A0A5K4F9E2_SCHMA Loading...

Ovule protein

AlphaFold DB , UniProt , Accession A0A5K4F9E2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 84 aa.

						>A0A5K4F9E2_SCHMA|A0A5K4F9E2
MNDQPPKQLPPPPNPSLSTQPTSHMEDSQTLAYTNHTQSQYHVHIHNQIHEQTHSRQVNISPPTTTRDMYNTFNLFMMTSGKVQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.2	Low	70.3	Confident	212 Å²	212	154.9 Å²	154.9	100%	1.044	82%	0.824	S	S	*	*				0	110.7	0	-67.9	175.1	177.9	0	0	105.3
2	N	60.5	Low	70.9	Confident	171 Å²	171	151.1 Å²	151.1	91%	0.914	82%	0.815	S	S	*	*			trans	-99.2	87.3	169	-82.7	-10.9	0	0	0	105.9	Q4	N2-Q4 PolarHBondContact O-N 3.07Å
3	D	67.8	Low	71.3	Confident	138 Å²	138	148.9 Å²	148.9	74%	0.738	81%	0.814	S	S	*	*			trans	-58.4	86.2	163.6	-60.3	-74.6	0	0	0	107.4	P5	D3-P5 WeakPolarHBondContact O-CD 3.21Å
4	Q	63.4	Low	71.6	Confident	181 Å²	181	148.9 Å²	148.9	85%	0.846	81%	0.812	S	S	*	*	P	Polyproline II helix	trans	-63.3	119.5	171.5	-168.7	179.4	65	0	0	106.2	N2	N2-Q4 PolarHBondContact O-N 3.07Å
5	P	75.5	Confident	71	Confident	103 Å²	103	146.2 Å²	146.2	67%	0.669	81%	0.805	S	S	*	*	P	Polyproline II helix	trans	-57.5	144.1	-179.3	22.5	-32.4	0	0	0	109.6	D3 K7	D3-P5 WeakPolarHBondContact O-CD 3.21Å; P5-K7 PolarHBondContact O-N 3.01Å; P5-K7 VanDerWaalsContact O-N 3.15Å
6	P	75.3	Confident	70.8	Confident	127 Å²	127	144.1 Å²	144.1	83%	0.825	80%	0.804	S	S	*	*	P	Polyproline II helix	trans	-54.2	126.7	178.4	22.2	-32	0	0	0	109	Q8	P6-Q8 PolarHBondContact O-N 2.77Å
7	K	74.4	Confident	70.1	Confident	205 Å²	205	146.3 Å²	146.3	89%	0.891	81%	0.812	S	S	*	*			trans	-50.2	110.5	-177.7	-157.4	176.3	-173.2	-179.6	0	108.7	P5 L9	P5-K7 PolarHBondContact O-N 3.01Å; P5-K7 VanDerWaalsContact O-N 3.15Å; K7-L9 PolarHBondContact O-N 3.04Å
8	Q	73.6	Confident	69.1	Low	188 Å²	188	143 Å²	143	88%	0.879	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-58.3	120.9	177.6	-133.5	172.4	8.2	0	0	107.7	P6	P6-Q8 PolarHBondContact O-N 2.77Å
9	L	73.3	Confident	67.8	Low	157 Å²	157	142.5 Å²	142.5	82%	0.822	80%	0.802	S	S	*	*	P	Polyproline II helix	trans	-60.9	142.2	175.8	-75.5	168	0	0	0	109.1	K7	K7-L9 PolarHBondContact O-N 3.04Å
10	P	78	Confident	66.5	Low	108 Å²	108	144.2 Å²	144.2	70%	0.701	80%	0.803	S	S	*	*	P	Polyproline II helix	trans	-59.6	140.7	178.2	25.2	-32.9	0	0	0	110
11	P	78.9	Confident	65.7	Low	114 Å²	114	142.8 Å²	142.8	74%	0.74	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-59.9	145.8	174.8	25.4	-32.8	0	0	0	110
12	P	77.4	Confident	65.6	Low	109 Å²	109	138.2 Å²	138.2	71%	0.708	78%	0.784	S	S	*	*	P	Polyproline II helix	trans	-58	146.8	178.2	24.2	-32.6	0	0	0	110.3	N14	P12-N14 PolarHBondContact O-N 3.14Å; P12-N14 VanDerWaalsContact O-N 3.13Å
