakPolarHBondContact CA-OG1 3.34Å; V16-T19 PolarHBondContact O-N 3.45Å; V16-T19 VanDerWaalsContact O-N 3.15Å; V16-T19 PolarHBondContact O-OG1 3.37Å; T19-G23 VanDerWaalsContact O-CA 3.28Å; T19-G23 WeakPolarHBondContact O-CA 3.1Å; T19-G23 PolarHBondContact O-N 2.9Å
20	E	75	Confident	70.6	Confident	136 Å²	136	108.1 Å²	108.1	64%	0.636	60%	0.602	S	S	*	*	H	α-helix	trans	-74	-40.9	178.7	-167	153.9	-173.4	0	0	111.5	V16 L17 F18 S24	V16-E20 PolarHBondContact O-N 2.99Å; L17-E20 PolarHBondContact O-N 3.43Å; F18-E20 VanDerWaalsContact C-N 3.3Å; F18-E20 PolarHBondContact O-N 2.99Å; E20-S24 PolarHBondContact O-N 3.4Å
21	I	69.3	Low	69.1	Low	130 Å²	130	109.1 Å²	109.1	67%	0.667	61%	0.607	S	S	*	*	H	α-helix	trans	-64.5	-42.9	175.2	-65.2	163.1	0	0	0	111	L17 F18	L17-I21 WeakPolarHBondContact O-CB 3.42Å; L17-I21 WeakPolarHBondContact O-CD1 3.17Å; L17-I21 WeakPolarHBondContact O-CG1 3.4Å; L17-I21 PolarHBondContact O-N 3.36Å; F18-I21 PolarHBondContact O-N 3.43Å
22	N	65.9	Low	67.9	Low	95 Å²	95	113.8 Å²	113.8	51%	0.508	62%	0.618	S	S	.	*	H	α-helix	trans	-83	-26.3	-179.4	-68	-69.4	0	0	0	113.5	F18 S24	F18-N22 VanDerWaalsContact CD1-ND2 3.25Å; F18-N22 WeakPolarHBondContact CD1-ND2 3.07Å; F18-N22 VanDerWaalsContact CD2-ND2 3.34Å; F18-N22 WeakPolarHBondContact CD2-ND2 3.19Å; F18-N22 WeakPolarHBondContact CE1-ND2 3.3Å; F18-N22 WeakPolarHBondContact CE2-ND2 3.14Å; F18-N22 WeakPolarHBondContact CG-ND2 3.42Å; F18-N22 WeakPolarHBondContact CZ-ND2 3.41Å; F18-N22 WeakPolarHBondContact O-CB 3.38Å; F18-N22 PolarHBondContact O-N 2.93Å; F18-N22 PolarHBondContact O-ND2 3.27Å; N22-S24 VanDerWaalsContact C-N 3.34Å
23	G	60.6	Low	66.3	Low	62 Å²	62	114.9 Å²	114.9	64%	0.639	63%	0.627	S	S	*	*	H	α-helix	trans	-78.2	-16.6	-179.6	0	0	0	0	0	113.8	T19 G25	T19-G23 VanDerWaalsContact O-CA 3.28Å; T19-G23 WeakPolarHBondContact O-CA 3.1Å; T19-G23 PolarHBondContact O-N 2.9Å; G23-G25 PolarHBondContact O-N 2.96Å
24	S	54.5	Low	65	Low	94 Å²	94	119.7 Å²	119.7	66%	0.657	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.6	29.5	173.1	-169.7	0	0	0	0	113.2	E20 N22 K26	E20-S24 PolarHBondContact O-N 3.4Å; N22-S24 VanDerWaalsContact C-N 3.34Å; S24-K26 PolarHBondContact O-N 2.88Å; S24-K26 VanDerWaalsContact O-N 3.08Å
25	G	50	Low	63.3	Low	61 Å²	61	121.9 Å²	121.9	63%	0.629	65%	0.653	S	S	*	*			trans	-78.6	47.9	163.7	0	0	0	0	0	112.1	G23 S27	G23-G25 PolarHBondContact O-N 2.96Å; G25-S27 VanDerWaalsContact C-N 3.29Å; G25-S27 PolarHBondContact O-N 2.75Å
26	K	55.5	Low	61.9	Low	194 Å²	194	123.5 Å²	123.5	84%	0.843	67%	0.667	S	S	*	*			trans	-70.5	96.8	164.3	-76.8	-178	-179.8	174.4	0	106.3	S24	S24-K26 PolarHBondContact O-N 2.88Å; S24-K26 VanDerWaalsContact O-N 3.08Å
27	S	52	Low	60.5	Low	101 Å²	101	127.6 Å²	127.6	71%	0.706	69%	0.685	S	S	*	*			trans	-38.5	132.1	172	-63.2	0	0	0	0	109.9	G25 M29	G25-S27 VanDerWaalsContact C-N 3.29Å; G25-S27 PolarHBondContact O-N 2.75Å; S27-M29 PolarHBondContact O-N 3.29Å
28	P	50.7	Low	59.4	Low	115 Å²	115	128.9 Å²	128.9	75%	0.747	70%	0.699	S	S	*	*			trans	-56.5	114	165.6	24.9	-30.4	0	0	0	105.7	L30	P28-L30 PolarHBondContact O-N 3.28Å
29	M	49.9	Very low	58.4	Low	165 Å²	165	132.1 Å²	132.1	81%	0.813	72%	0.716	S	S	*	*			trans	-56.8	94.2	166.2	-178.8	174.1	174.4	0	0	105.2	S27 I31	S27-M29 PolarHBondContact O-N 3.29Å; M29-I31 HydrophobicContact CE-CG1 4.49Å; M29-I31 HydrophobicContact CG-CG1 4.2Å; M29-I31 PolarHBondContact O-N 2.89Å
