A0A5K4F9B1_SCHMA Loading...

Sel1 repeat family protein

AlphaFold DB , UniProt , Accession A0A5K4F9B1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 39 aa.

						>A0A5K4F9B1_SCHMA|A0A5K4F9B1
MMKNLWLLFAIIAVFAVFVQSDYQHESASKPIFDTDDIQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.3	Low	87.6	Confident	216 Å²	216	133.4 Å²	133.4	100%	1.064	65%	0.647	S	S	*	*				0	-32.7	0	-104.7	174.9	167.4	0	114.2	K3 N4	M1-K3 PolarHBondContact O-N 3.49Å; M1-N4 PolarHBondContact O-N 3.32Å
2	M	82.2	Confident	88.2	Confident	171 Å²	171	131.4 Å²	131.4	84%	0.842	64%	0.64	S	S	*	*	H	α-helix	trans	-62.6	-31.5	-176.6	-66.6	165.5	180	0	115.4	N4 L5 W6	M2-N4 VanDerWaalsContact C-N 3.26Å; M2-N4 PolarHBondContact O-N 3.02Å; M2-L5 WeakPolarHBondContact O-CB 3.45Å; M2-L5 PolarHBondContact O-N 3.48Å; M2-L5 VanDerWaalsContact O-N 3.14Å; M2-W6 PolarHBondContact O-N 3.4Å
3	K	84.7	Confident	88.6	Confident	171 Å²	171	124.6 Å²	124.6	74%	0.743	62%	0.618	S	S	*	*	H	α-helix	trans	-59.1	-33.6	-178.1	70	171.4	-173.2	173.2	114	M1 L7	M1-K3 PolarHBondContact O-N 3.49Å; K3-L7 PolarHBondContact O-N 3.14Å
4	N	85.1	Confident	88.9	Confident	97 Å²	97	123.3 Å²	123.3	52%	0.519	62%	0.62	S	S	.	*	H	α-helix	trans	-78.2	-31.6	-179.1	-63	-0.8	0	0	111.2	M1 M2 W6 L7 L8	M1-N4 PolarHBondContact O-N 3.32Å; M2-N4 VanDerWaalsContact C-N 3.26Å; M2-N4 PolarHBondContact O-N 3.02Å; N4-W6 VanDerWaalsContact C-N 3.33Å; N4-L7 PolarHBondContact O-N 3.16Å; N4-L8 WeakPolarHBondContact O-CG 3.45Å; N4-L8 PolarHBondContact O-N 3.26Å; N4-L8 VanDerWaalsContact O-N 3.16Å
5	L	90.6	Very high	89.2	Confident	126 Å²	126	124.6 Å²	124.6	66%	0.66	62%	0.62	S	S	*	*	H	α-helix	trans	-65.1	-40.6	175.3	-119.2	72.6	0	0	111.1	M2 L7 L8 F9	M2-L5 WeakPolarHBondContact O-CB 3.45Å; M2-L5 PolarHBondContact O-N 3.48Å; M2-L5 VanDerWaalsContact O-N 3.14Å; L5-L7 VanDerWaalsContact C-N 3.33Å; L5-L7 PolarHBondContact O-N 3.22Å; L5-L8 PolarHBondContact O-N 3.48Å; L5-F9 PolarHBondContact O-N 3.39Å
6	W	91.9	Very high	89.3	Confident	192 Å²	192	119.4 Å²	119.4	73%	0.727	60%	0.603	S	S	*	*	H	α-helix	trans	-62.6	-41.3	177	-170.8	80.6	0	0	112	M2 N4 L8 F9 A10	M2-W6 PolarHBondContact O-N 3.4Å; N4-W6 VanDerWaalsContact C-N 3.33Å; W6-L8 PolarHBondContact O-N 3.19Å; W6-F9 PolarHBondContact O-N 3.31Å; W6-A10 PolarHBondContact O-N 3.06Å