13	P	75.1	Confident	65.3	Low	123 Å²	123	134.8 Å²	134.8	80%	0.799	77%	0.774	S	S	*	*	P	Polyproline II helix	trans	-58.6	122.4	177.1	23.7	-31.4	0	0	0	109
14	N	76	Confident	64.6	Low	148 Å²	148	136.2 Å²	136.2	79%	0.791	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-57	129.2	168.4	-81.9	-15.7	0	0	0	107.6	P12 S16	P12-N14 PolarHBondContact O-N 3.14Å; P12-N14 VanDerWaalsContact O-N 3.13Å; N14-S16 PolarHBondContact O-N 2.91Å
15	P	62.9	Low	64.3	Low	109 Å²	109	135.4 Å²	135.4	71%	0.708	77%	0.774	S	S	*	*			trans	-57	115	171.7	21.9	-29.4	0	0	0	107.6	L17	P15-L17 PolarHBondContact O-N 3.29Å
16	S	67.9	Low	63.5	Low	112 Å²	112	135.5 Å²	135.5	78%	0.783	77%	0.766	S	S	*	*			trans	-62.7	109.6	-179.8	-172.5	0	0	0	0	108.5	N14 S18	N14-S16 PolarHBondContact O-N 2.91Å; S16-S18 VanDerWaalsContact C-N 3.31Å; S16-S18 PolarHBondContact O-N 3.47Å
17	L	59.2	Low	62.8	Low	182 Å²	182	134.3 Å²	134.3	95%	0.953	75%	0.752	S	S	*	*			trans	-73.4	84.8	172.5	-88.9	129.7	0	0	0	109.2	P15	P15-L17 PolarHBondContact O-N 3.29Å
18	S	50.8	Low	62.3	Low	87 Å²	87	129.1 Å²	129.1	61%	0.608	74%	0.742	S	S	*	*			trans	-156.3	104.7	169.6	155.5	0	0	0	0	105.7	S16	S16-S18 VanDerWaalsContact C-N 3.31Å; S16-S18 PolarHBondContact O-N 3.47Å
19	T	45.7	Very low	62.1	Low	134 Å²	134	127.1 Å²	127.1	82%	0.822	73%	0.732	S	S	*	*				-161.7	157	74.5	33.9	0	0	0	0	113.4
20	Q	41.1	Very low	62.2	Low	176 Å²	176	123.5 Å²	123.5	82%	0.822	72%	0.717	S	S	*	*			trans	-25.7	157.7	162.1	-93.9	179.1	-11.7	0	0	119.2
21	P	50.2	Low	61.9	Low	115 Å²	115	123.3 Å²	123.3	75%	0.747	71%	0.709	S	S	*	*			trans	-84	133.8	-162.3	34.9	-32.2	0	0	0	112.1
22	T	51.3	Low	61.9	Low	115 Å²	115	120.7 Å²	120.7	71%	0.706	70%	0.697	S	S	*	*			trans	-140.4	101.1	168.3	-34.5	0	0	0	0	111.9
23	S	53.9	Low	62.1	Low	99 Å²	99	123.3 Å²	123.3	69%	0.692	69%	0.694	S	S	*	*			trans	78.2	138.5	157.2	-159.1	0	0	0	0	119.7	M25 E26	S23-M25 PolarHBondContact O-N 2.94Å; S23-E26 PolarHBondContact O-N 3.07Å
24	H	53.6	Low	62.4	Low	168 Å²	168	120.2 Å²	120.2	78%	0.778	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59	21.8	-175.8	-96.9	-60	0	0	0	117.4	D27	H24-D27 IonicContact CE1-OD2 3.84Å; H24-D27 IonicContact ND1-OD2 3.07Å; H24-D27 PolarHBondContact ND1-OD2 3.06Å
25	M	55.6	Low	62.4	Low	164 Å²	164	116.8 Å²	116.8	81%	0.808	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.9	-6.5	166.4	-73.8	-154.3	-159.6	0	0	113.5	S23	S23-M25 PolarHBondContact O-N 2.94Å
26	E	59	Low	63.4	Low	106 Å²	106	116.7 Å²	116.7	50%	0.495	65%	0.645	S	S	.	*	S	Bend	trans	-78.6	-23.4	-178.3	-68.5	-168.1	125.6	0	0	114.1	S23 S28 Q29 T30	S23-E26 PolarHBondContact O-N 3.07Å; E26-S28 VanDerWaalsContact C-N 3.26Å; E26-S28 PolarHBondContact O-N 3.48Å; E26-S28 VanDerWaalsContact O-N 3.14Å; E26-Q29 PolarHBondContact O-N 3.28Å; E26-T30 PolarHBondContact O-N 3.12Å; E26-T30 PolarHBondContact O-OG1 2.92Å