30	L	51	Low	57	Low	154 Å²	154	138.2 Å²	138.2	81%	0.806	74%	0.739	S	S	*	*			trans	-67.2	84.3	169.9	-112.4	166.5	0	0	0	105.2	P28 R32	P28-L30 PolarHBondContact O-N 3.28Å; L30-R32 PolarHBondContact O-N 2.9Å
31	I	56.4	Low	56	Low	131 Å²	131	137.4 Å²	137.4	67%	0.672	74%	0.744	S	S	*	*			trans	-55.1	107.8	163	-65.9	170.2	0	0	0	104.6	M29 P33	M29-I31 HydrophobicContact CE-CG1 4.49Å; M29-I31 HydrophobicContact CG-CG1 4.2Å; M29-I31 PolarHBondContact O-N 2.89Å; I31-P33 WeakPolarHBondContact O-CD 3.41Å
32	R	60.7	Low	55	Low	194 Å²	194	136.6 Å²	136.6	73%	0.732	75%	0.745	S	S	*	*			trans	-67.5	124.5	174.2	-70	-170.8	-168.6	-167.7	4.8	107.3	L30 Y34	L30-R32 PolarHBondContact O-N 2.9Å; R32-Y34 PolarHBondContact O-N 3.38Å
33	P	54.3	Low	54.2	Low	107 Å²	107	137.9 Å²	137.9	70%	0.695	76%	0.757	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.3	47.4	180	31.8	-33.6	0	0	0	112.4	I31	I31-P33 WeakPolarHBondContact O-CD 3.41Å
34	Y	61.2	Low	53.7	Low	201 Å²	201	143.5 Å²	143.5	79%	0.788	77%	0.766	S	S	*	*	T	Hydrogen-bonded Turn	trans	-134.3	4.6	179	-66.8	-70	0	0	0	115.1	R32 L36	R32-Y34 PolarHBondContact O-N 3.38Å; Y34-L36 VanDerWaalsContact C-N 3.3Å; Y34-L36 PolarHBondContact O-N 3.37Å
35	D	53.2	Low	53.7	Low	147 Å²	147	145.1 Å²	145.1	79%	0.786	77%	0.773	S	S	*	*			trans	-90.1	15.4	176.2	-65.9	-31.9	0	0	0	113.6
36	L	54.5	Low	53.7	Low	171 Å²	171	147.1 Å²	147.1	90%	0.895	77%	0.773	S	S	*	*			trans	-102.3	63.4	172.6	-65.1	174.3	0	0	0	110.4	Y34	Y34-L36 VanDerWaalsContact C-N 3.3Å; Y34-L36 PolarHBondContact O-N 3.37Å
37	L	55.1	Low	53.2	Low	156 Å²	156	143.9 Å²	143.9	82%	0.817	77%	0.772	S	S	*	*			trans	-80.5	126.1	161	-161.4	81.9	0	0	0	107.2	E39	L37-E39 PolarHBondContact O-N 3.46Å; L37-E39 VanDerWaalsContact O-N 3.16Å
38	P	59.2	Low	53.4	Low	116 Å²	116	145.9 Å²	145.9	75%	0.753	77%	0.773	S	S	*	*			trans	-69.6	115.3	-174.3	26.4	-31.3	0	0	0	109.9	E40	P38-E40 PolarHBondContact O-N 3.39Å
39	E	57.9	Low	52.8	Low	182 Å²	182	146.1 Å²	146.1	85%	0.85	77%	0.772	S	S	*	*			trans	-61.8	127.4	166.3	-84.5	-159.2	148.5	0	0	109.5	L37 T41	L37-E39 PolarHBondContact O-N 3.46Å; L37-E39 VanDerWaalsContact O-N 3.16Å; E39-T41 PolarHBondContact O-N 3.25Å
40	E	50	Low	52.6	Low	190 Å²	190	144.2 Å²	144.2	89%	0.888	77%	0.77	S	S	*	*			trans	-49.9	132	171.8	-60.2	-173.7	124.4	0	0	111.4	P38	P38-E40 PolarHBondContact O-N 3.39Å
41	T	53.8	Low	52.3	Low	119 Å²	119	145.4 Å²	145.4	73%	0.73	77%	0.772	S	S	*	*			trans	-155.4	115	155.8	5.6	0	0	0	0	109.1	E39	E39-T41 PolarHBondContact O-N 3.25Å
42	T	48.9	Very low	51.8	Low	114 Å²	114	148 Å²	148	70%	0.699	78%	0.781	S	S	*	*			trans	65.3	117	133.5	-33.7	0	0	0	0	114.7
43	T	48.3	Very low	50.9	Low	122 Å²	122	144.2 Å²	144.2	75%	0.748	78%	0.784	S	S	*	*				176.8	151.4	62.4	-21	0	0	0	0	107.3
44	E	50.6	Low	50.3	Low	179 Å²	179	148.1 Å²	148.1	84%	0.836	79%	0.793	S	S	*	*			trans	-37.3	143.7	167.1	-63.9	174.3	104.6	0	0	114.3
45	T	54	Low	49.8	Very low	129 Å²	129	149.7 Å²	149.7	79%	0.791	80%	0.798	S	S	*	*				171.5	122.8	125	-72.8	0	0	0	0	110.3
46	T	51.4	Low	49.3	Very low	102 Å²	102	148.2 Å²	148.2	63%	0.626	80%	0.796	S	S	*	*			trans	75.8	122.9	161.1	4.7	0	0	0	0	120.5	I48	T46-I48 HydrophobicContact CG2-CD1 4.29Å; T46-I48 HydrophobicContact CG2-CG1 4.01Å
