A0A5K4F970_SCHMA Loading...

ATP synthase subunit epsilon, mitochondrial AlphaSync

AlphaFold DB , UniProt , Accession A0A5K4F970, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 91 aa.

						>A0A5K4F970_SCHMA|A0A5K4F970
MIPEVMALSAVSLHLTWNFYLMRPLYAHLYRAVLWGSGAYIISREVQRAFHKKKVAHLKAIDIYKSQFPDRVPVKFYPTFGEIIKPWKPLR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	84.2	Confident	93.3	Very high	178 Å²	178	74.1 Å²	74.1	88%	0.877	41%	0.407	S	S	*	.				0	-49.6	0	-58.9	-166	87.7	0	0	112.9	E4 V5	M1-E4 WeakPolarHBondContact CA-OE2 3.47Å; M1-E4 PolarHBondContact N-OE1 2.98Å; M1-E4 PolarHBondContact N-OE2 3.06Å; M1-V5 WeakPolarHBondContact O-CG2 3.33Å; M1-V5 PolarHBondContact O-N 3.36Å; M1-V5 VanDerWaalsContact O-N 3.12Å
2	I	91.2	Very high	93.4	Very high	103 Å²	103	73.3 Å²	73.3	53%	0.528	41%	0.41	S	S	.	.	H	α-helix	trans	-59.7	-51.5	-179.1	-57	172	0	0	0	113.4	E4 V5 M6	I2-E4 VanDerWaalsContact C-N 3.33Å; I2-E4 PolarHBondContact O-N 2.83Å; I2-V5 PolarHBondContact O-N 3.29Å; I2-M6 HydrophobicContact CG2-SD 4.22Å; I2-M6 WeakPolarHBondContact O-CG 3.49Å; I2-M6 PolarHBondContact O-N 3.18Å
3	P	93.3	Very high	93.5	Very high	4 Å²	4	77.1 Å²	77.1	3%	0.026	43%	0.428	C	S	.	.	H	α-helix	trans	-68.6	-31.6	-175.5	26.6	-34.7	0	0	0	113.1	M6 A7 Y40 S43	P3-M6 PolarHBondContact O-N 3.14Å; P3-A7 WeakPolarHBondContact O-CB 3.42Å; P3-A7 PolarHBondContact O-N 3.47Å; P3-Y40 HydrophobicContact CB-CD2 3.86Å; P3-Y40 HydrophobicContact CB-CE2 3.81Å; P3-Y40 HydrophobicContact CG-CE2 4.14Å; P3-S43 VanDerWaalsContact CA-OG 3.25Å; P3-S43 WeakPolarHBondContact CA-OG 3.41Å; P3-S43 VanDerWaalsContact CB-OG 3.23Å; P3-S43 WeakPolarHBondContact CB-OG 3.27Å
4	E	93.9	Very high	93.4	Very high	87 Å²	87	72.8 Å²	72.8	41%	0.407	40%	0.403	S	S	.	.	H	α-helix	trans	-67.9	-42.7	176	-54.2	84.5	169.9	0	0	110.9	M1 I2 A7 L8 Y40	M1-E4 WeakPolarHBondContact CA-OE2 3.47Å; M1-E4 PolarHBondContact N-OE1 2.98Å; M1-E4 PolarHBondContact N-OE2 3.06Å; I2-E4 VanDerWaalsContact C-N 3.33Å; I2-E4 PolarHBondContact O-N 2.83Å; E4-A7 PolarHBondContact O-N 2.85Å; E4-L8 WeakPolarHBondContact O-CB 3.46Å; E4-L8 WeakPolarHBondContact O-CG 3.37Å; E4-L8 PolarHBondContact O-N 3.21Å; E4-Y40 HydrophobicContact CG-CE2 4.41Å
5	V	95.1	Very high	93.3	Very high	92 Å²	92	71.7 Å²	71.7	56%	0.558	40%	0.396	S	S	*	.	H	α-helix	trans	-63.8	-41.7	175.8	171.8	0	0	0	0	111.1	M1 I2 L8 S9	M1-V5 WeakPolarHBondContact O-CG2 3.33Å; M1-V5 PolarHBondContact O-N 3.36Å; M1-V5 VanDerWaalsContact O-N 3.12Å; I2-V5 PolarHBondContact O-N 3.29Å; V5-L8 PolarHBondContact O-N 3.42Å; V5-S9 WeakPolarHBondContact O-CB 3.3Å; V5-S9 PolarHBondContact O-N 3.23Å; V5-S9 PolarHBondContact O-OG 3.42Å
6	M	94.4	Very high	93.3	Very high	84 Å²	84	72.3 Å²	72.3	41%	0.414	40%	0.403	S	S	.	.	H	α-helix	trans	-66.9	-36.1	176.7	-71.9	-172.6	68.1	0	0	112.9	I2 P3 S9 A10 S43	I2-M6 HydrophobicContact CG2-SD 4.22Å; I2-M6 WeakPolarHBondContact O-CG 3.49Å; I2-M6 PolarHBondContact O-N 3.18Å; P3-M6 PolarHBondContact O-N 3.14Å; M6-S9 WeakPolarHBondContact CA-OG 3.11Å; M6-S9 PolarHBondContact O-OG 2.77Å; M6-A10 WeakPolarHBondContact O-CB 3.34Å; M6-A10 PolarHBondContact O-N 3.33Å; M6-S43 WeakPolarHBondContact SD-CB 3.34Å
7	A	94.8	Very high	93.2	Very high	18 Å²	18	76.6 Å²	76.6	15%	0.149	41%	0.411	C	S	.	.	H	α-helix	trans	-66.1	-46.7	174.4	0	0	0	0	0	111.1	P3 E4 S9 A10 V11 Y40	P3-A7 WeakPolarHBondContact O-CB 3.42Å; P3-A7 PolarHBondContact O-N 3.47Å; E4-A7 PolarHBondContact O-N 2.85Å; A7-S9 VanDerWaalsContact C-N 3.33Å; A7-S9 PolarHBondContact O-N 2.87Å; A7-A10 PolarHBondContact O-N 3.38Å; A7-V11 WeakPolarHBondContact O-CG2 3.33Å; A7-V11 PolarHBondContact O-N 3.22Å; A7-Y40 HydrophobicContact CB-CD2 4.29Å
8	L	94.9	Very high	93.2	Very high	117 Å²	117	72.6 Å²	72.6	61%	0.613	39%	0.39	S	S	*	.	H	α-helix	trans	-62.5	-40.1	176.9	-72.9	172.9	0	0	0	111.8	E4 V5 V11 S12	E4-L8 WeakPolarHBondContact O-CB 3.46Å; E4-L8 WeakPolarHBondContact O-CG 3.37Å; E4-L8 PolarHBondContact O-N 3.21Å; V5-L8 PolarHBondContact O-N 3.42Å; L8-V11 PolarHBondContact O-N 3.3Å; L8-S12 VanDerWaalsContact O-CB 3.27Å; L8-S12 WeakPolarHBondContact O-CB 3.3Å; L8-S12 PolarHBondContact O-N 3.35Å; L8-S12 PolarHBondContact O-OG 2.95Å
9	S	95.5	Very high	93.1	Very high	66 Å²	66	76.5 Å²	76.5	46%	0.462	40%	0.403	S	S	.	.	H	α-helix	trans	-66.9	-38.8	177.3	70.3	0	0	0	0	111.8	V5 M6 A7 S12 L13	V5-S9 WeakPolarHBondContact O-CB 3.3Å; V5-S9 PolarHBondContact O-N 3.23Å; V5-S9 PolarHBondContact O-OG 3.42Å; M6-S9 WeakPolarHBondContact CA-OG 3.11Å; M6-S9 PolarHBondContact O-OG 2.77Å; A7-S9 VanDerWaalsContact C-N 3.33Å; A7-S9 PolarHBondContact O-N 2.87Å; S9-S12 PolarHBondContact O-N 3.49Å; S9-L13 VanDerWaalsContact O-CB 3.29Å; S9-L13 WeakPolarHBondContact O-CB 3.37Å; S9-L13 PolarHBondContact O-N 2.94Å
10	A	94.9	Very high	93.1	Very high	20 Å²	20	81.2 Å²	81.2	17%	0.165	42%	0.416	C	S	.	.	H	α-helix	trans	-65.4	-42.5	175.2	0	0	0	0	0	112.5	M6 A7 L13 H14 A39	M6-A10 WeakPolarHBondContact O-CB 3.34Å; M6-A10 PolarHBondContact O-N 3.33Å; A7-A10 PolarHBondContact O-N 3.38Å; A10-L13 PolarHBondContact O-N 2.84Å; A10-H14 PolarHBondContact O-N 3.3Å; A10-H14 VanDerWaalsContact O-N 3.08Å; A10-A39 HydrophobicContact CB-CB 3.58Å
11	V	94.4	Very high	93.2	Very high	46 Å²	46	80.6 Å²	80.6	28%	0.279	41%	0.414	S	S	.	.	H	α-helix	trans	-63.6	-45.7	174	173.6	0	0	0	0	110.5	A7 L8 L13 H14 L15	A7-V11 WeakPolarHBondContact O-CG2 3.33Å; A7-V11 PolarHBondContact O-N 3.22Å; L8-V11 PolarHBondContact O-N 3.3Å; V11-L13 VanDerWaalsContact C-N 3.31Å; V11-L13 PolarHBondContact O-N 3.07Å; V11-H14 PolarHBondContact O-N 3.38Å; V11-H14 VanDerWaalsContact O-N 3.14Å; V11-L15 HydrophobicContact CG1-CD1 4.13Å; V11-L15 HydrophobicContact CG1-CG 4.45Å; V11-L15 WeakPolarHBondContact O-CG 3.42Å; V11-L15 PolarHBondContact O-N 2.99Å