27	D	61.4	Low	64	Low	101 Å²	101	114.6 Å²	114.6	54%	0.54	63%	0.627	S	S	.	*	H	α-helix	trans	-57.5	-38.2	-172	-63	-30.9	0	0	0	112.6	H24 L31	H24-D27 IonicContact CE1-OD2 3.84Å; H24-D27 IonicContact ND1-OD2 3.07Å; H24-D27 PolarHBondContact ND1-OD2 3.06Å; D27-L31 WeakPolarHBondContact O-CB 3.37Å; D27-L31 PolarHBondContact O-N 3.48Å
28	S	63.6	Low	64.9	Low	96 Å²	96	110.8 Å²	110.8	67%	0.671	60%	0.604	S	S	*	*	H	α-helix	trans	-73.4	-34.3	179.5	-65.2	0	0	0	0	113.2	E26 A32	E26-S28 VanDerWaalsContact C-N 3.26Å; E26-S28 PolarHBondContact O-N 3.48Å; E26-S28 VanDerWaalsContact O-N 3.14Å; S28-A32 WeakPolarHBondContact O-CB 3.48Å; S28-A32 PolarHBondContact O-N 3.43Å; S28-A32 VanDerWaalsContact O-N 3.12Å
29	Q	69.1	Low	66.4	Low	146 Å²	146	110 Å²	110	68%	0.682	60%	0.599	S	S	*	*	H	α-helix	trans	-77.3	-42.7	179.2	-67.8	-171.3	69.1	0	0	111.3	E26 L31 A32 Y33	E26-Q29 PolarHBondContact O-N 3.28Å; Q29-L31 VanDerWaalsContact C-N 3.34Å; Q29-L31 PolarHBondContact O-N 2.87Å; Q29-A32 PolarHBondContact O-N 2.98Å; Q29-Y33 WeakPolarHBondContact O-CB 3.42Å; Q29-Y33 PolarHBondContact O-N 3.4Å
30	T	74.6	Confident	68.1	Low	81 Å²	81	108.6 Å²	108.6	50%	0.497	58%	0.583	S	S	.	*	H	α-helix	trans	-61.2	-44.4	175.2	-61.1	0	0	0	0	110.5	E26 A32 Y33 T34	E26-T30 PolarHBondContact O-N 3.12Å; E26-T30 PolarHBondContact O-OG1 2.92Å; T30-A32 PolarHBondContact O-N 2.91Å; T30-Y33 PolarHBondContact O-N 3.49Å; T30-T34 WeakPolarHBondContact O-CB 3.37Å; T30-T34 PolarHBondContact O-N 3.3Å; T30-T34 PolarHBondContact O-OG1 3.03Å
31	L	72.2	Confident	70.2	Confident	104 Å²	104	107.3 Å²	107.3	55%	0.545	57%	0.572	S	S	.	*	H	α-helix	trans	-61.7	-44	176	-176.1	64.5	0	0	0	112.2	D27 Q29 Y33 T34 N35	D27-L31 WeakPolarHBondContact O-CB 3.37Å; D27-L31 PolarHBondContact O-N 3.48Å; Q29-L31 VanDerWaalsContact C-N 3.34Å; Q29-L31 PolarHBondContact O-N 2.87Å; L31-Y33 VanDerWaalsContact C-N 3.35Å; L31-Y33 PolarHBondContact O-N 2.92Å; L31-T34 PolarHBondContact O-N 3.13Å; L31-N35 WeakPolarHBondContact O-CB 3.5Å; L31-N35 PolarHBondContact O-N 3.3Å; L31-N35 PolarHBondContact O-ND2 3.42Å
32	A	79.4	Confident	71.5	Confident	59 Å²	59	107.9 Å²	107.9	49%	0.488	56%	0.564	S	S	.	*	H	α-helix	trans	-61.7	-42.1	177.1	0	0	0	0	0	112.1	S28 Q29 T30 H36	S28-A32 WeakPolarHBondContact O-CB 3.48Å; S28-A32 PolarHBondContact O-N 3.43Å; S28-A32 VanDerWaalsContact O-N 3.12Å; Q29-A32 PolarHBondContact O-N 2.98Å; T30-A32 PolarHBondContact O-N 2.91Å; A32-H36 WeakPolarHBondContact O-CB 3.3Å; A32-H36 PolarHBondContact O-N 3.42Å