47	P	44	Very low	48.6	Very low	127 Å²	127	150 Å²	150	83%	0.825	80%	0.797	S	S	*	*			trans	-88.1	113.6	156.5	33.4	-23	0	0	0	108.6
48	I	55.8	Low	48.1	Very low	143 Å²	143	151.5 Å²	151.5	73%	0.733	80%	0.8	S	S	*	*			trans	-119.6	114.1	165.9	-51.7	-177.4	0	0	0	108.1	T46	T46-I48 HydrophobicContact CG2-CD1 4.29Å; T46-I48 HydrophobicContact CG2-CG1 4.01Å
49	T	39.4	Very low	47.4	Very low	119 Å²	119	155.2 Å²	155.2	73%	0.73	81%	0.807	S	S	*	*			trans	-41	129.9	166.6	-42.2	0	0	0	0	112.7
50	T	46	Very low	46.8	Very low	125 Å²	125	152.1 Å²	152.1	77%	0.767	81%	0.806	S	S	*	*			trans	-148.5	90.2	149.9	-53.5	0	0	0	0	107.6	E52	T50-E52 PolarHBondContact O-N 3.46Å
51	E	42.9	Very low	46.6	Very low	180 Å²	180	153 Å²	153	84%	0.841	81%	0.81	S	S	*	*			trans	-61.7	116.9	149.7	-71.5	-169.8	141.4	0	0	106.8
52	E	46.1	Very low	46.5	Very low	185 Å²	185	156 Å²	156	86%	0.864	82%	0.815	S	S	*	*			trans	170	105	147.7	-98.8	-174.1	150.9	0	0	107.8	T50	T50-E52 PolarHBondContact O-N 3.46Å
53	S	42.4	Very low	46.4	Very low	115 Å²	115	154.9 Å²	154.9	80%	0.804	81%	0.81	S	S	*	*				169.2	89.7	124.3	-168.5	0	0	0	0	108.7	R55	S53-R55 PolarHBondContact O-N 3.32Å
54	Q	41.6	Very low	46.3	Very low	189 Å²	189	158.2 Å²	158.2	88%	0.883	82%	0.815	S	S	*	*			trans	-53.9	120.1	156	-65.6	171	-24.6	0	0	109.3
55	R	50.4	Low	46.3	Very low	234 Å²	234	157.3 Å²	157.3	88%	0.883	81%	0.811	S	S	*	*			trans	-165.2	133.5	133.9	-109.6	-171.1	-100.7	-172.3	-3.3	110.5	S53	S53-R55 PolarHBondContact O-N 3.32Å
56	P	42.2	Very low	46.1	Very low	115 Å²	115	160.9 Å²	160.9	75%	0.747	82%	0.818	S	S	*	*			trans	-81	131.6	-169.4	33.1	-31.7	0	0	0	111.3	E58	P56-E58 PolarHBondContact O-N 2.94Å
57	F	40.7	Very low	46	Very low	208 Å²	208	160.1 Å²	160.1	91%	0.912	82%	0.817	S	S	*	*	S	Bend		21.5	86.5	126.7	-135.1	-92.3	0	0	0	116.2
58	E	43.7	Very low	46.4	Very low	188 Å²	188	162.2 Å²	162.2	88%	0.879	82%	0.816	S	S	*	*			trans	176.4	74.4	161.7	-104.1	164.7	-155.1	0	0	110.8	P56	P56-E58 PolarHBondContact O-N 2.94Å
59	E	45.1	Very low	46.2	Very low	194 Å²	194	164.2 Å²	164.2	91%	0.907	82%	0.822	S	S	*	*	S	Bend	trans	-178.4	92.5	157.5	-111.6	179.5	152	0	0	109.9
60	S	46.5	Very low	46.6	Very low	118 Å²	118	162.6 Å²	162.6	83%	0.825	81%	0.814	S	S	*	*			trans	167.5	24.1	147.9	62	0	0	0	0	113.8	Q62	S60-Q62 VanDerWaalsContact C-N 3.3Å; S60-Q62 PolarHBondContact O-N 3.47Å
61	Q	45.1	Very low	46.7	Very low	209 Å²	209	165.2 Å²	165.2	98%	0.977	82%	0.815	S	S	*	*			trans	-81	81.4	157.6	-75.6	-157.2	29.3	0	0	109.1
62	Q	52	Low	47.2	Very low	180 Å²	180	164.4 Å²	164.4	84%	0.841	81%	0.811	S	S	*	*			trans	-132.9	134.6	160.7	-124.6	178.2	-16.3	0	0	108.1	S60	S60-Q62 VanDerWaalsContact C-N 3.3Å; S60-Q62 PolarHBondContact O-N 3.47Å
63	P	46.4	Very low	47.4	Very low	92 Å²	92	162.9 Å²	162.9	60%	0.597	80%	0.804	S	S	*	*			trans	-83	141.3	-133.3	31.5	-35	0	0	0	112.7	E65	P63-E65 HydrophobicContact CB-CB 4.37Å; P63-E65 HydrophobicContact CB-CG 4.13Å; P63-E65 PolarHBondContact O-N 3.31Å
64	F	45.7	Very low	47.9	Very low	192 Å²	192	160.4 Å²	160.4	84%	0.842	79%	0.786	S	S	*	*			trans	-68.5	54.5	170.2	-149.1	-93.2	0	0	0	110.6