12	S	93.8	Very high	93.5	Very high	64 Å²	64	80.2 Å²	80.2	45%	0.448	41%	0.412	S	S	.	.	H	α-helix	trans	-60	-41.8	177.8	-58.3	0	0	0	0	111.5	L8 S9 H14 L15 T16	L8-S12 VanDerWaalsContact O-CB 3.27Å; L8-S12 WeakPolarHBondContact O-CB 3.3Å; L8-S12 PolarHBondContact O-N 3.35Å; L8-S12 PolarHBondContact O-OG 2.95Å; S9-S12 PolarHBondContact O-N 3.49Å; S12-H14 VanDerWaalsContact C-N 3.33Å; S12-H14 PolarHBondContact O-N 3.29Å; S12-L15 PolarHBondContact O-N 3.07Å; S12-T16 WeakPolarHBondContact O-CG2 3.43Å; S12-T16 PolarHBondContact O-N 2.77Å; S12-T16 PolarHBondContact O-OG1 3.01Å
13	L	94.7	Very high	93.4	Very high	123 Å²	123	80.8 Å²	80.8	64%	0.644	41%	0.407	S	S	*	.	H	α-helix	trans	-62.7	-38.3	176	-174.4	66.5	0	0	0	112.3	S9 A10 V11 T16 W17	S9-L13 VanDerWaalsContact O-CB 3.29Å; S9-L13 WeakPolarHBondContact O-CB 3.37Å; S9-L13 PolarHBondContact O-N 2.94Å; A10-L13 PolarHBondContact O-N 2.84Å; V11-L13 VanDerWaalsContact C-N 3.31Å; V11-L13 PolarHBondContact O-N 3.07Å; L13-T16 WeakPolarHBondContact CA-OG1 3.3Å; L13-T16 PolarHBondContact O-OG1 3.09Å; L13-W17 WeakPolarHBondContact O-CB 3.37Å; L13-W17 PolarHBondContact O-N 3.37Å
14	H	92.6	Very high	93.2	Very high	17 Å²	17	83.6 Å²	83.6	8%	0.079	43%	0.426	C	S	.	.	H	α-helix	trans	-68.4	-38.6	174.8	-174	-80.9	0	0	0	111.9	A10 V11 S12 W17 N18 R31 A32 W35	A10-H14 PolarHBondContact O-N 3.3Å; A10-H14 VanDerWaalsContact O-N 3.08Å; V11-H14 PolarHBondContact O-N 3.38Å; V11-H14 VanDerWaalsContact O-N 3.14Å; S12-H14 VanDerWaalsContact C-N 3.33Å; S12-H14 PolarHBondContact O-N 3.29Å; H14-W17 WeakPolarHBondContact O-CB 3.46Å; H14-W17 PolarHBondContact O-N 2.88Å; H14-N18 PolarHBondContact O-N 3.34Å; H14-R31 VanDerWaalsContact NE2-CB 3.3Å; H14-R31 WeakPolarHBondContact NE2-CB 3.45Å; H14-A32 HydrophobicContact CB-CB 4.33Å; H14-W35 AromaticContact CD2-CD1 3.56Å
15	L	91.9	Very high	92.8	Very high	56 Å²	56	84 Å²	84	29%	0.293	43%	0.43	S	S	.	.	H	α-helix	trans	-66.7	-41.6	176.6	-66.8	174.4	0	0	0	111.6	V11 S12 W17 N18 F19 L25	V11-L15 HydrophobicContact CG1-CD1 4.13Å; V11-L15 HydrophobicContact CG1-CG 4.45Å; V11-L15 WeakPolarHBondContact O-CG 3.42Å; V11-L15 PolarHBondContact O-N 2.99Å; S12-L15 PolarHBondContact O-N 3.07Å; L15-W17 VanDerWaalsContact C-N 3.31Å; L15-W17 PolarHBondContact O-N 3.29Å; L15-N18 PolarHBondContact O-N 3.3Å; L15-F19 PolarHBondContact O-N 2.97Å; L15-L25 HydrophobicContact CD2-CB 4.39Å; L15-L25 WeakPolarHBondContact CD2-O 3.24Å
16	T	93	Very high	92.4	Very high	82 Å²	82	87.7 Å²	87.7	50%	0.503	44%	0.435	S	S	.	.	H	α-helix	trans	-67.1	-33.2	174.8	55.9	0	0	0	0	111.9	S12 L13 F19 Y20	S12-T16 WeakPolarHBondContact O-CG2 3.43Å; S12-T16 PolarHBondContact O-N 2.77Å; S12-T16 PolarHBondContact O-OG1 3.01Å; L13-T16 WeakPolarHBondContact CA-OG1 3.3Å; L13-T16 PolarHBondContact O-OG1 3.09Å; T16-F19 WeakPolarHBondContact O-CB 3.38Å; T16-F19 PolarHBondContact O-N 3.48Å; T16-Y20 WeakPolarHBondContact O-CB 3.32Å; T16-Y20 PolarHBondContact O-N 2.88Å
17	W	92.5	Very high	92	Very high	146 Å²	146	84.5 Å²	84.5	55%	0.553	42%	0.422	S	S	*	.	H	α-helix	trans	-63.8	-43.5	172	-175.7	-106.5	0	0	0	112.5	L13 H14 L15 F19 Y20 L21	L13-W17 WeakPolarHBondContact O-CB 3.37Å; L13-W17 PolarHBondContact O-N 3.37Å; H14-W17 WeakPolarHBondContact O-CB 3.46Å; H14-W17 PolarHBondContact O-N 2.88Å; L15-W17 VanDerWaalsContact C-N 3.31Å; L15-W17 PolarHBondContact O-N 3.29Å; W17-F19 VanDerWaalsContact C-N 3.33Å; W17-F19 PolarHBondContact O-N 2.99Å; W17-Y20 HydrophobicContact CE3-CD1 4.48Å; W17-Y20 HydrophobicContact CZ3-CD1 4.26Å; W17-Y20 PolarHBondContact O-N 2.92Å; W17-L21 HydrophobicContact CD2-CD1 4.48Å; W17-L21 HydrophobicContact CZ2-CD1 4.17Å; W17-L21 VanDerWaalsContact NE1-CD1 3.31Å; W17-L21 WeakPolarHBondContact O-CG 3.48Å; W17-L21 PolarHBondContact O-N 3.41Å
18	N	92.6	Very high	91.7	Very high	4 Å²	4	86.4 Å²	86.4	2%	0.021	43%	0.428	C	S	.	.	H	α-helix	trans	-61.2	-43.1	173.4	-79.6	-19.5	0	0	0	111.7	H14 L15 L21 M22 R23 L25 A27	H14-N18 PolarHBondContact O-N 3.34Å; L15-N18 PolarHBondContact O-N 3.3Å; N18-L21 PolarHBondContact O-N 3.13Å; N18-M22 PolarHBondContact O-N 3.14Å; N18-R23 HydrophobicContact CB-CB 4.48Å; N18-R23 PolarHBondContact O-N 3.42Å; N18-L25 PolarHBondContact ND2-O 2.89Å; N18-A27 PolarHBondContact ND2-O 3.01Å
19	F	91.6	Very high	91.4	Very high	146 Å²	146	85.4 Å²	85.4	64%	0.64	42%	0.422	S	S	*	.	H	α-helix	trans	-60.9	-44.6	176.3	-177.7	-100	0	0	0	111.9	L15 T16 W17 L21 M22 L25	L15-F19 PolarHBondContact O-N 2.97Å; T16-F19 WeakPolarHBondContact O-CB 3.38Å; T16-F19 PolarHBondContact O-N 3.48Å; W17-F19 VanDerWaalsContact C-N 3.33Å; W17-F19 PolarHBondContact O-N 2.99Å; F19-L21 VanDerWaalsContact C-N 3.3Å; F19-L21 PolarHBondContact O-N 3.08Å; F19-M22 PolarHBondContact O-N 3.44Å; F19-M22 VanDerWaalsContact O-N 3.09Å; F19-L25 HydrophobicContact CB-CD2 4.12Å
20	Y	93.7	Very high	91.3	Very high	171 Å²	171	89.1 Å²	89.1	67%	0.671	43%	0.427	S	S	*	.	H	α-helix	trans	-61	-37.4	176.8	-179.5	-103.1	0	0	0	112.7	T16 W17 M22	T16-Y20 WeakPolarHBondContact O-CB 3.32Å; T16-Y20 PolarHBondContact O-N 2.88Å; W17-Y20 HydrophobicContact CE3-CD1 4.48Å; W17-Y20 HydrophobicContact CZ3-CD1 4.26Å; W17-Y20 PolarHBondContact O-N 2.92Å; Y20-M22 PolarHBondContact O-N 2.98Å