33	Y	80.7	Confident	73.1	Confident	164 Å²	164	106.2 Å²	106.2	64%	0.643	55%	0.554	S	S	*	*	H	α-helix	trans	-65.6	-46.8	176.2	-172.2	-94	0	0	0	111.7	Q29 T30 L31 N35 H36 T37	Q29-Y33 WeakPolarHBondContact O-CB 3.42Å; Q29-Y33 PolarHBondContact O-N 3.4Å; T30-Y33 PolarHBondContact O-N 3.49Å; L31-Y33 VanDerWaalsContact C-N 3.35Å; L31-Y33 PolarHBondContact O-N 2.92Å; Y33-N35 PolarHBondContact O-N 2.89Å; Y33-H36 WeakPolarHBondContact O-CB 3.49Å; Y33-H36 PolarHBondContact O-N 3.19Å; Y33-T37 PolarHBondContact O-N 3.4Å; Y33-T37 PolarHBondContact O-OG1 3.35Å; Y33-T37 VanDerWaalsContact O-OG1 3.08Å
34	T	81.7	Confident	74.3	Confident	58 Å²	58	106.4 Å²	106.4	36%	0.356	54%	0.544	S	S	.	.	H	α-helix	trans	-58.3	-47.1	176.5	-61	0	0	0	0	111.5	T30 L31 H36 T37 Q38	T30-T34 WeakPolarHBondContact O-CB 3.37Å; T30-T34 PolarHBondContact O-N 3.3Å; T30-T34 PolarHBondContact O-OG1 3.03Å; L31-T34 PolarHBondContact O-N 3.13Å; T34-H36 VanDerWaalsContact C-N 3.31Å; T34-H36 PolarHBondContact O-N 3.08Å; T34-T37 PolarHBondContact O-N 2.77Å; T34-Q38 HydrophobicContact CG2-CG 4.41Å; T34-Q38 WeakPolarHBondContact O-CB 3.38Å; T34-Q38 VanDerWaalsContact O-CG 3.3Å; T34-Q38 WeakPolarHBondContact O-CG 3.49Å; T34-Q38 PolarHBondContact O-N 2.68Å
35	N	77.3	Confident	75.8	Confident	76 Å²	76	101.1 Å²	101.1	41%	0.406	52%	0.52	S	S	.	.	H	α-helix	trans	-62.3	-39.6	177.9	-71.8	-20	0	0	0	111.7	L31 Y33 S39	L31-N35 WeakPolarHBondContact O-CB 3.5Å; L31-N35 PolarHBondContact O-N 3.3Å; L31-N35 PolarHBondContact O-ND2 3.42Å; Y33-N35 PolarHBondContact O-N 2.89Å; N35-S39 WeakPolarHBondContact O-CB 3.37Å; N35-S39 PolarHBondContact O-N 3.37Å; N35-S39 PolarHBondContact O-OG 3.49Å
36	H	82.5	Confident	76.8	Confident	108 Å²	108	99.5 Å²	99.5	50%	0.5	51%	0.51	S	S	.	.	H	α-helix	trans	-63.6	-50.3	176.2	-173.6	70.7	0	0	0	111.5	A32 Y33 T34 Q38 S39 Q40	A32-H36 WeakPolarHBondContact O-CB 3.3Å; A32-H36 PolarHBondContact O-N 3.42Å; Y33-H36 WeakPolarHBondContact O-CB 3.49Å; Y33-H36 PolarHBondContact O-N 3.19Å; T34-H36 VanDerWaalsContact C-N 3.31Å; T34-H36 PolarHBondContact O-N 3.08Å; H36-Q38 VanDerWaalsContact C-N 3.34Å; H36-Q38 PolarHBondContact O-N 3.05Å; H36-S39 PolarHBondContact O-N 3.04Å; H36-Q40 PolarHBondContact CE1-NE2 3.26Å; H36-Q40 WeakPolarHBondContact O-CG 3.36Å; H36-Q40 PolarHBondContact O-N 3.03Å
37	T	81.8	Confident	77.7	Confident	67 Å²	67	98.5 Å²	98.5	41%	0.411	51%	0.509	S	S	.	.	H	α-helix	trans	-61.9	-41.5	179	-54.5	0	0	0	0	111.9	Y33 T34 Q40 Y41	Y33-T37 PolarHBondContact O-N 3.4Å; Y33-T37 PolarHBondContact O-OG1 3.35Å; Y33-T37 VanDerWaalsContact O-OG1 3.08Å; T34-T37 PolarHBondContact O-N 2.77Å; T37-Q40 PolarHBondContact O-N 3.22Å; T37-Y41 PolarHBondContact O-N 2.94Å