65	E	50.5	Low	48.4	Very low	160 Å²	160	158 Å²	158	75%	0.748	78%	0.775	S	S	*	*			trans	-110.9	-4.6	-173.9	-83.1	-174.5	171	0	0	114.4	P63	P63-E65 HydrophobicContact CB-CB 4.37Å; P63-E65 HydrophobicContact CB-CG 4.13Å; P63-E65 PolarHBondContact O-N 3.31Å
66	E	49.8	Very low	48.5	Very low	204 Å²	204	153.9 Å²	153.9	95%	0.953	77%	0.766	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.4	1.2	178.6	-96.1	-172.6	141.9	0	0	115.2
67	S	50.4	Low	49.2	Very low	85 Å²	85	152 Å²	152	59%	0.594	75%	0.754	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.9	17.2	-176.9	64.5	0	0	0	0	115.5
68	Q	51.8	Low	50	Low	172 Å²	172	147.1 Å²	147.1	80%	0.804	74%	0.737	S	S	*	*			trans	-110.9	16.2	-175.5	-78.4	-152.3	45.4	0	0	117
69	Q	51.5	Low	50.8	Low	185 Å²	185	142.1 Å²	142.1	86%	0.864	72%	0.719	S	S	*	*	S	Bend	trans	-141.4	127.4	171.4	-90.6	177.7	-36.4	0	0	111.2
70	P	48.1	Very low	51.7	Low	85 Å²	85	138.5 Å²	138.5	55%	0.552	71%	0.705	S	S	*	*			cis	-124.3	107.1	9.7	34.7	-14.7	0	0	0	112.3	E72	P70-E72 HydrophobicContact CB-CB 4.5Å; P70-E72 PolarHBondContact O-N 3.43Å
71	F	48.5	Very low	53.1	Low	180 Å²	180	137.2 Å²	137.2	79%	0.789	69%	0.689	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72	14.1	161.8	-134.9	-92.1	0	0	0	112.2	S74	F71-S74 WeakPolarHBondContact CD1-OG 3.3Å; F71-S74 PolarHBondContact O-OG 3.21Å; F71-S74 VanDerWaalsContact O-OG 3.06Å
72	E	52.4	Low	54.8	Low	162 Å²	162	132.7 Å²	132.7	76%	0.757	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.8	-20.6	179.7	-70.4	-168.6	156.1	0	0	113.5	P70 S74 Q75	P70-E72 HydrophobicContact CB-CB 4.5Å; P70-E72 PolarHBondContact O-N 3.43Å; E72-S74 VanDerWaalsContact C-N 3.31Å; E72-S74 PolarHBondContact O-N 3.5Å; E72-Q75 PolarHBondContact O-N 2.97Å
73	E	51.8	Low	56.3	Low	154 Å²	154	129 Å²	129	72%	0.72	65%	0.653	S	S	*	*	G	3₁₀ helix	trans	-72.1	-25.1	175.3	-83.1	-168.7	138.7	0	0	112.9	Q75	E73-Q75 VanDerWaalsContact C-N 3.28Å; E73-Q75 PolarHBondContact O-N 2.86Å
74	S	52.4	Low	57.9	Low	63 Å²	63	129.2 Å²	129.2	44%	0.441	65%	0.647	S	S	.	*	G	3₁₀ helix	trans	-77	-5	178	43.5	0	0	0	0	115.1	F71 E72 P77	F71-S74 WeakPolarHBondContact CD1-OG 3.3Å; F71-S74 PolarHBondContact O-OG 3.21Å; F71-S74 VanDerWaalsContact O-OG 3.06Å; E72-S74 VanDerWaalsContact C-N 3.31Å; E72-S74 PolarHBondContact O-N 3.5Å; S74-P77 VanDerWaalsContact O-CD 3.29Å; S74-P77 WeakPolarHBondContact O-CD 3.5Å; S74-P77 WeakPolarHBondContact O-CG 3.26Å
75	Q	52.4	Low	59.8	Low	139 Å²	139	125 Å²	125	65%	0.65	63%	0.633	S	S	*	*	G	3₁₀ helix	trans	-95.3	-15.8	175.2	-72.4	-153.5	51.8	0	0	114.5	E72 E73 L78	E72-Q75 PolarHBondContact O-N 2.97Å; E73-Q75 VanDerWaalsContact C-N 3.28Å; E73-Q75 PolarHBondContact O-N 2.86Å; Q75-L78 PolarHBondContact O-N 3.41Å
76	Q	52.7	Low	61.6	Low	147 Å²	147	123.9 Å²	123.9	69%	0.687	63%	0.625	S	S	*	*	H	α-helix	trans	-63.1	-31.7	172.2	-94.2	-179.3	10.4	0	0	116.5	L78 T79 L80	Q76-L78 PolarHBondContact O-N 3.09Å; Q76-T79 PolarHBondContact O-N 3.02Å; Q76-L80 PolarHBondContact O-N 2.82Å
77	P	55.5	Low	63.5	Low	75 Å²	75	118.9 Å²	118.9	49%	0.487	61%	0.605	S	S	.	*	H	α-helix	trans	-67.4	-22.8	-179.3	25.6	-33.5	0	0	0	112.6	S74 N81	S74-P77 VanDerWaalsContact O-CD 3.29Å; S74-P77 WeakPolarHBondContact O-CD 3.5Å; S74-P77 WeakPolarHBondContact O-CG 3.26Å; P77-N81 WeakPolarHBondContact O-CB 3.47Å; P77-N81 PolarHBondContact O-N 3.23Å