7	L	91.2	Very high	89.4	Confident	101 Å²	101	118.1 Å²	118.1	53%	0.529	60%	0.602	S	S	.	*	H	α-helix	trans	-62.1	-43.1	176.2	-169.7	74	0	0	112	K3 N4 L5 F9 A10 I11	K3-L7 PolarHBondContact O-N 3.14Å; N4-L7 PolarHBondContact O-N 3.16Å; L5-L7 VanDerWaalsContact C-N 3.33Å; L5-L7 PolarHBondContact O-N 3.22Å; L7-F9 VanDerWaalsContact C-N 3.32Å; L7-F9 PolarHBondContact O-N 3.4Å; L7-A10 PolarHBondContact O-N 3.11Å; L7-I11 HydrophobicContact CG-CD1 4.36Å; L7-I11 WeakPolarHBondContact O-CG1 3.34Å; L7-I11 PolarHBondContact O-N 3.01Å; L7-I11 VanDerWaalsContact O-N 3.15Å
8	L	91.7	Very high	89.3	Confident	104 Å²	104	118.7 Å²	118.7	55%	0.545	60%	0.6	S	S	.	*	H	α-helix	trans	-61	-42.5	176.4	-70.4	171.6	0	0	111.5	N4 L5 W6 A10 I11 I12	N4-L8 WeakPolarHBondContact O-CG 3.45Å; N4-L8 PolarHBondContact O-N 3.26Å; N4-L8 VanDerWaalsContact O-N 3.16Å; L5-L8 PolarHBondContact O-N 3.48Å; W6-L8 PolarHBondContact O-N 3.19Å; L8-A10 VanDerWaalsContact C-N 3.34Å; L8-A10 PolarHBondContact O-N 3.34Å; L8-I11 PolarHBondContact O-N 3.46Å; L8-I12 WeakPolarHBondContact O-CG1 3.34Å; L8-I12 PolarHBondContact O-N 3.29Å; L8-I12 VanDerWaalsContact O-N 3.11Å
9	F	92.1	Very high	89	Confident	149 Å²	149	115.7 Å²	115.7	65%	0.654	59%	0.588	S	S	*	*	H	α-helix	trans	-63.6	-39.8	178.2	-161.9	-93	0	0	112.1	L5 W6 L7 I12 A13	L5-F9 PolarHBondContact O-N 3.39Å; W6-F9 PolarHBondContact O-N 3.31Å; L7-F9 VanDerWaalsContact C-N 3.32Å; L7-F9 PolarHBondContact O-N 3.4Å; F9-I12 PolarHBondContact O-N 2.91Å; F9-A13 WeakPolarHBondContact O-CB 3.33Å; F9-A13 PolarHBondContact O-N 3.45Å
10	A	93.4	Very high	88.6	Confident	36 Å²	36	116.5 Å²	116.5	30%	0.298	59%	0.589	S	S	.	*	H	α-helix	trans	-62.4	-43.1	177	0	0	0	0	112.2	W6 L7 L8 A13 V14	W6-A10 PolarHBondContact O-N 3.06Å; L7-A10 PolarHBondContact O-N 3.11Å; L8-A10 VanDerWaalsContact C-N 3.34Å; L8-A10 PolarHBondContact O-N 3.34Å; A10-A13 PolarHBondContact O-N 3.38Å; A10-V14 WeakPolarHBondContact O-CG2 3.39Å; A10-V14 PolarHBondContact O-N 3.15Å
11	I	95.3	Very high	87.9	Confident	104 Å²	104	114.1 Å²	114.1	53%	0.533	58%	0.583	S	S	.	*	H	α-helix	trans	-63.6	-45.1	178.4	-63.8	165	0	0	110.6	L7 L8 A13 V14 F15	L7-I11 HydrophobicContact CG-CD1 4.36Å; L7-I11 WeakPolarHBondContact O-CG1 3.34Å; L7-I11 PolarHBondContact O-N 3.01Å; L7-I11 VanDerWaalsContact O-N 3.15Å; L8-I11 PolarHBondContact O-N 3.46Å; I11-A13 PolarHBondContact O-N 3.5Å; I11-V14 PolarHBondContact O-N 3.37Å; I11-F15 PolarHBondContact O-N 3.47Å
12	I	94.6	Very high	88.1	Confident	110 Å²	110	108.5 Å²	108.5	56%	0.564	56%	0.558	S	S	*	*	H	α-helix	trans	-63.6	-42.4	178.3	-64.8	166.8	0	0	110.7	L8 F9 F15 A16	L8-I12 WeakPolarHBondContact O-CG1 3.34Å; L8-I12 PolarHBondContact O-N 3.29Å; L8-I12 VanDerWaalsContact O-N 3.11Å; F9-I12 PolarHBondContact O-N 2.91Å; I12-F15 PolarHBondContact O-N 2.85Å; I12-A16 WeakPolarHBondContact O-CB 3.35Å; I12-A16 PolarHBondContact O-N 3Å