38	Q	78.5	Confident	78.4	Confident	102 Å²	102	97.5 Å²	97.5	48%	0.477	50%	0.501	S	S	.	.	H	α-helix	trans	-61.4	-48.9	174.7	-74.3	179.9	-0.8	0	0	110.7	T34 H36 Q40 Y41 H42	T34-Q38 HydrophobicContact CG2-CG 4.41Å; T34-Q38 WeakPolarHBondContact O-CB 3.38Å; T34-Q38 VanDerWaalsContact O-CG 3.3Å; T34-Q38 WeakPolarHBondContact O-CG 3.49Å; T34-Q38 PolarHBondContact O-N 2.68Å; H36-Q38 VanDerWaalsContact C-N 3.34Å; H36-Q38 PolarHBondContact O-N 3.05Å; Q38-Q40 VanDerWaalsContact C-N 3.27Å; Q38-Q40 PolarHBondContact O-N 3.48Å; Q38-Y41 PolarHBondContact O-N 3.43Å; Q38-Y41 VanDerWaalsContact O-N 3.12Å; Q38-H42 PolarHBondContact O-N 3.29Å; Q38-H42 PolarHBondContact O-ND1 3.18Å
39	S	82.5	Confident	79.1	Confident	70 Å²	70	97.4 Å²	97.4	49%	0.49	49%	0.492	S	S	.	.	H	α-helix	trans	-57.5	-41.1	179.4	-59.5	0	0	0	0	112	N35 H36 H42 V43	N35-S39 WeakPolarHBondContact O-CB 3.37Å; N35-S39 PolarHBondContact O-N 3.37Å; N35-S39 PolarHBondContact O-OG 3.49Å; H36-S39 PolarHBondContact O-N 3.04Å; S39-H42 PolarHBondContact O-N 2.83Å; S39-V43 WeakPolarHBondContact O-CG2 3.36Å; S39-V43 PolarHBondContact O-N 3.44Å
40	Q	79.6	Confident	79.3	Confident	105 Å²	105	95.5 Å²	95.5	49%	0.491	48%	0.483	S	S	.	.	H	α-helix	trans	-65.6	-41.2	176.1	-67.1	-67.6	-3.6	0	0	112.8	H36 T37 Q38 H42 V43 H44	H36-Q40 PolarHBondContact CE1-NE2 3.26Å; H36-Q40 WeakPolarHBondContact O-CG 3.36Å; H36-Q40 PolarHBondContact O-N 3.03Å; T37-Q40 PolarHBondContact O-N 3.22Å; Q38-Q40 VanDerWaalsContact C-N 3.27Å; Q38-Q40 PolarHBondContact O-N 3.48Å; Q40-H42 VanDerWaalsContact C-N 3.32Å; Q40-H42 PolarHBondContact O-N 3.5Å; Q40-V43 PolarHBondContact O-N 2.96Å; Q40-H44 PolarHBondContact O-N 3.15Å
41	Y	85	Confident	79.3	Confident	150 Å²	150	98 Å²	98	59%	0.588	49%	0.489	S	S	*	.	H	α-helix	trans	-60.9	-41	175.5	-178.6	-101.2	0	0	0	111.7	T37 Q38 V43 H44 I45	T37-Y41 PolarHBondContact O-N 2.94Å; Q38-Y41 PolarHBondContact O-N 3.43Å; Q38-Y41 VanDerWaalsContact O-N 3.12Å; Y41-V43 PolarHBondContact O-N 2.99Å; Y41-H44 PolarHBondContact O-N 3.2Å; Y41-I45 HydrophobicContact CD1-CG1 4.15Å; Y41-I45 HydrophobicContact CD2-CG1 4.49Å; Y41-I45 HydrophobicContact CE1-CD1 4.31Å; Y41-I45 HydrophobicContact CE1-CG1 3.72Å; Y41-I45 HydrophobicContact CE2-CD1 4.09Å; Y41-I45 HydrophobicContact CE2-CG1 4.1Å; Y41-I45 WeakPolarHBondContact O-CG1 3.36Å; Y41-I45 PolarHBondContact O-N 3.12Å
42	H	78.5	Confident	79.1	Confident	126 Å²	126	99 Å²	99	58%	0.583	49%	0.491	S	S	*	.	H	α-helix	trans	-62.2	-43.8	177	-69.7	90.6	0	0	0	112.4	Q38 S39 Q40 H44 I45 H46	Q38-H42 PolarHBondContact O-N 3.29Å; Q38-H42 PolarHBondContact O-ND1 3.18Å; S39-H42 PolarHBondContact O-N 2.83Å; Q40-H42 VanDerWaalsContact C-N 3.32Å; Q40-H42 PolarHBondContact O-N 3.5Å; H42-H44 VanDerWaalsContact C-N 3.33Å; H42-H44 PolarHBondContact O-N 3.35Å; H42-I45 PolarHBondContact O-N 3.01Å; H42-H46 WeakPolarHBondContact O-CB 3.13Å; H42-H46 PolarHBondContact O-N 3.44Å