78	L	58.3	Low	65.3	Low	106 Å²	106	118.9 Å²	118.9	56%	0.555	60%	0.597	S	S	*	*	H	α-helix	trans	-68.1	-44.8	178.6	-65.5	178.6	0	0	0	111.2	Q75 Q76 L80 N81 E82	Q75-L78 PolarHBondContact O-N 3.41Å; Q76-L78 PolarHBondContact O-N 3.09Å; L78-L80 PolarHBondContact O-N 3.39Å; L78-N81 PolarHBondContact O-N 3.31Å; L78-E82 WeakPolarHBondContact O-CB 3.23Å; L78-E82 WeakPolarHBondContact O-CG 3.22Å; L78-E82 PolarHBondContact O-N 3.27Å
79	T	59.7	Low	67.1	Low	82 Å²	82	118.4 Å²	118.4	50%	0.503	59%	0.589	S	S	.	*	H	α-helix	trans	-65.2	-40.2	178.5	-40.3	0	0	0	0	111.7	Q76 E82 I83	Q76-T79 PolarHBondContact O-N 3.02Å; T79-E82 PolarHBondContact O-N 3.3Å; T79-I83 HydrophobicContact CG2-CD1 4.38Å; T79-I83 VanDerWaalsContact O-CG1 3.3Å; T79-I83 WeakPolarHBondContact O-CG1 3.35Å; T79-I83 PolarHBondContact O-N 2.84Å
80	L	63.8	Low	69	Low	119 Å²	119	116.6 Å²	116.6	62%	0.623	58%	0.578	S	S	*	*	H	α-helix	trans	-67.9	-40.9	176.6	-169.1	134.4	0	0	0	111.2	Q76 L78 I83 M84	Q76-L80 PolarHBondContact O-N 2.82Å; L78-L80 PolarHBondContact O-N 3.39Å; L80-I83 PolarHBondContact O-N 3.04Å; L80-M84 HydrophobicContact CD2-CG 4.03Å; L80-M84 VanDerWaalsContact O-CB 3.3Å; L80-M84 WeakPolarHBondContact O-CB 3.47Å; L80-M84 WeakPolarHBondContact O-CG 3.38Å; L80-M84 PolarHBondContact O-N 3.45Å
81	N	76.1	Confident	70.9	Confident	91 Å²	91	117.2 Å²	117.2	49%	0.487	58%	0.576	S	S	.	*	H	α-helix	trans	-64.7	-39	176.1	-162	14.2	0	0	0	111.6	P77 L78 M84 L85	P77-N81 WeakPolarHBondContact O-CB 3.47Å; P77-N81 PolarHBondContact O-N 3.23Å; L78-N81 PolarHBondContact O-N 3.31Å; N81-M84 PolarHBondContact O-N 3.33Å; N81-L85 WeakPolarHBondContact O-CB 3.48Å; N81-L85 WeakPolarHBondContact O-CD1 3.32Å; N81-L85 PolarHBondContact O-N 3.38Å; N81-L85 VanDerWaalsContact OD1-CD1 3.22Å; N81-L85 WeakPolarHBondContact OD1-CD1 3.37Å
82	E	81.3	Confident	72.9	Confident	114 Å²	114	115.3 Å²	115.3	53%	0.533	56%	0.564	S	S	.	*	H	α-helix	trans	-63.7	-44.5	174.6	-77.9	-173.7	-173.6	0	0	112.9	L78 T79 L85 K86	L78-E82 WeakPolarHBondContact O-CB 3.23Å; L78-E82 WeakPolarHBondContact O-CG 3.22Å; L78-E82 PolarHBondContact O-N 3.27Å; T79-E82 PolarHBondContact O-N 3.3Å; E82-L85 PolarHBondContact O-N 3.27Å; E82-K86 WeakPolarHBondContact O-CB 3.38Å; E82-K86 WeakPolarHBondContact O-CG 3.41Å; E82-K86 PolarHBondContact O-N 2.87Å
83	I	82.7	Confident	74.8	Confident	102 Å²	102	109.8 Å²	109.8	52%	0.523	55%	0.546	S	S	.	.	H	α-helix	trans	-63.7	-44.7	176.3	-67.2	166.5	0	0	0	109.9	T79 L80 K86 L87	T79-I83 HydrophobicContact CG2-CD1 4.38Å; T79-I83 VanDerWaalsContact O-CG1 3.3Å; T79-I83 WeakPolarHBondContact O-CG1 3.35Å; T79-I83 PolarHBondContact O-N 2.84Å; L80-I83 PolarHBondContact O-N 3.04Å; I83-K86 PolarHBondContact O-N 2.92Å; I83-L87 PolarHBondContact O-N 3.36Å
84	M	80.6	Confident	76.6	Confident	97 Å²	97	107.4 Å²	107.4	48%	0.478	54%	0.537	S	S	.	.	H	α-helix	trans	-60.4	-47.5	177	-75.2	-70.8	-71.5	0	0	111.7	L80 N81 K86 L87 I88	L80-M84 HydrophobicContact CD2-CG 4.03Å; L80-M84 VanDerWaalsContact O-CB 3.3Å; L80-M84 WeakPolarHBondContact O-CB 3.47Å; L80-M84 WeakPolarHBondContact O-CG 3.38Å; L80-M84 PolarHBondContact O-N 3.45Å; N81-M84 PolarHBondContact O-N 3.33Å; M84-K86 VanDerWaalsContact C-N 3.34Å; M84-K86 PolarHBondContact O-N 3.28Å; M84-L87 WeakPolarHBondContact O-CB 3.47Å; M84-L87 PolarHBondContact O-N 2.85Å; M84-L87 VanDerWaalsContact O-N 3.14Å; M84-I88 WeakPolarHBondContact O-CB 3.39Å; M84-I88 VanDerWaalsContact O-CG1 3.23Å; M84-I88 WeakPolarHBondContact O-CG1 3.46Å; M84-I88 PolarHBondContact O-N 3.31Å