13	A	93.7	Very high	87.3	Confident	43 Å²	43	108.7 Å²	108.7	36%	0.355	55%	0.55	S	S	.	*	H	α-helix	trans	-61.9	-45	178.1	0	0	0	0	111.9	F9 A10 I11 F15 A16 V17	F9-A13 WeakPolarHBondContact O-CB 3.33Å; F9-A13 PolarHBondContact O-N 3.45Å; A10-A13 PolarHBondContact O-N 3.38Å; I11-A13 PolarHBondContact O-N 3.5Å; A13-F15 VanDerWaalsContact C-N 3.34Å; A13-F15 PolarHBondContact O-N 3.49Å; A13-A16 PolarHBondContact O-N 2.92Å; A13-V17 VanDerWaalsContact O-CG2 3.27Å; A13-V17 WeakPolarHBondContact O-CG2 3.36Å; A13-V17 PolarHBondContact O-N 3.03Å
14	V	93.6	Very high	86.1	Confident	106 Å²	106	107.5 Å²	107.5	64%	0.642	55%	0.547	S	S	*	.	H	α-helix	trans	-60.7	-44.2	176	171.7	0	0	0	111	A10 I11 V17 F18	A10-V14 WeakPolarHBondContact O-CG2 3.39Å; A10-V14 PolarHBondContact O-N 3.15Å; I11-V14 PolarHBondContact O-N 3.37Å; V14-V17 PolarHBondContact O-N 3.11Å; V14-F18 PolarHBondContact O-N 3.31Å; V14-F18 VanDerWaalsContact O-N 3.11Å
15	F	93	Very high	84.9	Confident	143 Å²	143	110.3 Å²	110.3	63%	0.627	56%	0.557	S	S	*	*	H	α-helix	trans	-65.6	-43.4	178.4	-170.8	-100.9	0	0	112.4	I11 I12 A13 V17 F18 V19	I11-F15 PolarHBondContact O-N 3.47Å; I12-F15 PolarHBondContact O-N 2.85Å; A13-F15 VanDerWaalsContact C-N 3.34Å; A13-F15 PolarHBondContact O-N 3.49Å; F15-V17 PolarHBondContact O-N 3.4Å; F15-F18 PolarHBondContact O-N 2.9Å; F15-V19 HydrophobicContact CD1-CG2 3.96Å; F15-V19 HydrophobicContact CE1-CG2 3.6Å; F15-V19 HydrophobicContact CE2-CG2 4.36Å; F15-V19 HydrophobicContact CG-CG2 4.49Å; F15-V19 HydrophobicContact CZ-CG2 3.82Å; F15-V19 WeakPolarHBondContact O-CG2 3.24Å; F15-V19 PolarHBondContact O-N 3.41Å
16	A	91.3	Very high	83.4	Confident	41 Å²	41	111.5 Å²	111.5	34%	0.339	56%	0.559	S	S	.	*	H	α-helix	trans	-63.1	-40.8	178.4	0	0	0	0	112.2	I12 A13 V19 Q20	I12-A16 WeakPolarHBondContact O-CB 3.35Å; I12-A16 PolarHBondContact O-N 3Å; A13-A16 PolarHBondContact O-N 2.92Å; A16-V19 PolarHBondContact O-N 3.47Å; A16-Q20 WeakPolarHBondContact O-CB 3.27Å; A16-Q20 VanDerWaalsContact O-CG 3.24Å; A16-Q20 WeakPolarHBondContact O-CG 3.45Å; A16-Q20 PolarHBondContact O-N 3.46Å
17	V	89.7	Confident	81.6	Confident	97 Å²	97	106.8 Å²	106.8	59%	0.588	56%	0.556	S	S	*	*	H	α-helix	trans	-61.8	-44.8	175	169.8	0	0	0	110.8	A13 V14 F15 Q20 S21	A13-V17 VanDerWaalsContact O-CG2 3.27Å; A13-V17 WeakPolarHBondContact O-CG2 3.36Å; A13-V17 PolarHBondContact O-N 3.03Å; V14-V17 PolarHBondContact O-N 3.11Å; F15-V17 PolarHBondContact O-N 3.4Å; V17-Q20 PolarHBondContact O-N 3.49Å; V17-S21 PolarHBondContact O-N 3.4Å; V17-S21 VanDerWaalsContact O-N 3.09Å; V17-S21 PolarHBondContact O-OG 3.2Å