43	V	84.8	Confident	78.6	Confident	80 Å²	80	101 Å²	101	49%	0.485	50%	0.496	S	S	.	.	H	α-helix	trans	-62.5	-41.4	175.9	175	0	0	0	0	111	S39 Q40 Y41 H46 N47	S39-V43 WeakPolarHBondContact O-CG2 3.36Å; S39-V43 PolarHBondContact O-N 3.44Å; Q40-V43 PolarHBondContact O-N 2.96Å; Y41-V43 PolarHBondContact O-N 2.99Å; V43-H46 PolarHBondContact O-N 2.85Å; V43-N47 PolarHBondContact O-N 3.41Å; V43-N47 VanDerWaalsContact O-N 3.14Å
44	H	78	Confident	77.7	Confident	104 Å²	104	99.3 Å²	99.3	48%	0.481	49%	0.494	S	S	.	.	H	α-helix	trans	-63.4	-43.4	178.8	-175.2	63.4	0	0	0	112.7	Q40 Y41 H42 N47 Q48	Q40-H44 PolarHBondContact O-N 3.15Å; Y41-H44 PolarHBondContact O-N 3.2Å; H42-H44 VanDerWaalsContact C-N 3.33Å; H42-H44 PolarHBondContact O-N 3.35Å; H44-N47 PolarHBondContact O-N 3.15Å; H44-Q48 PolarHBondContact CD2-NE2 2.68Å; H44-Q48 VanDerWaalsContact CD2-NE2 3.35Å; H44-Q48 PolarHBondContact CE1-NE2 3.02Å; H44-Q48 PolarHBondContact NE2-NE2 3.47Å; H44-Q48 PolarHBondContact O-N 2.7Å
45	I	85.5	Confident	76.8	Confident	56 Å²	56	101.1 Å²	101.1	29%	0.287	51%	0.51	S	S	.	.	H	α-helix	trans	-66.8	-41.9	177.8	-66	-64.1	0	0	0	111.4	Y41 H42 N47 Q48 I49	Y41-I45 HydrophobicContact CD1-CG1 4.15Å; Y41-I45 HydrophobicContact CD2-CG1 4.49Å; Y41-I45 HydrophobicContact CE1-CD1 4.31Å; Y41-I45 HydrophobicContact CE1-CG1 3.72Å; Y41-I45 HydrophobicContact CE2-CD1 4.09Å; Y41-I45 HydrophobicContact CE2-CG1 4.1Å; Y41-I45 WeakPolarHBondContact O-CG1 3.36Å; Y41-I45 PolarHBondContact O-N 3.12Å; H42-I45 PolarHBondContact O-N 3.01Å; I45-N47 VanDerWaalsContact C-N 3.32Å; I45-N47 PolarHBondContact O-N 3.47Å; I45-Q48 PolarHBondContact O-N 3.21Å; I45-I49 HydrophobicContact CG2-CD1 3.79Å; I45-I49 HydrophobicContact CG2-CG1 4.42Å; I45-I49 WeakPolarHBondContact O-CG1 3.34Å; I45-I49 PolarHBondContact O-N 2.95Å
46	H	78	Confident	76.1	Confident	130 Å²	130	107.9 Å²	107.9	60%	0.602	53%	0.529	S	S	*	.	H	α-helix	trans	-59.4	-43.4	178.2	-176	-89.5	0	0	0	111.9	H42 V43 I49 H50	H42-H46 WeakPolarHBondContact O-CB 3.13Å; H42-H46 PolarHBondContact O-N 3.44Å; V43-H46 PolarHBondContact O-N 2.85Å; H46-I49 PolarHBondContact O-N 3.18Å; H46-H50 WeakPolarHBondContact O-CB 3.21Å; H46-H50 PolarHBondContact O-N 3.44Å; H46-H50 VanDerWaalsContact O-N 3.07Å
47	N	77.1	Confident	74.9	Confident	86 Å²	86	110.7 Å²	110.7	46%	0.46	54%	0.543	S	S	.	.	H	α-helix	trans	-66.4	-40.5	178.9	-69.1	-6.9	0	0	0	112.3	V43 H44 I45 H50 E51	V43-N47 PolarHBondContact O-N 3.41Å; V43-N47 VanDerWaalsContact O-N 3.14Å; H44-N47 PolarHBondContact O-N 3.15Å; I45-N47 VanDerWaalsContact C-N 3.32Å; I45-N47 PolarHBondContact O-N 3.47Å; N47-H50 PolarHBondContact O-N 3.07Å; N47-E51 PolarHBondContact O-N 3.14Å; N47-E51 VanDerWaalsContact O-N 3.11Å