85	L	84.9	Confident	78.2	Confident	103 Å²	103	109.3 Å²	109.3	54%	0.539	54%	0.542	S	S	.	.	H	α-helix	trans	-59.2	-44.2	175.8	-105.3	77.7	0	0	0	111.8	N81 E82 L87 I88 Y89	N81-L85 WeakPolarHBondContact O-CB 3.48Å; N81-L85 WeakPolarHBondContact O-CD1 3.32Å; N81-L85 PolarHBondContact O-N 3.38Å; N81-L85 VanDerWaalsContact OD1-CD1 3.22Å; N81-L85 WeakPolarHBondContact OD1-CD1 3.37Å; E82-L85 PolarHBondContact O-N 3.27Å; L85-L87 VanDerWaalsContact C-N 3.29Å; L85-L87 PolarHBondContact O-N 3.42Å; L85-I88 PolarHBondContact O-N 3Å; L85-Y89 WeakPolarHBondContact O-CB 3.3Å; L85-Y89 PolarHBondContact O-N 3.44Å
86	K	89.8	Confident	79.9	Confident	136 Å²	136	105.9 Å²	105.9	59%	0.591	53%	0.526	S	S	*	.	H	α-helix	trans	-60.8	-39.7	176.1	-76.7	172.9	-179.5	167.4	0	111.5	E82 I83 M84 K90	E82-K86 WeakPolarHBondContact O-CB 3.38Å; E82-K86 WeakPolarHBondContact O-CG 3.41Å; E82-K86 PolarHBondContact O-N 2.87Å; I83-K86 PolarHBondContact O-N 2.92Å; M84-K86 VanDerWaalsContact C-N 3.34Å; M84-K86 PolarHBondContact O-N 3.28Å; K86-K90 WeakPolarHBondContact O-CG 3.5Å; K86-K90 PolarHBondContact O-N 3.49Å; K86-K90 VanDerWaalsContact O-N 3.11Å
87	L	88.4	Confident	81.5	Confident	100 Å²	100	106 Å²	106	52%	0.524	52%	0.521	S	S	.	.	H	α-helix	trans	-68.5	-45.1	178.2	-145.7	105.8	0	0	0	111.4	I83 M84 L85 Y89 K90 L91	I83-L87 PolarHBondContact O-N 3.36Å; M84-L87 WeakPolarHBondContact O-CB 3.47Å; M84-L87 PolarHBondContact O-N 2.85Å; M84-L87 VanDerWaalsContact O-N 3.14Å; L85-L87 VanDerWaalsContact C-N 3.29Å; L85-L87 PolarHBondContact O-N 3.42Å; L87-Y89 PolarHBondContact O-N 3.14Å; L87-K90 PolarHBondContact O-N 2.94Å; L87-L91 HydrophobicContact CD2-CD1 4.07Å; L87-L91 HydrophobicContact CG-CD1 4.48Å; L87-L91 PolarHBondContact O-N 3.42Å
88	I	88.5	Confident	82.8	Confident	85 Å²	85	107.4 Å²	107.4	44%	0.436	52%	0.524	S	S	.	.	H	α-helix	trans	-59.4	-47.3	176.8	-69.8	163.7	0	0	0	110.3	M84 L85 K90 L91 W92	M84-I88 WeakPolarHBondContact O-CB 3.39Å; M84-I88 VanDerWaalsContact O-CG1 3.23Å; M84-I88 WeakPolarHBondContact O-CG1 3.46Å; M84-I88 PolarHBondContact O-N 3.31Å; L85-I88 PolarHBondContact O-N 3Å; I88-K90 VanDerWaalsContact C-N 3.34Å; I88-K90 PolarHBondContact O-N 2.89Å; I88-L91 PolarHBondContact O-N 3.49Å; I88-W92 WeakPolarHBondContact O-CB 3.33Å; I88-W92 PolarHBondContact O-N 2.94Å
89	Y	89.8	Confident	84.1	Confident	162 Å²	162	110.7 Å²	110.7	64%	0.635	53%	0.529	S	S	*	.	H	α-helix	trans	-63	-40.2	179	-170.5	-92.9	0	0	0	112.1	L85 L87 W92 A93	L85-Y89 WeakPolarHBondContact O-CB 3.3Å; L85-Y89 PolarHBondContact O-N 3.44Å; L87-Y89 PolarHBondContact O-N 3.14Å; Y89-W92 HydrophobicContact CE2-CE3 4.46Å; Y89-W92 PolarHBondContact O-N 3.08Å; Y89-A93 WeakPolarHBondContact O-CB 3.37Å; Y89-A93 PolarHBondContact O-N 3.2Å
90	K	92	Very high	85.4	Confident	147 Å²	147	115.2 Å²	115.2	64%	0.639	54%	0.542	S	S	*	.	H	α-helix	trans	-63.1	-45.4	174	-79.4	-178.2	176.5	-176.5	0	112.3	K86 L87 I88 W92 A93 I94	K86-K90 WeakPolarHBondContact O-CG 3.5Å; K86-K90 PolarHBondContact O-N 3.49Å; K86-K90 VanDerWaalsContact O-N 3.11Å; L87-K90 PolarHBondContact O-N 2.94Å; I88-K90 VanDerWaalsContact C-N 3.34Å; I88-K90 PolarHBondContact O-N 2.89Å; K90-W92 VanDerWaalsContact C-N 3.33Å; K90-W92 PolarHBondContact O-N 3.32Å; K90-A93 PolarHBondContact O-N 3.48Å; K90-I94 WeakPolarHBondContact O-CG1 3.35Å; K90-I94 PolarHBondContact O-N 3.41Å; K90-I94 VanDerWaalsContact O-N 3.08Å