18	F	87.3	Confident	80	Confident	130 Å²	130	105.3 Å²	105.3	57%	0.57	56%	0.558	S	S	*	*	H	α-helix	trans	-63.7	-45.3	178.6	-168.6	-92.2	0	0	112.3	V14 F15 Q20 S21 D22	V14-F18 PolarHBondContact O-N 3.31Å; V14-F18 VanDerWaalsContact O-N 3.11Å; F15-F18 PolarHBondContact O-N 2.9Å; F18-Q20 PolarHBondContact O-N 3.31Å; F18-S21 PolarHBondContact O-N 3.03Å; F18-S21 PolarHBondContact O-OG 3.4Å; F18-D22 WeakPolarHBondContact CE1-OD2 3.49Å; F18-D22 PolarHBondContact O-N 3.26Å
19	V	85.3	Confident	78.4	Confident	62 Å²	62	104.2 Å²	104.2	38%	0.376	56%	0.559	S	S	.	*	H	α-helix	trans	-64.7	-39.6	177.4	171.8	0	0	0	111.6	F15 A16 S21 D22 Y23	F15-V19 HydrophobicContact CD1-CG2 3.96Å; F15-V19 HydrophobicContact CE1-CG2 3.6Å; F15-V19 HydrophobicContact CE2-CG2 4.36Å; F15-V19 HydrophobicContact CG-CG2 4.49Å; F15-V19 HydrophobicContact CZ-CG2 3.82Å; F15-V19 WeakPolarHBondContact O-CG2 3.24Å; F15-V19 PolarHBondContact O-N 3.41Å; A16-V19 PolarHBondContact O-N 3.47Å; V19-S21 VanDerWaalsContact C-N 3.35Å; V19-S21 PolarHBondContact O-N 2.92Å; V19-D22 PolarHBondContact O-N 3.26Å; V19-Y23 WeakPolarHBondContact O-CB 3.47Å; V19-Y23 PolarHBondContact O-N 3.32Å
20	Q	79.6	Confident	76.6	Confident	131 Å²	131	106 Å²	106	61%	0.612	57%	0.566	S	S	*	*	H	α-helix	trans	-64.6	-36.8	176.8	-77.2	177.4	2.3	0	112.7	A16 V17 F18 Y23 Q24	A16-Q20 WeakPolarHBondContact O-CB 3.27Å; A16-Q20 VanDerWaalsContact O-CG 3.24Å; A16-Q20 WeakPolarHBondContact O-CG 3.45Å; A16-Q20 PolarHBondContact O-N 3.46Å; V17-Q20 PolarHBondContact O-N 3.49Å; F18-Q20 PolarHBondContact O-N 3.31Å; Q20-Y23 PolarHBondContact O-N 3.09Å; Q20-Q24 WeakPolarHBondContact O-CB 3.32Å; Q20-Q24 PolarHBondContact O-N 3.47Å
21	S	74.8	Confident	74.8	Confident	66 Å²	66	108.8 Å²	108.8	46%	0.462	58%	0.581	S	S	.	*	H	α-helix	trans	-64.3	-41	176.6	43.2	0	0	0	112.7	V17 F18 V19 H25	V17-S21 PolarHBondContact O-N 3.4Å; V17-S21 VanDerWaalsContact O-N 3.09Å; V17-S21 PolarHBondContact O-OG 3.2Å; F18-S21 PolarHBondContact O-N 3.03Å; F18-S21 PolarHBondContact O-OG 3.4Å; V19-S21 VanDerWaalsContact C-N 3.35Å; V19-S21 PolarHBondContact O-N 2.92Å; S21-H25 PolarHBondContact O-N 2.7Å
22	D	69.2	Low	72.9	Confident	99 Å²	99	109.6 Å²	109.6	53%	0.529	59%	0.586	S	S	.	*	H	α-helix	trans	-67.7	-41.4	176	-73	-29.2	0	0	111.2	F18 V19 Q24 H25 E26	F18-D22 WeakPolarHBondContact CE1-OD2 3.49Å; F18-D22 PolarHBondContact O-N 3.26Å; V19-D22 PolarHBondContact O-N 3.26Å; D22-Q24 PolarHBondContact O-N 3.17Å; D22-H25 WeakPolarHBondContact O-CB 3.34Å; D22-H25 PolarHBondContact O-N 3.49Å; D22-E26 PolarHBondContact O-N 3.12Å