21	L	93.6	Very high	91.2	Very high	68 Å²	68	93.5 Å²	93.5	36%	0.356	44%	0.439	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.8	9	177.2	-68.3	178.2	0	0	0	114.1	W17 N18 F19 R23	W17-L21 HydrophobicContact CD2-CD1 4.48Å; W17-L21 HydrophobicContact CZ2-CD1 4.17Å; W17-L21 VanDerWaalsContact NE1-CD1 3.31Å; W17-L21 WeakPolarHBondContact O-CG 3.48Å; W17-L21 PolarHBondContact O-N 3.41Å; N18-L21 PolarHBondContact O-N 3.13Å; F19-L21 VanDerWaalsContact C-N 3.3Å; F19-L21 PolarHBondContact O-N 3.08Å; L21-R23 HydrophobicContact CB-CG 4.09Å; L21-R23 PolarHBondContact O-N 3.45Å
22	M	90.8	Very high	91.1	Very high	171 Å²	171	91.5 Å²	91.5	84%	0.842	43%	0.428	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.5	32.5	-176	-57.7	-64.8	173.2	0	0	112.9	N18 F19 Y20	N18-M22 PolarHBondContact O-N 3.14Å; F19-M22 PolarHBondContact O-N 3.44Å; F19-M22 VanDerWaalsContact O-N 3.09Å; Y20-M22 PolarHBondContact O-N 2.98Å
23	R	90.1	Very high	91.1	Very high	115 Å²	115	93.2 Å²	93.2	43%	0.434	44%	0.435	S	S	.	.			trans	-98.1	148.9	174.6	-64.8	178.1	178.5	-160.9	-4.9	109	N18 L21 A27 H28	N18-R23 HydrophobicContact CB-CB 4.48Å; N18-R23 PolarHBondContact O-N 3.42Å; L21-R23 HydrophobicContact CB-CG 4.09Å; L21-R23 PolarHBondContact O-N 3.45Å; R23-A27 HydrophobicContact CB-CB 4.05Å; R23-H28 PolarHBondContact NH1-CE1 2.97Å; R23-H28 VanDerWaalsContact NH1-CE1 3.29Å
24	P	89.1	Confident	91.1	Very high	63 Å²	63	92.5 Å²	92.5	41%	0.409	43%	0.432	S	S	.	.			trans	-57.7	145.5	172.8	21.3	-28.6	0	0	0	110.1	Y26 A27	P24-Y26 HydrophobicContact CB-CD1 3.93Å; P24-Y26 HydrophobicContact CB-CD2 4.32Å; P24-Y26 HydrophobicContact CB-CE1 3.47Å; P24-Y26 VanDerWaalsContact CB-CE1 3.47Å; P24-Y26 HydrophobicContact CB-CE2 3.89Å; P24-Y26 HydrophobicContact CB-CG 4.33Å; P24-Y26 VanDerWaalsContact CB-CZ 3.44Å; P24-Y26 HydrophobicContact CG-CD2 4.44Å; P24-Y26 HydrophobicContact CG-CE1 4.34Å; P24-Y26 HydrophobicContact CG-CE2 3.87Å; P24-Y26 PolarHBondContact O-N 2.97Å; P24-Y26 VanDerWaalsContact O-N 3.13Å; P24-A27 HydrophobicContact CG-CB 4.12Å; P24-A27 WeakPolarHBondContact O-CB 3.42Å; P24-A27 PolarHBondContact O-N 3.21Å
25	L	85	Confident	91.2	Very high	95 Å²	95	99.3 Å²	99.3	50%	0.497	46%	0.457	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.7	-34.2	-175.8	-67	175.7	0	0	0	112.8	L15 N18 F19 A27	L15-L25 HydrophobicContact CD2-CB 4.39Å; L15-L25 WeakPolarHBondContact CD2-O 3.24Å; N18-L25 PolarHBondContact ND2-O 2.89Å; F19-L25 HydrophobicContact CB-CD2 4.12Å; L25-A27 VanDerWaalsContact C-N 3.25Å; L25-A27 PolarHBondContact O-N 3.37Å
26	Y	85.9	Confident	91.3	Very high	170 Å²	170	96.9 Å²	96.9	67%	0.667	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.5	0.3	176.7	60.5	-99.6	0	0	0	114.1	P24 H28 L29	P24-Y26 HydrophobicContact CB-CD1 3.93Å; P24-Y26 HydrophobicContact CB-CD2 4.32Å; P24-Y26 HydrophobicContact CB-CE1 3.47Å; P24-Y26 VanDerWaalsContact CB-CE1 3.47Å; P24-Y26 HydrophobicContact CB-CE2 3.89Å; P24-Y26 HydrophobicContact CB-CG 4.33Å; P24-Y26 VanDerWaalsContact CB-CZ 3.44Å; P24-Y26 HydrophobicContact CG-CD2 4.44Å; P24-Y26 HydrophobicContact CG-CE1 4.34Å; P24-Y26 HydrophobicContact CG-CE2 3.87Å; P24-Y26 PolarHBondContact O-N 2.97Å; P24-Y26 VanDerWaalsContact O-N 3.13Å; Y26-H28 PolarHBondContact O-N 3.4Å; Y26-L29 WeakPolarHBondContact O-CG 3.37Å
27	A	86.6	Confident	91.4	Very high	16 Å²	16	95.8 Å²	95.8	13%	0.132	44%	0.441	C	S	.	.	T	Hydrogen-bonded Turn	trans	-62.9	130.4	173.5	0	0	0	0	0	109.5	N18 R23 P24 L25 L29	N18-A27 PolarHBondContact ND2-O 3.01Å; R23-A27 HydrophobicContact CB-CB 4.05Å; P24-A27 HydrophobicContact CG-CB 4.12Å; P24-A27 WeakPolarHBondContact O-CB 3.42Å; P24-A27 PolarHBondContact O-N 3.21Å; L25-A27 VanDerWaalsContact C-N 3.25Å; L25-A27 PolarHBondContact O-N 3.37Å; A27-L29 PolarHBondContact O-N 2.94Å
28	H	88.3	Confident	91.6	Very high	59 Å²	59	90 Å²	90	27%	0.273	43%	0.427	S	S	.	.	T	Hydrogen-bonded Turn	trans	58.7	41.4	176.5	-47.5	80.3	0	0	0	114.2	R23 Y26 Y30 R31 A32	R23-H28 PolarHBondContact NH1-CE1 2.97Å; R23-H28 VanDerWaalsContact NH1-CE1 3.29Å; Y26-H28 PolarHBondContact O-N 3.4Å; H28-Y30 HydrophobicContact CB-CE1 4.05Å; H28-Y30 PolarHBondContact O-N 3.23Å; H28-Y30 VanDerWaalsContact O-N 3.14Å; H28-R31 HydrophobicContact CB-CB 4.24Å; H28-R31 HydrophobicContact CB-CG 3.97Å; H28-R31 WeakPolarHBondContact O-CA 3.4Å; H28-R31 WeakPolarHBondContact O-CB 3.5Å; H28-R31 PolarHBondContact O-N 2.88Å; H28-A32 PolarHBondContact O-N 3.18Å
29	L	90.1	Very high	91.8	Very high	95 Å²	95	90.8 Å²	90.8	50%	0.497	43%	0.434	S	S	.	.	H	α-helix	trans	-52.6	-35.2	176.5	-78.8	170.9	0	0	0	113.6	Y26 A27 R31 A32 V33	Y26-L29 WeakPolarHBondContact O-CG 3.37Å; A27-L29 PolarHBondContact O-N 2.94Å; L29-R31 PolarHBondContact O-N 2.68Å; L29-A32 WeakPolarHBondContact O-CB 3.5Å; L29-A32 PolarHBondContact O-N 3.28Å; L29-V33 WeakPolarHBondContact O-CG2 3.37Å; L29-V33 PolarHBondContact O-N 3.49Å
30	Y	92.4	Very high	92	Very high	145 Å²	145	88.1 Å²	88.1	57%	0.569	42%	0.42	S	S	*	.	H	α-helix	trans	-56.8	-34.8	175	70.5	-90.6	0	0	0	112.4	H28 L34	H28-Y30 HydrophobicContact CB-CE1 4.05Å; H28-Y30 PolarHBondContact O-N 3.23Å; H28-Y30 VanDerWaalsContact O-N 3.14Å; Y30-L34 WeakPolarHBondContact O-CB 3.32Å; Y30-L34 PolarHBondContact O-N 3.49Å