91	L	87.2	Confident	86.3	Confident	97 Å²	97	116.1 Å²	116.1	51%	0.508	55%	0.545	S	S	.	.	H	α-helix	trans	-60.6	-44.4	175.9	-106.4	113.7	0	0	0	111.4	L87 I88 A93 I94 L95	L87-L91 HydrophobicContact CD2-CD1 4.07Å; L87-L91 HydrophobicContact CG-CD1 4.48Å; L87-L91 PolarHBondContact O-N 3.42Å; I88-L91 PolarHBondContact O-N 3.49Å; L91-A93 VanDerWaalsContact C-N 3.34Å; L91-A93 PolarHBondContact O-N 2.93Å; L91-I94 PolarHBondContact O-N 3.22Å; L91-L95 PolarHBondContact O-N 3.45Å
92	W	91.6	Very high	86.6	Confident	140 Å²	140	119.4 Å²	119.4	53%	0.53	56%	0.561	S	S	.	*	H	α-helix	trans	-60.7	-42.1	177.6	-174.6	80.1	0	0	0	111.9	I88 Y89 K90 I94 L95 Q96	I88-W92 WeakPolarHBondContact O-CB 3.33Å; I88-W92 PolarHBondContact O-N 2.94Å; Y89-W92 HydrophobicContact CE2-CE3 4.46Å; Y89-W92 PolarHBondContact O-N 3.08Å; K90-W92 VanDerWaalsContact C-N 3.33Å; K90-W92 PolarHBondContact O-N 3.32Å; W92-I94 PolarHBondContact O-N 3.33Å; W92-L95 WeakPolarHBondContact O-CB 3.41Å; W92-L95 PolarHBondContact O-N 3.5Å; W92-Q96 HydrophobicContact CD2-CG 4.15Å; W92-Q96 HydrophobicContact CE3-CG 4.31Å; W92-Q96 HydrophobicContact CH2-CG 4.19Å; W92-Q96 HydrophobicContact CZ2-CG 4.02Å; W92-Q96 HydrophobicContact CZ3-CG 4.33Å; W92-Q96 WeakPolarHBondContact O-CG 3.33Å; W92-Q96 PolarHBondContact O-N 3.11Å
93	A	91	Very high	86.8	Confident	47 Å²	47	119.7 Å²	119.7	39%	0.388	56%	0.563	S	S	.	*	H	α-helix	trans	-62.9	-40	175.2	0	0	0	0	0	112.8	Y89 K90 L91 Q96 Y97	Y89-A93 WeakPolarHBondContact O-CB 3.37Å; Y89-A93 PolarHBondContact O-N 3.2Å; K90-A93 PolarHBondContact O-N 3.48Å; L91-A93 VanDerWaalsContact C-N 3.34Å; L91-A93 PolarHBondContact O-N 2.93Å; A93-Q96 PolarHBondContact O-N 3.19Å; A93-Y97 PolarHBondContact O-N 3.46Å
94	I	89.7	Confident	87	Confident	103 Å²	103	120.6 Å²	120.6	53%	0.528	57%	0.565	S	S	.	*	H	α-helix	trans	-65.4	-43.5	175.9	-66.3	164.7	0	0	0	110.6	K90 L91 W92 Q96 Y97 L98	K90-I94 WeakPolarHBondContact O-CG1 3.35Å; K90-I94 PolarHBondContact O-N 3.41Å; K90-I94 VanDerWaalsContact O-N 3.08Å; L91-I94 PolarHBondContact O-N 3.22Å; W92-I94 PolarHBondContact O-N 3.33Å; I94-Q96 VanDerWaalsContact C-N 3.35Å; I94-Q96 PolarHBondContact O-N 3.44Å; I94-Y97 PolarHBondContact O-N 2.92Å; I94-L98 HydrophobicContact CG2-CD1 3.96Å; I94-L98 HydrophobicContact CG2-CG 4.34Å; I94-L98 WeakPolarHBondContact O-CG 3.41Å; I94-L98 PolarHBondContact O-N 3.48Å
95	L	85.7	Confident	87.4	Confident	104 Å²	104	121.9 Å²	121.9	55%	0.545	57%	0.57	S	S	.	*	H	α-helix	trans	-59.2	-44.5	175.2	-82.6	154.6	0	0	0	111.8	L91 W92 Y97 L98 W99	L91-L95 PolarHBondContact O-N 3.45Å; W92-L95 WeakPolarHBondContact O-CB 3.41Å; W92-L95 PolarHBondContact O-N 3.5Å; L95-Y97 VanDerWaalsContact C-N 3.34Å; L95-Y97 PolarHBondContact O-N 3.48Å; L95-L98 PolarHBondContact O-N 3.19Å; L95-W99 WeakPolarHBondContact O-CB 3.5Å; L95-W99 PolarHBondContact O-N 3.42Å