23	Y	65	Low	71.3	Confident	174 Å²	174	114.2 Å²	114.2	68%	0.682	60%	0.602	S	S	*	*	H	α-helix	trans	-66.6	-37.4	179.3	-140.9	-91.1	0	0	112.7	V19 Q20 H25 E26 S27	V19-Y23 WeakPolarHBondContact O-CB 3.47Å; V19-Y23 PolarHBondContact O-N 3.32Å; Q20-Y23 PolarHBondContact O-N 3.09Å; Y23-H25 VanDerWaalsContact C-N 3.33Å; Y23-E26 PolarHBondContact O-N 2.79Å; Y23-S27 WeakPolarHBondContact O-CB 3.12Å; Y23-S27 PolarHBondContact O-N 3.4Å
24	Q	60.5	Low	69.4	Low	146 Å²	146	118.3 Å²	118.3	68%	0.682	62%	0.618	S	S	*	*	H	α-helix	trans	-66.6	-34.1	174.1	-85.7	-130.1	-20.6	0	112.3	Q20 D22 E26 S27 A28	Q20-Q24 WeakPolarHBondContact O-CB 3.32Å; Q20-Q24 PolarHBondContact O-N 3.47Å; D22-Q24 PolarHBondContact O-N 3.17Å; Q24-E26 VanDerWaalsContact C-N 3.29Å; Q24-E26 PolarHBondContact O-N 3.37Å; Q24-S27 PolarHBondContact O-N 3.34Å; Q24-A28 WeakPolarHBondContact O-CB 3.5Å; Q24-A28 PolarHBondContact O-N 2.97Å
25	H	59.5	Low	67.7	Low	157 Å²	157	118.6 Å²	118.6	73%	0.727	62%	0.62	S	S	*	*	H	α-helix	trans	-63.4	-38.8	177.1	-165.7	-88	0	0	111.5	S21 D22 Y23	S21-H25 PolarHBondContact O-N 2.7Å; D22-H25 WeakPolarHBondContact O-CB 3.34Å; D22-H25 PolarHBondContact O-N 3.49Å; Y23-H25 VanDerWaalsContact C-N 3.33Å
26	E	58.5	Low	66.3	Low	151 Å²	151	118.4 Å²	118.4	71%	0.706	63%	0.626	S	S	*	*	H	α-helix	trans	-71.8	-43.7	174.4	-161.7	178.6	113.3	0	111.7	D22 Y23 Q24 A28 S29	D22-E26 PolarHBondContact O-N 3.12Å; Y23-E26 PolarHBondContact O-N 2.79Å; Q24-E26 VanDerWaalsContact C-N 3.29Å; Q24-E26 PolarHBondContact O-N 3.37Å; E26-A28 VanDerWaalsContact C-N 3.33Å; E26-A28 PolarHBondContact O-N 3.43Å; E26-S29 WeakPolarHBondContact O-CB 3.21Å; E26-S29 PolarHBondContact O-N 3.33Å; E26-S29 VanDerWaalsContact O-N 3.12Å; E26-S29 PolarHBondContact O-OG 3.48Å
27	S	54.4	Low	64.7	Low	93 Å²	93	122.6 Å²	122.6	65%	0.65	64%	0.642	S	S	*	*	H	α-helix	trans	-71.4	-25.8	-179	-166.2	0	0	0	113.7	Y23 Q24 S29	Y23-S27 WeakPolarHBondContact O-CB 3.12Å; Y23-S27 PolarHBondContact O-N 3.4Å; Q24-S27 PolarHBondContact O-N 3.34Å; S27-S29 PolarHBondContact O-N 3.21Å
28	A	58.1	Low	63.1	Low	69 Å²	69	126.1 Å²	126.1	57%	0.57	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.8	-6.2	173.4	0	0	0	0	112.8	Q24 E26 K30 P31	Q24-A28 WeakPolarHBondContact O-CB 3.5Å; Q24-A28 PolarHBondContact O-N 2.97Å; E26-A28 VanDerWaalsContact C-N 3.33Å; E26-A28 PolarHBondContact O-N 3.43Å; A28-K30 PolarHBondContact O-N 3.41Å; A28-P31 WeakPolarHBondContact O-CD 3.49Å