31	R	92.1	Very high	92.2	Very high	111 Å²	111	84.8 Å²	84.8	42%	0.419	41%	0.413	S	S	.	.	H	α-helix	trans	-71.2	-42.2	175.1	-61.9	-174.6	-175.5	-175.4	-3.9	111	H14 H28 L29 V33 L34 W35	H14-R31 VanDerWaalsContact NE2-CB 3.3Å; H14-R31 WeakPolarHBondContact NE2-CB 3.45Å; H28-R31 HydrophobicContact CB-CB 4.24Å; H28-R31 HydrophobicContact CB-CG 3.97Å; H28-R31 WeakPolarHBondContact O-CA 3.4Å; H28-R31 WeakPolarHBondContact O-CB 3.5Å; H28-R31 PolarHBondContact O-N 2.88Å; L29-R31 PolarHBondContact O-N 2.68Å; R31-V33 VanDerWaalsContact C-N 3.3Å; R31-V33 PolarHBondContact O-N 2.93Å; R31-L34 PolarHBondContact O-N 3.46Å; R31-W35 WeakPolarHBondContact O-CB 3.26Å; R31-W35 PolarHBondContact O-N 3.24Å
32	A	92	Very high	92.3	Very high	4 Å²	4	86.9 Å²	86.9	3%	0.033	42%	0.423	C	S	.	.	H	α-helix	trans	-59	-43.2	175.7	0	0	0	0	0	111.4	H14 H28 L29 W35 G36	H14-A32 HydrophobicContact CB-CB 4.33Å; H28-A32 PolarHBondContact O-N 3.18Å; L29-A32 WeakPolarHBondContact O-CB 3.5Å; L29-A32 PolarHBondContact O-N 3.28Å; A32-W35 PolarHBondContact O-N 3.06Å; A32-G36 PolarHBondContact O-N 3.36Å
33	V	94.2	Very high	92.6	Very high	100 Å²	100	78.9 Å²	78.9	61%	0.606	39%	0.385	S	S	*	.	H	α-helix	trans	-65	-41.9	175.6	175.8	0	0	0	0	111.4	L29 R31 G36 S37	L29-V33 WeakPolarHBondContact O-CG2 3.37Å; L29-V33 PolarHBondContact O-N 3.49Å; R31-V33 VanDerWaalsContact C-N 3.3Å; R31-V33 PolarHBondContact O-N 2.93Å; V33-G36 PolarHBondContact O-N 2.95Å; V33-S37 VanDerWaalsContact O-CB 3.3Å; V33-S37 WeakPolarHBondContact O-CB 3.25Å; V33-S37 PolarHBondContact O-N 3.32Å; V33-S37 PolarHBondContact O-OG 2.89Å
34	L	94.9	Very high	92.9	Very high	109 Å²	109	78.7 Å²	78.7	57%	0.571	38%	0.384	S	S	*	.	H	α-helix	trans	-62.5	-47.9	175.9	-169.6	162.3	0	0	0	111.2	Y30 R31 S37 G38	Y30-L34 WeakPolarHBondContact O-CB 3.32Å; Y30-L34 PolarHBondContact O-N 3.49Å; R31-L34 PolarHBondContact O-N 3.46Å; L34-S37 PolarHBondContact O-OG 3.49Å; L34-S37 VanDerWaalsContact O-OG 3.07Å; L34-G38 PolarHBondContact O-N 2.97Å
35	W	94	Very high	93.3	Very high	159 Å²	159	80.1 Å²	80.1	60%	0.602	39%	0.385	S	S	*	.	H	α-helix	trans	-62.5	-44.4	177.3	-77.5	115.3	0	0	0	112.2	H14 R31 A32 A39	H14-W35 AromaticContact CD2-CD1 3.56Å; R31-W35 WeakPolarHBondContact O-CB 3.26Å; R31-W35 PolarHBondContact O-N 3.24Å; A32-W35 PolarHBondContact O-N 3.06Å; W35-A39 VanDerWaalsContact O-CB 3.24Å; W35-A39 WeakPolarHBondContact O-CB 3.44Å; W35-A39 PolarHBondContact O-N 2.72Å
36	G	95.2	Very high	93.8	Very high	6 Å²	6	78.9 Å²	78.9	6%	0.062	38%	0.381	C	S	.	.	H	α-helix	trans	-63.2	-47.8	177.5	0	0	0	0	0	112.9	A32 V33 Y40	A32-G36 PolarHBondContact O-N 3.36Å; V33-G36 PolarHBondContact O-N 2.95Å; G36-Y40 WeakPolarHBondContact O-CB 3.23Å; G36-Y40 PolarHBondContact O-N 3.37Å
37	S	95.7	Very high	94.3	Very high	59 Å²	59	74.7 Å²	74.7	41%	0.413	37%	0.368	S	S	.	.	H	α-helix	trans	-67.1	-41	178	58.7	0	0	0	0	112.4	V33 L34 Y40 I41	V33-S37 VanDerWaalsContact O-CB 3.3Å; V33-S37 WeakPolarHBondContact O-CB 3.25Å; V33-S37 PolarHBondContact O-N 3.32Å; V33-S37 PolarHBondContact O-OG 2.89Å; L34-S37 PolarHBondContact O-OG 3.49Å; L34-S37 VanDerWaalsContact O-OG 3.07Å; S37-Y40 WeakPolarHBondContact O-CB 3.22Å; S37-Y40 PolarHBondContact O-N 3Å; S37-I41 WeakPolarHBondContact O-CG1 3.38Å; S37-I41 PolarHBondContact O-N 2.95Å
38	G	96.3	Very high	94.8	Very high	25 Å²	25	78.8 Å²	78.8	26%	0.258	38%	0.38	S	S	.	.	H	α-helix	trans	-60.9	-47.9	174.5	0	0	0	0	0	112.3	L34 Y40 I41 I42	L34-G38 PolarHBondContact O-N 2.97Å; G38-Y40 VanDerWaalsContact C-N 3.31Å; G38-Y40 PolarHBondContact O-N 2.93Å; G38-I41 PolarHBondContact O-N 3.01Å; G38-I42 VanDerWaalsContact O-CG1 3.3Å; G38-I42 WeakPolarHBondContact O-CG1 3.19Å; G38-I42 PolarHBondContact O-N 3.29Å
39	A	95.8	Very high	95.2	Very high	20 Å²	20	78.2 Å²	78.2	17%	0.165	39%	0.386	C	S	.	.	H	α-helix	trans	-61.6	-38.9	175.9	0	0	0	0	0	112.1	A10 W35 S43	A10-A39 HydrophobicContact CB-CB 3.58Å; W35-A39 VanDerWaalsContact O-CB 3.24Å; W35-A39 WeakPolarHBondContact O-CB 3.44Å; W35-A39 PolarHBondContact O-N 2.72Å; A39-S43 WeakPolarHBondContact O-CB 3.37Å; A39-S43 PolarHBondContact O-N 2.95Å; A39-S43 PolarHBondContact O-OG 3.41Å
40	Y	97	Very high	95.6	Very high	89 Å²	89	79.7 Å²	79.7	35%	0.349	39%	0.388	S	S	.	.	H	α-helix	trans	-61.9	-46.7	175.3	-176.7	-95	0	0	0	112.4	P3 E4 A7 G36 S37 G38 S43 R44	P3-Y40 HydrophobicContact CB-CD2 3.86Å; P3-Y40 HydrophobicContact CB-CE2 3.81Å; P3-Y40 HydrophobicContact CG-CE2 4.14Å; E4-Y40 HydrophobicContact CG-CE2 4.41Å; A7-Y40 HydrophobicContact CB-CD2 4.29Å; G36-Y40 WeakPolarHBondContact O-CB 3.23Å; G36-Y40 PolarHBondContact O-N 3.37Å; S37-Y40 WeakPolarHBondContact O-CB 3.22Å; S37-Y40 PolarHBondContact O-N 3Å; G38-Y40 VanDerWaalsContact C-N 3.31Å; G38-Y40 PolarHBondContact O-N 2.93Å; Y40-S43 WeakPolarHBondContact CA-OG 3.29Å; Y40-S43 PolarHBondContact O-OG 2.7Å; Y40-R44 VanDerWaalsContact O-CB 3.26Å; Y40-R44 WeakPolarHBondContact O-CB 3.25Å; Y40-R44 PolarHBondContact O-N 3.41Å
41	I	96.7	Very high	95.8	Very high	102 Å²	102	78.5 Å²	78.5	52%	0.523	39%	0.388	S	S	.	.	H	α-helix	trans	-64.3	-48.3	-179.8	-67.1	165.6	0	0	0	110.4	S37 G38 S43 R44 E45	S37-I41 WeakPolarHBondContact O-CG1 3.38Å; S37-I41 PolarHBondContact O-N 2.95Å; G38-I41 PolarHBondContact O-N 3.01Å; I41-S43 PolarHBondContact O-N 3.02Å; I41-R44 PolarHBondContact O-N 2.86Å; I41-E45 PolarHBondContact O-N 3.42Å
42	I	96.9	Very high	96	Very high	111 Å²	111	80.5 Å²	80.5	57%	0.569	40%	0.399	S	S	*	.	H	α-helix	trans	-60.2	-49.7	179.9	-67.2	166.6	0	0	0	110.6	G38 R44 E45 V46	G38-I42 VanDerWaalsContact O-CG1 3.3Å; G38-I42 WeakPolarHBondContact O-CG1 3.19Å; G38-I42 PolarHBondContact O-N 3.29Å; I42-R44 VanDerWaalsContact C-N 3.3Å; I42-R44 PolarHBondContact O-N 2.85Å; I42-E45 PolarHBondContact O-N 2.95Å; I42-V46 HydrophobicContact CG2-CG2 4.44Å; I42-V46 WeakPolarHBondContact O-CG2 3.48Å; I42-V46 PolarHBondContact O-N 3.29Å