96	Q	88.2	Confident	87.6	Confident	67 Å²	67	123 Å²	123	31%	0.313	57%	0.571	S	S	.	*	H	α-helix	trans	-61	-41.4	174.6	-72.9	-70.3	-42.6	0	0	112	W92 A93 I94 K100	W92-Q96 HydrophobicContact CD2-CG 4.15Å; W92-Q96 HydrophobicContact CE3-CG 4.31Å; W92-Q96 HydrophobicContact CH2-CG 4.19Å; W92-Q96 HydrophobicContact CZ2-CG 4.02Å; W92-Q96 HydrophobicContact CZ3-CG 4.33Å; W92-Q96 WeakPolarHBondContact O-CG 3.33Å; W92-Q96 PolarHBondContact O-N 3.11Å; A93-Q96 PolarHBondContact O-N 3.19Å; I94-Q96 VanDerWaalsContact C-N 3.35Å; I94-Q96 PolarHBondContact O-N 3.44Å; Q96-K100 PolarHBondContact O-N 3.08Å; Q96-K100 VanDerWaalsContact O-N 3.08Å
97	Y	86.8	Confident	87.4	Confident	149 Å²	149	122.2 Å²	122.2	58%	0.584	57%	0.57	S	S	*	*	H	α-helix	trans	-65.6	-45.3	176.9	-178	-97.4	0	0	0	112.2	A93 I94 L95 W99 K100 M101	A93-Y97 PolarHBondContact O-N 3.46Å; I94-Y97 PolarHBondContact O-N 2.92Å; L95-Y97 VanDerWaalsContact C-N 3.34Å; L95-Y97 PolarHBondContact O-N 3.48Å; Y97-W99 VanDerWaalsContact C-N 3.34Å; Y97-W99 PolarHBondContact O-N 2.97Å; Y97-K100 PolarHBondContact O-N 3.39Å; Y97-M101 HydrophobicContact CD1-CG 4.4Å; Y97-M101 HydrophobicContact CE1-CG 3.98Å; Y97-M101 WeakPolarHBondContact O-CG 3.45Å; Y97-M101 PolarHBondContact O-N 2.87Å
98	L	82.4	Confident	87.3	Confident	104 Å²	104	123.7 Å²	123.7	55%	0.545	57%	0.573	S	S	.	*	H	α-helix	trans	-62.3	-41.6	176.8	-72.9	171.7	0	0	0	111.7	I94 L95 K100 M101 L102	I94-L98 HydrophobicContact CG2-CD1 3.96Å; I94-L98 HydrophobicContact CG2-CG 4.34Å; I94-L98 WeakPolarHBondContact O-CG 3.41Å; I94-L98 PolarHBondContact O-N 3.48Å; L95-L98 PolarHBondContact O-N 3.19Å; L98-K100 VanDerWaalsContact C-N 3.32Å; L98-K100 PolarHBondContact O-N 2.99Å; L98-M101 PolarHBondContact O-N 3.47Å; L98-L102 PolarHBondContact O-N 3.23Å
99	W	85.7	Confident	87.3	Confident	176 Å²	176	126.4 Å²	126.4	67%	0.667	58%	0.583	S	S	*	*	H	α-helix	trans	-63.1	-37.7	175.8	-175.3	19.8	0	0	0	112.2	L95 Y97 M101 L102	L95-W99 WeakPolarHBondContact O-CB 3.5Å; L95-W99 PolarHBondContact O-N 3.42Å; Y97-W99 VanDerWaalsContact C-N 3.34Å; Y97-W99 PolarHBondContact O-N 2.97Å; W99-M101 VanDerWaalsContact C-N 3.28Å; W99-M101 PolarHBondContact O-N 3.4Å; W99-L102 PolarHBondContact O-N 3.2Å
100	K	87.4	Confident	87.1	Confident	177 Å²	177	123.7 Å²	123.7	77%	0.77	58%	0.579	S	S	*	*	H	α-helix	trans	-68.1	-23.8	175.4	-79.3	-172.8	174.3	-172.4	0	114.3	Q96 Y97 L98	Q96-K100 PolarHBondContact O-N 3.08Å; Q96-K100 VanDerWaalsContact O-N 3.08Å; Y97-K100 PolarHBondContact O-N 3.39Å; L98-K100 VanDerWaalsContact C-N 3.32Å; L98-K100 PolarHBondContact O-N 2.99Å
101	M	82.1	Confident	86.7	Confident	138 Å²	138	121.8 Å²	121.8	68%	0.68	57%	0.574	S	S	*	*	H	α-helix	trans	-89.9	-16.2	-180	-69.7	-71.4	-75.8	0	0	113.1	Y97 L98 W99	Y97-M101 HydrophobicContact CD1-CG 4.4Å; Y97-M101 HydrophobicContact CE1-CG 3.98Å; Y97-M101 WeakPolarHBondContact O-CG 3.45Å; Y97-M101 PolarHBondContact O-N 2.87Å; L98-M101 PolarHBondContact O-N 3.47Å; W99-M101 VanDerWaalsContact C-N 3.28Å; W99-M101 PolarHBondContact O-N 3.4Å
102	L	82.2	Confident	86.6	Confident	159 Å²	159	124 Å²	124	83%	0.832	58%	0.58	S	S	*	*			trans	-90.6	0	177.9	-167.7	77.3	0	0	0	111.1	V7 L98 W99	V7-L102 HydrophobicContact CG1-CD2 4.38Å; L98-L102 PolarHBondContact O-N 3.23Å; W99-L102 PolarHBondContact O-N 3.2Å

Retrieved 102 of 102 residues in 140.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).