48	Q	76.3	Confident	74.1	Confident	79 Å²	79	113.2 Å²	113.2	37%	0.369	56%	0.558	S	S	.	*	H	α-helix	trans	-62.7	-42.9	175.7	-74.6	-166.8	42.5	0	0	112.6	H44 I45 H50 E51 Q52	H44-Q48 PolarHBondContact CD2-NE2 2.68Å; H44-Q48 VanDerWaalsContact CD2-NE2 3.35Å; H44-Q48 PolarHBondContact CE1-NE2 3.02Å; H44-Q48 PolarHBondContact NE2-NE2 3.47Å; H44-Q48 PolarHBondContact O-N 2.7Å; I45-Q48 PolarHBondContact O-N 3.21Å; Q48-H50 VanDerWaalsContact C-N 3.35Å; Q48-E51 PolarHBondContact O-N 3.43Å; Q48-Q52 WeakPolarHBondContact O-CB 3.4Å; Q48-Q52 WeakPolarHBondContact O-CG 3.35Å; Q48-Q52 PolarHBondContact O-N 3.17Å
49	I	77.8	Confident	73.1	Confident	95 Å²	95	114.8 Å²	114.8	49%	0.487	57%	0.569	S	S	.	*	H	α-helix	trans	-65.9	-41	179.9	-67.7	171.2	0	0	0	110.6	I45 H46 Q52 T53	I45-I49 HydrophobicContact CG2-CD1 3.79Å; I45-I49 HydrophobicContact CG2-CG1 4.42Å; I45-I49 WeakPolarHBondContact O-CG1 3.34Å; I45-I49 PolarHBondContact O-N 2.95Å; H46-I49 PolarHBondContact O-N 3.18Å; I49-Q52 PolarHBondContact O-N 3.01Å; I49-T53 WeakPolarHBondContact O-CB 3.49Å; I49-T53 PolarHBondContact O-N 2.92Å; I49-T53 PolarHBondContact O-OG1 3.19Å
50	H	74.6	Confident	71.9	Confident	106 Å²	106	118.5 Å²	118.5	49%	0.491	58%	0.582	S	S	.	*	H	α-helix	trans	-59.4	-49.4	177.2	-175.7	67.6	0	0	0	111.4	H46 N47 Q48 Q52 T53 H54	H46-H50 WeakPolarHBondContact O-CB 3.21Å; H46-H50 PolarHBondContact O-N 3.44Å; H46-H50 VanDerWaalsContact O-N 3.07Å; N47-H50 PolarHBondContact O-N 3.07Å; Q48-H50 VanDerWaalsContact C-N 3.35Å; H50-Q52 PolarHBondContact O-N 2.87Å; H50-T53 PolarHBondContact O-N 3.47Å; H50-H54 AromaticContact CE1-CD2 3.2Å; H50-H54 PolarHBondContact CE1-CD2 3.4Å; H50-H54 AromaticContact CE1-NE2 3.09Å; H50-H54 PolarHBondContact CE1-NE2 3.49Å; H50-H54 AromaticContact CG-CD2 3.87Å; H50-H54 AromaticContact ND1-CD2 3.3Å; H50-H54 PolarHBondContact ND1-CD2 3.05Å; H50-H54 VanDerWaalsContact ND1-CD2 3.3Å; H50-H54 AromaticContact ND1-NE2 3.16Å; H50-H54 PolarHBondContact ND1-NE2 3.33Å; H50-H54 VanDerWaalsContact ND1-NE2 3.16Å; H50-H54 AromaticContact NE2-CD2 3.71Å; H50-H54 PolarHBondContact O-CD2 3.41Å; H50-H54 PolarHBondContact O-N 3.43Å
51	E	73.6	Confident	71.3	Confident	134 Å²	134	118 Å²	118	63%	0.626	59%	0.59	S	S	*	*	H	α-helix	trans	-63.2	-40.2	178.5	-72.9	-177.1	166.3	0	0	112.8	N47 Q48 S55	N47-E51 PolarHBondContact O-N 3.14Å; N47-E51 VanDerWaalsContact O-N 3.11Å; Q48-E51 PolarHBondContact O-N 3.43Å; E51-S55 WeakPolarHBondContact O-CB 3.49Å; E51-S55 PolarHBondContact O-N 3.3Å; E51-S55 PolarHBondContact O-OG 3.3Å
52	Q	67.1	Low	70.4	Confident	125 Å²	125	115.5 Å²	115.5	58%	0.584	59%	0.593	S	S	*	*	H	α-helix	trans	-68.5	-39	179.5	-74.2	-176.6	3.1	0	0	112.8	Q48 I49 H50 H54	Q48-Q52 WeakPolarHBondContact O-CB 3.4Å; Q48-Q52 WeakPolarHBondContact O-CG 3.35Å; Q48-Q52 PolarHBondContact O-N 3.17Å; I49-Q52 PolarHBondContact O-N 3.01Å; H50-Q52 PolarHBondContact O-N 2.87Å; Q52-H54 VanDerWaalsContact C-N 3.35Å