43	S	96.1	Very high	96.3	Very high	4 Å²	4	87.5 Å²	87.5	3%	0.028	43%	0.429	C	S	.	.	H	α-helix	trans	-62.6	-36.8	-179.3	58	0	0	0	0	112.6	P3 M6 A39 Y40 I41 V46 Q47	P3-S43 VanDerWaalsContact CA-OG 3.25Å; P3-S43 WeakPolarHBondContact CA-OG 3.41Å; P3-S43 VanDerWaalsContact CB-OG 3.23Å; P3-S43 WeakPolarHBondContact CB-OG 3.27Å; M6-S43 WeakPolarHBondContact SD-CB 3.34Å; A39-S43 WeakPolarHBondContact O-CB 3.37Å; A39-S43 PolarHBondContact O-N 2.95Å; A39-S43 PolarHBondContact O-OG 3.41Å; Y40-S43 WeakPolarHBondContact CA-OG 3.29Å; Y40-S43 PolarHBondContact O-OG 2.7Å; I41-S43 PolarHBondContact O-N 3.02Å; S43-V46 PolarHBondContact O-N 3.41Å; S43-Q47 WeakPolarHBondContact O-CB 3.47Å; S43-Q47 PolarHBondContact O-N 3.33Å
44	R	97	Very high	96.5	Very high	110 Å²	110	89.6 Å²	89.6	42%	0.415	43%	0.43	S	S	.	.	H	α-helix	trans	-64.1	-44.2	174.6	-174.1	179.4	-174.3	-139	10.8	112.3	Y40 I41 I42 Q47 R48	Y40-R44 VanDerWaalsContact O-CB 3.26Å; Y40-R44 WeakPolarHBondContact O-CB 3.25Å; Y40-R44 PolarHBondContact O-N 3.41Å; I41-R44 PolarHBondContact O-N 2.86Å; I42-R44 VanDerWaalsContact C-N 3.3Å; I42-R44 PolarHBondContact O-N 2.85Å; R44-Q47 PolarHBondContact O-N 3.45Å; R44-R48 WeakPolarHBondContact O-CB 3.38Å; R44-R48 VanDerWaalsContact O-CG 3.25Å; R44-R48 WeakPolarHBondContact O-CG 2.87Å; R44-R48 PolarHBondContact O-N 2.87Å
45	E	96.7	Very high	96.7	Very high	93 Å²	93	87.9 Å²	87.9	44%	0.435	42%	0.424	S	S	.	.	H	α-helix	trans	-65.8	-40.8	176.9	-70.2	-51	132.9	0	0	112	I41 I42 Q47 R48 A49	I41-E45 PolarHBondContact O-N 3.42Å; I42-E45 PolarHBondContact O-N 2.95Å; E45-Q47 PolarHBondContact O-N 3.43Å; E45-R48 WeakPolarHBondContact O-CB 3.41Å; E45-R48 PolarHBondContact O-N 2.93Å; E45-R48 IonicContact OE1-CZ 3.6Å; E45-R48 IonicContact OE1-NE 3.92Å; E45-R48 IonicContact OE1-NH1 2.68Å; E45-R48 PolarHBondContact OE1-NH1 3.33Å; E45-R48 IonicContact OE2-NH1 3.91Å; E45-A49 PolarHBondContact O-N 3.4Å
46	V	96.8	Very high	96.9	Very high	69 Å²	69	83.1 Å²	83.1	42%	0.418	42%	0.418	S	S	.	.	H	α-helix	trans	-60	-46.9	173.3	170.9	0	0	0	0	110.8	I42 S43 R48 A49 F50	I42-V46 HydrophobicContact CG2-CG2 4.44Å; I42-V46 WeakPolarHBondContact O-CG2 3.48Å; I42-V46 PolarHBondContact O-N 3.29Å; S43-V46 PolarHBondContact O-N 3.41Å; V46-R48 VanDerWaalsContact C-N 3.33Å; V46-R48 PolarHBondContact O-N 3.46Å; V46-A49 WeakPolarHBondContact O-CB 3.47Å; V46-A49 PolarHBondContact O-N 3.48Å; V46-F50 HydrophobicContact CG1-CD2 3.68Å; V46-F50 HydrophobicContact CG1-CE2 3.43Å; V46-F50 VanDerWaalsContact CG1-CE2 3.43Å; V46-F50 WeakPolarHBondContact O-CD2 3.42Å; V46-F50 PolarHBondContact O-N 2.89Å
47	Q	96.3	Very high	97	Very high	82 Å²	82	88.6 Å²	88.6	38%	0.383	44%	0.442	S	S	.	.	H	α-helix	trans	-61.1	-41.1	177.7	-170	179.9	18	0	0	112	S43 R44 E45 F50 H51	S43-Q47 WeakPolarHBondContact O-CB 3.47Å; S43-Q47 PolarHBondContact O-N 3.33Å; R44-Q47 PolarHBondContact O-N 3.45Å; E45-Q47 PolarHBondContact O-N 3.43Å; Q47-F50 PolarHBondContact O-N 3.38Å; Q47-H51 WeakPolarHBondContact O-CB 3.5Å; Q47-H51 PolarHBondContact O-N 2.64Å
48	R	96.5	Very high	97.1	Very high	102 Å²	102	91.1 Å²	91.1	39%	0.385	45%	0.451	S	S	.	.	H	α-helix	trans	-60.5	-44.3	174.2	-74.8	166.5	168.2	-164.5	-11.8	111.6	R44 E45 V46 H51 K52	R44-R48 WeakPolarHBondContact O-CB 3.38Å; R44-R48 VanDerWaalsContact O-CG 3.25Å; R44-R48 WeakPolarHBondContact O-CG 2.87Å; R44-R48 PolarHBondContact O-N 2.87Å; E45-R48 WeakPolarHBondContact O-CB 3.41Å; E45-R48 PolarHBondContact O-N 2.93Å; E45-R48 IonicContact OE1-CZ 3.6Å; E45-R48 IonicContact OE1-NE 3.92Å; E45-R48 IonicContact OE1-NH1 2.68Å; E45-R48 PolarHBondContact OE1-NH1 3.33Å; E45-R48 IonicContact OE2-NH1 3.91Å; V46-R48 VanDerWaalsContact C-N 3.33Å; V46-R48 PolarHBondContact O-N 3.46Å; R48-H51 PolarHBondContact O-N 2.93Å; R48-K52 WeakPolarHBondContact O-CG 3.42Å; R48-K52 PolarHBondContact O-N 3Å
49	A	97.2	Very high	97.2	Very high	48 Å²	48	96.5 Å²	96.5	40%	0.397	47%	0.467	S	S	.	.	H	α-helix	trans	-61.8	-44.3	177.3	0	0	0	0	0	112	E45 V46 K52 K53	E45-A49 PolarHBondContact O-N 3.4Å; V46-A49 WeakPolarHBondContact O-CB 3.47Å; V46-A49 PolarHBondContact O-N 3.48Å; A49-K52 PolarHBondContact O-N 3.04Å; A49-K53 WeakPolarHBondContact O-CG 3.4Å; A49-K53 PolarHBondContact O-N 3.42Å; A49-K53 VanDerWaalsContact O-N 3.14Å
50	F	97	Very high	97.3	Very high	125 Å²	125	98.1 Å²	98.1	55%	0.548	48%	0.48	S	S	.	.	H	α-helix	trans	-63.6	-41.3	174.5	-78.9	-66.1	0	0	0	112.6	V46 Q47 K53 K54	V46-F50 HydrophobicContact CG1-CD2 3.68Å; V46-F50 HydrophobicContact CG1-CE2 3.43Å; V46-F50 VanDerWaalsContact CG1-CE2 3.43Å; V46-F50 WeakPolarHBondContact O-CD2 3.42Å; V46-F50 PolarHBondContact O-N 2.89Å; Q47-F50 PolarHBondContact O-N 3.38Å; F50-K53 PolarHBondContact O-N 2.9Å; F50-K54 WeakPolarHBondContact O-CG 3.33Å; F50-K54 PolarHBondContact O-N 2.95Å
51	H	97.1	Very high	97.3	Very high	121 Å²	121	96.9 Å²	96.9	56%	0.56	48%	0.479	S	S	*	.	H	α-helix	trans	-62.6	-45	177.4	-174.3	75	0	0	0	111.5	Q47 R48 K53 K54 V55	Q47-H51 WeakPolarHBondContact O-CB 3.5Å; Q47-H51 PolarHBondContact O-N 2.64Å; R48-H51 PolarHBondContact O-N 2.93Å; H51-K53 VanDerWaalsContact C-N 3.33Å; H51-K53 PolarHBondContact O-N 3.33Å; H51-K54 PolarHBondContact O-N 3.14Å; H51-K54 VanDerWaalsContact O-N 3.16Å; H51-V55 WeakPolarHBondContact O-CG2 3.36Å; H51-V55 PolarHBondContact O-N 3.37Å