29	S	58.2	Low	61.2	Low	81 Å²	81	132.6 Å²	132.6	57%	0.566	69%	0.688	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.8	3.7	177.8	75.4	0	0	0	114.5	E26 S27	E26-S29 WeakPolarHBondContact O-CB 3.21Å; E26-S29 PolarHBondContact O-N 3.33Å; E26-S29 VanDerWaalsContact O-N 3.12Å; E26-S29 PolarHBondContact O-OG 3.48Å; S27-S29 PolarHBondContact O-N 3.21Å
30	K	54.6	Low	60	Low	186 Å²	186	136.2 Å²	136.2	81%	0.809	70%	0.704	S	S	*	*			trans	-118	63.1	167.8	-72.5	-175.3	176.5	179.5	112.9	A28 I32	A28-K30 PolarHBondContact O-N 3.41Å; K30-I32 VanDerWaalsContact C-N 3.27Å; K30-I32 PolarHBondContact O-N 3.43Å; K30-I32 VanDerWaalsContact O-N 3.17Å
31	P	53.8	Low	58.9	Low	95 Å²	95	136.4 Å²	136.4	62%	0.617	71%	0.709	S	S	*	*	S	Bend	trans	-74.4	95.9	145.5	25	-8.4	0	0	106.5	A28	A28-P31 WeakPolarHBondContact O-CD 3.49Å
32	I	56.9	Low	58	Low	122 Å²	122	140.3 Å²	140.3	63%	0.626	72%	0.722	S	S	*	*			trans	55.6	79.7	136.4	-53.1	167.7	0	0	113	K30 D34	K30-I32 VanDerWaalsContact C-N 3.27Å; K30-I32 PolarHBondContact O-N 3.43Å; K30-I32 VanDerWaalsContact O-N 3.17Å; I32-D34 HydrophobicContact CG2-CB 3.86Å; I32-D34 PolarHBondContact O-N 3.36Å
33	F	59.3	Low	57.4	Low	207 Å²	207	142.8 Å²	142.8	91%	0.908	73%	0.734	S	S	*	*			trans	-75	18.2	147.7	-119.3	-84.6	0	0	110.9	T35	F33-T35 VanDerWaalsContact C-N 3.29Å; F33-T35 PolarHBondContact O-N 2.61Å
34	D	54.5	Low	56.9	Low	128 Å²	128	140.8 Å²	140.8	68%	0.684	74%	0.737	S	S	*	*			trans	-95.4	50.4	169.8	-61.1	-32.7	0	0	110.6	I32 D36	I32-D34 HydrophobicContact CG2-CB 3.86Å; I32-D34 PolarHBondContact O-N 3.36Å; D34-D36 VanDerWaalsContact C-N 3.31Å
35	T	58.2	Low	56.7	Low	112 Å²	112	140.5 Å²	140.5	69%	0.687	74%	0.741	S	S	*	*			trans	-107	68.4	142	-50.8	0	0	0	106.1	F33 D37	F33-T35 VanDerWaalsContact C-N 3.29Å; F33-T35 PolarHBondContact O-N 2.61Å; T35-D37 WeakPolarHBondContact CG2-O 3.36Å; T35-D37 PolarHBondContact O-N 3.07Å
36	D	63.5	Low	56.5	Low	140 Å²	140	139.3 Å²	139.3	75%	0.749	74%	0.742	S	S	*	*			trans	-64.7	16	163.5	-112.4	-26.9	0	0	112.1	D34	D34-D36 VanDerWaalsContact C-N 3.31Å
37	D	58.6	Low	56.3	Low	129 Å²	129	138.4 Å²	138.4	69%	0.69	74%	0.744	S	S	*	*			trans	-145.8	94.9	-171.5	-67.4	-59.2	0	0	109.7	T35	T35-D37 WeakPolarHBondContact CG2-O 3.36Å; T35-D37 PolarHBondContact O-N 3.07Å
38	I	55.1	Low	56.5	Low	171 Å²	171	142.2 Å²	142.2	88%	0.877	75%	0.752	S	S	*	*				-160.2	116.1	113.1	-54.1	-160.9	0	0	107.1
39	Q	46.7	Very low	56.3	Low	266 Å²	266	148.8 Å²	148.8	100%	1.243	77%	0.769	S	S	*	*			trans	-46.3	0	174.6	-58.4	-179.7	-81.7	0	115.5

Retrieved 39 of 39 residues in 121.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).