52	K	97.8	Very high	97.3	Very high	153 Å²	153	97.2 Å²	97.2	67%	0.665	48%	0.482	S	S	*	.	H	α-helix	trans	-56.4	-44.7	174.8	-73.5	177	-179.4	-179.1	0	112.1	R48 A49 V55 A56	R48-K52 WeakPolarHBondContact O-CG 3.42Å; R48-K52 PolarHBondContact O-N 3Å; A49-K52 PolarHBondContact O-N 3.04Å; K52-V55 PolarHBondContact O-N 3.33Å; K52-A56 WeakPolarHBondContact O-CB 3.49Å; K52-A56 PolarHBondContact O-N 3.12Å
53	K	97.9	Very high	97.3	Very high	150 Å²	150	95.5 Å²	95.5	65%	0.652	47%	0.473	S	S	*	.	H	α-helix	trans	-61.3	-44.7	175.7	-71.6	-178.4	177.9	-176.2	0	112.2	A49 F50 H51 A56 H57	A49-K53 WeakPolarHBondContact O-CG 3.4Å; A49-K53 PolarHBondContact O-N 3.42Å; A49-K53 VanDerWaalsContact O-N 3.14Å; F50-K53 PolarHBondContact O-N 2.9Å; H51-K53 VanDerWaalsContact C-N 3.33Å; H51-K53 PolarHBondContact O-N 3.33Å; K53-A56 PolarHBondContact O-N 3.37Å; K53-H57 WeakPolarHBondContact O-CB 3.5Å; K53-H57 PolarHBondContact O-N 3.46Å
54	K	98	Very high	97.3	Very high	145 Å²	145	100.3 Å²	100.3	63%	0.63	49%	0.491	S	S	*	.	H	α-helix	trans	-61.7	-45.7	177.1	-72.7	-179.9	179.3	-173.2	0	111.8	F50 H51 H57 L58	F50-K54 WeakPolarHBondContact O-CG 3.33Å; F50-K54 PolarHBondContact O-N 2.95Å; H51-K54 PolarHBondContact O-N 3.14Å; H51-K54 VanDerWaalsContact O-N 3.16Å; K54-H57 PolarHBondContact O-N 3.21Å; K54-L58 WeakPolarHBondContact O-CG 3.32Å; K54-L58 PolarHBondContact O-N 2.98Å
55	V	98.2	Very high	97.2	Very high	72 Å²	72	100.2 Å²	100.2	44%	0.436	49%	0.494	S	S	.	.	H	α-helix	trans	-62.6	-45	178	172.3	0	0	0	0	111	H51 K52 H57 L58 K59	H51-V55 WeakPolarHBondContact O-CG2 3.36Å; H51-V55 PolarHBondContact O-N 3.37Å; K52-V55 PolarHBondContact O-N 3.33Å; V55-H57 VanDerWaalsContact C-N 3.32Å; V55-H57 PolarHBondContact O-N 3.42Å; V55-L58 PolarHBondContact O-N 2.9Å; V55-K59 WeakPolarHBondContact O-CB 3.46Å; V55-K59 PolarHBondContact O-N 3.16Å
56	A	98.2	Very high	97.1	Very high	60 Å²	60	100 Å²	100	50%	0.496	50%	0.503	S	S	.	.	H	α-helix	trans	-60.1	-42.3	176.7	0	0	0	0	0	112.1	K52 K53 K59 A60	K52-A56 WeakPolarHBondContact O-CB 3.49Å; K52-A56 PolarHBondContact O-N 3.12Å; K53-A56 PolarHBondContact O-N 3.37Å; A56-K59 PolarHBondContact O-N 2.94Å; A56-A60 WeakPolarHBondContact O-CB 3.37Å; A56-A60 PolarHBondContact O-N 3.03Å
57	H	98.1	Very high	97.1	Very high	120 Å²	120	102.7 Å²	102.7	56%	0.556	51%	0.511	S	S	*	.	H	α-helix	trans	-64.7	-46.7	177.1	-178	65.1	0	0	0	112.6	K53 K54 V55 K59 A60 I61	K53-H57 WeakPolarHBondContact O-CB 3.5Å; K53-H57 PolarHBondContact O-N 3.46Å; K54-H57 PolarHBondContact O-N 3.21Å; V55-H57 VanDerWaalsContact C-N 3.32Å; V55-H57 PolarHBondContact O-N 3.42Å; H57-K59 VanDerWaalsContact C-N 3.33Å; H57-K59 PolarHBondContact O-N 3Å; H57-A60 WeakPolarHBondContact O-CB 3.21Å; H57-A60 PolarHBondContact O-N 2.96Å; H57-I61 WeakPolarHBondContact O-CG1 3.26Å; H57-I61 PolarHBondContact O-N 3.45Å
58	L	98.3	Very high	97	Very high	113 Å²	113	102.3 Å²	102.3	59%	0.592	51%	0.508	S	S	*	.	H	α-helix	trans	-62.2	-41.4	176.7	-70.7	173.7	0	0	0	111.8	K54 V55 A60 I61 D62	K54-L58 WeakPolarHBondContact O-CG 3.32Å; K54-L58 PolarHBondContact O-N 2.98Å; V55-L58 PolarHBondContact O-N 2.9Å; L58-A60 VanDerWaalsContact C-N 3.33Å; L58-A60 PolarHBondContact O-N 3.34Å; L58-I61 PolarHBondContact O-N 2.94Å; L58-D62 PolarHBondContact O-N 3.46Å
59	K	98.1	Very high	96.8	Very high	137 Å²	137	101.2 Å²	101.2	60%	0.596	51%	0.514	S	S	*	.	H	α-helix	trans	-61.8	-40.3	175.2	-173.2	177.4	-178.6	179.1	0	111.7	V55 A56 H57 D62 I63	V55-K59 WeakPolarHBondContact O-CB 3.46Å; V55-K59 PolarHBondContact O-N 3.16Å; A56-K59 PolarHBondContact O-N 2.94Å; H57-K59 VanDerWaalsContact C-N 3.33Å; H57-K59 PolarHBondContact O-N 3Å; K59-D62 PolarHBondContact O-N 3.31Å; K59-I63 HydrophobicContact CG-CD1 3.96Å; K59-I63 VanDerWaalsContact O-CG1 3.26Å; K59-I63 WeakPolarHBondContact O-CG1 3.43Å; K59-I63 PolarHBondContact O-N 2.96Å
60	A	97.6	Very high	96.6	Very high	55 Å²	55	106.4 Å²	106.4	46%	0.455	54%	0.535	S	S	.	.	H	α-helix	trans	-63.6	-40.6	176	0	0	0	0	0	112.1	A56 H57 L58 D62 Y64	A56-A60 WeakPolarHBondContact O-CB 3.37Å; A56-A60 PolarHBondContact O-N 3.03Å; H57-A60 WeakPolarHBondContact O-CB 3.21Å; H57-A60 PolarHBondContact O-N 2.96Å; L58-A60 VanDerWaalsContact C-N 3.33Å; L58-A60 PolarHBondContact O-N 3.34Å; A60-D62 VanDerWaalsContact C-N 3.35Å; A60-Y64 WeakPolarHBondContact O-CB 3.47Å; A60-Y64 PolarHBondContact O-N 3.47Å
61	I	96.7	Very high	96.5	Very high	63 Å²	63	108 Å²	108	32%	0.323	54%	0.537	S	S	.	.	H	α-helix	trans	-62.6	-43.6	174.7	-67.8	166.8	0	0	0	110.8	H57 L58 Y64 K65	H57-I61 WeakPolarHBondContact O-CG1 3.26Å; H57-I61 PolarHBondContact O-N 3.45Å; L58-I61 PolarHBondContact O-N 2.94Å; I61-Y64 PolarHBondContact O-N 3.45Å; I61-K65 HydrophobicContact CG2-CD 4.28Å; I61-K65 WeakPolarHBondContact O-CG 3.3Å; I61-K65 PolarHBondContact O-N 3.31Å
62	D	96.1	Very high	96.2	Very high	108 Å²	108	105.3 Å²	105.3	58%	0.578	53%	0.529	S	S	*	.	H	α-helix	trans	-65	-44	-179.5	-167.2	43.8	0	0	0	111.9	L58 K59 A60 Y64 K65 S66	L58-D62 PolarHBondContact O-N 3.46Å; K59-D62 PolarHBondContact O-N 3.31Å; A60-D62 VanDerWaalsContact C-N 3.35Å; D62-Y64 VanDerWaalsContact C-N 3.33Å; D62-Y64 PolarHBondContact O-N 3.47Å; D62-K65 PolarHBondContact O-N 3.28Å; D62-S66 PolarHBondContact O-N 3.01Å; D62-S66 PolarHBondContact O-OG 3.26Å
63	I	97.2	Very high	95.7	Very high	75 Å²	75	102.5 Å²	102.5	39%	0.385	53%	0.527	S	S	.	.	H	α-helix	trans	-59.7	-43.2	172.6	-68.1	166.1	0	0	0	111	K59 K65 S66 Q67	K59-I63 HydrophobicContact CG-CD1 3.96Å; K59-I63 VanDerWaalsContact O-CG1 3.26Å; K59-I63 WeakPolarHBondContact O-CG1 3.43Å; K59-I63 PolarHBondContact O-N 2.96Å; I63-K65 VanDerWaalsContact C-N 3.35Å; I63-K65 PolarHBondContact O-N 2.96Å; I63-S66 PolarHBondContact O-N 2.98Å; I63-S66 PolarHBondContact O-OG 3.25Å; I63-Q67 HydrophobicContact CG2-CG 4.36Å; I63-Q67 WeakPolarHBondContact O-CB 3.48Å; I63-Q67 VanDerWaalsContact O-CG 3.3Å; I63-Q67 WeakPolarHBondContact O-CG 3.39Å; I63-Q67 PolarHBondContact O-N 3.06Å
64	Y	96.4	Very high	95.3	Very high	105 Å²	105	102.4 Å²	102.4	41%	0.412	54%	0.539	S	S	.	.	H	α-helix	trans	-62.5	-41.8	178.2	-180	-95.7	0	0	0	112.2	A60 I61 D62 Q67 F68 R71	A60-Y64 WeakPolarHBondContact O-CB 3.47Å; A60-Y64 PolarHBondContact O-N 3.47Å; I61-Y64 PolarHBondContact O-N 3.45Å; D62-Y64 VanDerWaalsContact C-N 3.33Å; D62-Y64 PolarHBondContact O-N 3.47Å; Y64-Q67 PolarHBondContact O-N 3.43Å; Y64-F68 AromaticContact CD2-CD2 3.85Å; Y64-F68 HydrophobicContact CD2-CD2 3.85Å; Y64-F68 HydrophobicContact CD2-CE2 4.11Å; Y64-F68 AromaticContact CE2-CD2 3.66Å; Y64-F68 HydrophobicContact CE2-CD2 3.66Å; Y64-F68 AromaticContact CE2-CE2 3.96Å; Y64-F68 HydrophobicContact CE2-CE2 3.96Å; Y64-F68 HydrophobicContact CG-CD2 4.49Å; Y64-F68 PolarHBondContact O-N 3.16Å; Y64-F68 VanDerWaalsContact O-N 3.16Å; Y64-R71 WeakPolarHBondContact OH-CD 3.49Å; Y64-R71 PolarHBondContact OH-NH1 3.21Å
65	K	95.1	Very high	94.9	Very high	108 Å²	108	103 Å²	103	47%	0.47	54%	0.541	S	S	.	.	H	α-helix	trans	-64.3	-40.2	177	-73.5	176.9	179.4	-179.3	0	112.3	I61 D62 I63 F68 V72	I61-K65 HydrophobicContact CG2-CD 4.28Å; I61-K65 WeakPolarHBondContact O-CG 3.3Å; I61-K65 PolarHBondContact O-N 3.31Å; D62-K65 PolarHBondContact O-N 3.28Å; I63-K65 VanDerWaalsContact C-N 3.35Å; I63-K65 PolarHBondContact O-N 2.96Å; K65-F68 CarbonylContact O-C 3.32Å; K65-V72 HydrophobicContact CG-CG1 4.44Å; K65-V72 HydrophobicContact CG-CG2 4.33Å
66	S	94.3	Very high	94.4	Very high	89 Å²	89	107.4 Å²	107.4	62%	0.622	56%	0.555	S	S	*	*	H	α-helix	trans	-71.9	-32.1	179.7	66.7	0	0	0	0	113	D62 I63	D62-S66 PolarHBondContact O-N 3.01Å; D62-S66 PolarHBondContact O-OG 3.26Å; I63-S66 PolarHBondContact O-N 2.98Å; I63-S66 PolarHBondContact O-OG 3.25Å
67	Q	96.2	Very high	94.1	Very high	126 Å²	126	113.5 Å²	113.5	59%	0.589	57%	0.566	S	S	*	*	H	α-helix	trans	-72.8	-31.8	175.9	-73.7	177.7	-23.8	0	0	113.5	I63 Y64	I63-Q67 HydrophobicContact CG2-CG 4.36Å; I63-Q67 WeakPolarHBondContact O-CB 3.48Å; I63-Q67 VanDerWaalsContact O-CG 3.3Å; I63-Q67 WeakPolarHBondContact O-CG 3.39Å; I63-Q67 PolarHBondContact O-N 3.06Å; Y64-Q67 PolarHBondContact O-N 3.43Å
68	F	94.6	Very high	93.7	Very high	74 Å²	74	110.3 Å²	110.3	33%	0.325	56%	0.556	S	S	.	*			trans	-131.2	66.4	-174.7	-55.6	-72.7	0	0	0	112.2	Y64 K65 D70 R71	Y64-F68 AromaticContact CD2-CD2 3.85Å; Y64-F68 HydrophobicContact CD2-CD2 3.85Å; Y64-F68 HydrophobicContact CD2-CE2 4.11Å; Y64-F68 AromaticContact CE2-CD2 3.66Å; Y64-F68 HydrophobicContact CE2-CD2 3.66Å; Y64-F68 AromaticContact CE2-CE2 3.96Å; Y64-F68 HydrophobicContact CE2-CE2 3.96Å; Y64-F68 HydrophobicContact CG-CD2 4.49Å; Y64-F68 PolarHBondContact O-N 3.16Å; Y64-F68 VanDerWaalsContact O-N 3.16Å; K65-F68 CarbonylContact O-C 3.32Å; F68-D70 PolarHBondContact O-N 3.27Å; F68-R71 HydrophobicContact CB-CB 4.22Å; F68-R71 HydrophobicContact CB-CG 4.04Å; F68-R71 PolarHBondContact O-N 3.17Å; F68-R71 VanDerWaalsContact O-N 3.17Å
69	P	93	Very high	93.5	Very high	78 Å²	78	109.6 Å²	109.6	51%	0.506	56%	0.557	S	S	.	*	G	3₁₀ helix	trans	-59.5	-35.5	-179.8	24.8	-33.9	0	0	0	112.2	R71 V72	P69-R71 PolarHBondContact O-N 3.24Å; P69-V72 CarbonylContact O-C 3.52Å; P69-V72 VanDerWaalsContact O-C 3.32Å; P69-V72 PolarHBondContact O-N 3.05Å
70	D	93.5	Very high	93.2	Very high	157 Å²	157	111.2 Å²	111.2	84%	0.84	56%	0.564	S	S	*	*	G	3₁₀ helix	trans	-61.4	-29.5	-179.7	-55.6	-34.9	0	0	0	113.2	F68 V72	F68-D70 PolarHBondContact O-N 3.27Å; D70-V72 VanDerWaalsContact C-N 3.33Å
71	R	93.5	Very high	92.9	Very high	158 Å²	158	112.2 Å²	112.2	60%	0.596	58%	0.58	S	S	*	*	G	3₁₀ helix	trans	-80.8	-16.7	179.6	-63.1	-176.1	-176.8	176.2	1.1	112.7	Y64 F68 P69 P73	Y64-R71 WeakPolarHBondContact OH-CD 3.49Å; Y64-R71 PolarHBondContact OH-NH1 3.21Å; F68-R71 HydrophobicContact CB-CB 4.22Å; F68-R71 HydrophobicContact CB-CG 4.04Å; F68-R71 PolarHBondContact O-N 3.17Å; F68-R71 VanDerWaalsContact O-N 3.17Å; P69-R71 PolarHBondContact O-N 3.24Å; R71-P73 VanDerWaalsContact C-CD 3.42Å
72	V	90.4	Very high	92.7	Very high	65 Å²	65	115 Å²	115	39%	0.394	59%	0.591	S	S	.	*	S	Bend	trans	-128.3	65.5	-176.2	-167	0	0	0	0	109.2	K65 P69 D70	K65-V72 HydrophobicContact CG-CG1 4.44Å; K65-V72 HydrophobicContact CG-CG2 4.33Å; P69-V72 CarbonylContact O-C 3.52Å; P69-V72 VanDerWaalsContact O-C 3.32Å; P69-V72 PolarHBondContact O-N 3.05Å; D70-V72 VanDerWaalsContact C-N 3.33Å
73	P	88.8	Confident	92.4	Very high	95 Å²	95	112.8 Å²	112.8	62%	0.617	58%	0.579	S	S	*	*	P	Polyproline II helix	trans	-64.2	143.2	178.4	28	-34.8	0	0	0	110.5	R71 K75	R71-P73 VanDerWaalsContact C-CD 3.42Å; P73-K75 PolarHBondContact O-N 3.17Å; P73-K75 VanDerWaalsContact O-N 3.17Å
74	V	88.4	Confident	92	Very high	148 Å²	148	117.1 Å²	117.1	90%	0.897	60%	0.601	S	S	*	*	P	Polyproline II helix	trans	-63.8	118	173.6	-178.5	0	0	0	0	108	F76	V74-F76 PolarHBondContact O-N 3.43Å
75	K	89.6	Confident	91.7	Very high	157 Å²	157	119.2 Å²	119.2	68%	0.683	61%	0.612	S	S	*	*	P	Polyproline II helix	trans	-71.9	126.8	177	-65.6	-176.4	-179.9	-177.2	0	109.1	P73 Y77	P73-K75 PolarHBondContact O-N 3.17Å; P73-K75 VanDerWaalsContact O-N 3.17Å; K75-Y77 HydrophobicContact CB-CE2 4.27Å; K75-Y77 WeakPolarHBondContact O-CD2 3.42Å; K75-Y77 WeakPolarHBondContact O-CE2 3.44Å
76	F	89.2	Confident	91.5	Very high	164 Å²	164	119.5 Å²	119.5	72%	0.719	63%	0.625	S	S	*	*	P	Polyproline II helix	trans	-77.5	133.5	166.4	-178	-105.1	0	0	0	109.4	V74 P78	V74-F76 PolarHBondContact O-N 3.43Å; F76-P78 HydrophobicContact CD1-CB 4.33Å; F76-P78 HydrophobicContact CE1-CB 3.89Å; F76-P78 WeakPolarHBondContact O-CD 3.33Å
77	Y	90.8	Very high	91.4	Very high	189 Å²	189	125.7 Å²	125.7	74%	0.741	64%	0.635	S	S	*	*			trans	-108.6	94.9	177.3	-63.7	-84.3	0	0	0	108.7	K75	K75-Y77 HydrophobicContact CB-CE2 4.27Å; K75-Y77 WeakPolarHBondContact O-CD2 3.42Å; K75-Y77 WeakPolarHBondContact O-CE2 3.44Å
78	P	90.9	Very high	91.2	Very high	53 Å²	53	128 Å²	128	34%	0.344	64%	0.643	S	S	.	*			trans	-63.8	149.9	178.2	23.3	-30.5	0	0	0	111.3	F76 E82 I83	F76-P78 HydrophobicContact CD1-CB 4.33Å; F76-P78 HydrophobicContact CE1-CB 3.89Å; F76-P78 WeakPolarHBondContact O-CD 3.33Å; P78-E82 VanDerWaalsContact CA-OE2 3.27Å; P78-E82 WeakPolarHBondContact CA-OE2 3.08Å; P78-E82 HydrophobicContact CB-CB 4.12Å; P78-E82 WeakPolarHBondContact CB-OE2 3.27Å; P78-I83 HydrophobicContact CB-CD1 4.43Å; P78-I83 HydrophobicContact CB-CG1 4.01Å; P78-I83 HydrophobicContact CG-CD1 3.93Å; P78-I83 HydrophobicContact CG-CG1 3.77Å
79	T	93.2	Very high	91	Very high	98 Å²	98	128.4 Å²	128.4	60%	0.601	65%	0.653	S	S	*	*			trans	-69.3	150.1	174.9	-57.1	0	0	0	0	109.3	G81 E82 I83	T79-G81 PolarHBondContact O-N 3.5Å; T79-E82 PolarHBondContact N-OE2 3.27Å; T79-E82 WeakPolarHBondContact O-CB 3.43Å; T79-E82 PolarHBondContact O-N 2.86Å; T79-I83 PolarHBondContact O-N 2.99Å
80	F	91.7	Very high	90.7	Very high	170 Å²	170	133 Å²	133	75%	0.746	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.6	-25.8	179.6	-80.2	-74.8	0	0	0	114.3	E82 I83	F80-E82 VanDerWaalsContact C-N 3.3Å; F80-E82 PolarHBondContact O-N 3.18Å; F80-I83 HydrophobicContact CD1-CD1 4.45Å; F80-I83 PolarHBondContact O-N 3.34Å
81	G	91.1	Very high	90.1	Very high	76 Å²	76	140.7 Å²	140.7	78%	0.784	69%	0.69	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68	-23.9	173.7	0	0	0	0	0	114.8	T79	T79-G81 PolarHBondContact O-N 3.5Å
82	E	91.9	Very high	89.9	Confident	121 Å²	121	139.9 Å²	139.9	57%	0.565	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.3	-18.3	176.7	-62.2	167.1	-178.2	0	0	111.9	P78 T79 F80	P78-E82 VanDerWaalsContact CA-OE2 3.27Å; P78-E82 WeakPolarHBondContact CA-OE2 3.08Å; P78-E82 HydrophobicContact CB-CB 4.12Å; P78-E82 WeakPolarHBondContact CB-OE2 3.27Å; T79-E82 PolarHBondContact N-OE2 3.27Å; T79-E82 WeakPolarHBondContact O-CB 3.43Å; T79-E82 PolarHBondContact O-N 2.86Å; F80-E82 VanDerWaalsContact C-N 3.3Å; F80-E82 PolarHBondContact O-N 3.18Å
83	I	90	Very high	89.9	Confident	62 Å²	62	143.8 Å²	143.8	32%	0.318	71%	0.711	S	S	.	*			trans	-95.3	101.2	-174.9	-50.4	170.4	0	0	0	109.8	P78 T79 F80 K85	P78-I83 HydrophobicContact CB-CD1 4.43Å; P78-I83 HydrophobicContact CB-CG1 4.01Å; P78-I83 HydrophobicContact CG-CD1 3.93Å; P78-I83 HydrophobicContact CG-CG1 3.77Å; T79-I83 PolarHBondContact O-N 2.99Å; F80-I83 HydrophobicContact CD1-CD1 4.45Å; F80-I83 PolarHBondContact O-N 3.34Å; I83-K85 HydrophobicContact CG2-CG 3.78Å; I83-K85 PolarHBondContact O-N 3.46Å
84	I	89.1	Confident	90	Very high	167 Å²	167	146.5 Å²	146.5	86%	0.856	72%	0.716	S	S	*	*			trans	-84.1	92.5	171.9	-53.8	174.6	0	0	0	109
85	K	90	Very high	90.1	Very high	148 Å²	148	146.4 Å²	146.4	64%	0.643	71%	0.705	S	S	*	*	P	Polyproline II helix	trans	-83.1	144.1	170.2	-66.4	-170.6	-179.6	177.4	0	110.3	I83 W87	I83-K85 HydrophobicContact CG2-CG 3.78Å; I83-K85 PolarHBondContact O-N 3.46Å; K85-W87 PolarHBondContact O-N 3.5Å
86	P	91.5	Very high	90.1	Very high	114 Å²	114	145.8 Å²	145.8	74%	0.74	71%	0.706	S	S	*	*	P	Polyproline II helix	trans	-63.5	125.1	172.6	26.9	-33.4	0	0	0	109.7	K88	P86-K88 PolarHBondContact O-N 3.26Å
87	W	92.1	Very high	90.2	Very high	219 Å²	219	144.5 Å²	144.5	83%	0.83	71%	0.706	S	S	*	*	P	Polyproline II helix	trans	-72.2	126.5	172.7	178.3	66.1	0	0	0	109.6	K85 P89	K85-W87 PolarHBondContact O-N 3.5Å; W87-P89 HydrophobicContact CE3-CB 4.47Å; W87-P89 HydrophobicContact CH2-CB 3.65Å; W87-P89 HydrophobicContact CH2-CG 4.4Å; W87-P89 HydrophobicContact CZ2-CB 3.87Å; W87-P89 HydrophobicContact CZ3-CB 3.96Å; W87-P89 HydrophobicContact CZ3-CG 4.22Å
88	K	91.5	Very high	90.1	Very high	174 Å²	174	141.4 Å²	141.4	76%	0.757	70%	0.703	S	S	*	*			trans	-106.9	109.2	171.4	-71.9	-171.5	177.3	-175.6	0	108.5	P86 L90	P86-K88 PolarHBondContact O-N 3.26Å; K88-L90 PolarHBondContact O-N 3.46Å
89	P	90	Very high	90.1	Very high	84 Å²	84	148.2 Å²	148.2	55%	0.545	73%	0.731	S	S	.	*			trans	-64	134.8	175.3	24.6	-31.4	0	0	0	110	W87	W87-P89 HydrophobicContact CE3-CB 4.47Å; W87-P89 HydrophobicContact CH2-CB 3.65Å; W87-P89 HydrophobicContact CH2-CG 4.4Å; W87-P89 HydrophobicContact CZ2-CB 3.87Å; W87-P89 HydrophobicContact CZ3-CB 3.96Å; W87-P89 HydrophobicContact CZ3-CG 4.22Å
90	L	87.5	Confident	89.8	Confident	173 Å²	173	152.3 Å²	152.3	91%	0.906	74%	0.741	S	S	*	*			trans	-91.8	122.3	164.8	-64.6	171.3	0	0	0	106.7	K88	K88-L90 PolarHBondContact O-N 3.46Å
91	R	81.2	Confident	89.6	Confident	320 Å²	320	150.7 Å²	150.7	100%	1.208	74%	0.741	S	S	*	*			trans	-80.6	0	168.9	-78.8	-174.6	-176.1	161.5	1	110

Retrieved 91 of 91 residues in 228.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).