53	T	69.7	Low	69.9	Low	99 Å²	99	112.7 Å²	112.7	61%	0.607	59%	0.585	S	S	*	*	H	α-helix	trans	-69.5	-34.4	-177.5	-54.1	0	0	0	0	111.4	I49 H50	I49-T53 WeakPolarHBondContact O-CB 3.49Å; I49-T53 PolarHBondContact O-N 2.92Å; I49-T53 PolarHBondContact O-OG1 3.19Å; H50-T53 PolarHBondContact O-N 3.47Å
54	H	62.6	Low	69.4	Low	129 Å²	129	114.6 Å²	114.6	60%	0.597	60%	0.597	S	S	*	*	H	α-helix	trans	-87.6	-12.1	-178.2	-64.8	-54.4	0	0	0	114.9	H50 Q52	H50-H54 AromaticContact CE1-CD2 3.2Å; H50-H54 PolarHBondContact CE1-CD2 3.4Å; H50-H54 AromaticContact CE1-NE2 3.09Å; H50-H54 PolarHBondContact CE1-NE2 3.49Å; H50-H54 AromaticContact CG-CD2 3.87Å; H50-H54 AromaticContact ND1-CD2 3.3Å; H50-H54 PolarHBondContact ND1-CD2 3.05Å; H50-H54 VanDerWaalsContact ND1-CD2 3.3Å; H50-H54 AromaticContact ND1-NE2 3.16Å; H50-H54 PolarHBondContact ND1-NE2 3.33Å; H50-H54 VanDerWaalsContact ND1-NE2 3.16Å; H50-H54 AromaticContact NE2-CD2 3.71Å; H50-H54 PolarHBondContact O-CD2 3.41Å; H50-H54 PolarHBondContact O-N 3.43Å; Q52-H54 VanDerWaalsContact C-N 3.35Å
55	S	61.7	Low	69.6	Low	97 Å²	97	112.7 Å²	112.7	68%	0.678	59%	0.593	S	S	*	*	S	Bend	trans	-91.9	-2.5	-175.1	-58	0	0	0	0	115.3	E51	E51-S55 WeakPolarHBondContact O-CB 3.49Å; E51-S55 PolarHBondContact O-N 3.3Å; E51-S55 PolarHBondContact O-OG 3.3Å
56	R	62.1	Low	69.5	Low	218 Å²	218	114.6 Å²	114.6	82%	0.823	61%	0.607	S	S	*	*			trans	-114.7	51.3	-170.9	-67.3	-171.7	165.9	-169.5	-2.1	114.4	V58	R56-V58 PolarHBondContact O-N 2.86Å
57	Q	57.8	Low	70	Confident	167 Å²	167	117.4 Å²	117.4	78%	0.78	61%	0.613	S	S	*	*			trans	-83.3	100.1	155.9	-86.6	-176.5	-4.9	0	0	108.8	N59	Q57-N59 PolarHBondContact O-N 3.45Å; Q57-N59 VanDerWaalsContact O-N 3.16Å
58	V	64.8	Low	70.2	Confident	120 Å²	120	116.3 Å²	116.3	73%	0.727	61%	0.607	S	S	*	*			trans	-78.8	94.1	167.5	-174.5	0	0	0	0	107.2	R56 I60	R56-V58 PolarHBondContact O-N 2.86Å; V58-I60 VanDerWaalsContact C-N 3.34Å; V58-I60 HydrophobicContact CG1-CD1 4.31Å; V58-I60 HydrophobicContact CG1-CG1 3.68Å; V58-I60 PolarHBondContact O-N 2.84Å
59	N	58.8	Low	70.6	Confident	135 Å²	135	117.8 Å²	117.8	72%	0.722	62%	0.615	S	S	*	*			trans	-71	90.2	170.3	-76.3	-38.7	0	0	0	109	Q57 S61	Q57-N59 PolarHBondContact O-N 3.45Å; Q57-N59 VanDerWaalsContact O-N 3.16Å; N59-S61 PolarHBondContact O-N 2.94Å
60	I	56.2	Low	71.1	Confident	148 Å²	148	120.6 Å²	120.6	76%	0.759	62%	0.621	S	S	*	*			trans	-81.4	96	170	-51	178.3	0	0	0	107.3	V58	V58-I60 VanDerWaalsContact C-N 3.34Å; V58-I60 HydrophobicContact CG1-CD1 4.31Å; V58-I60 HydrophobicContact CG1-CG1 3.68Å; V58-I60 PolarHBondContact O-N 2.84Å
61	S	66.5	Low	71.6	Confident	93 Å²	93	119.9 Å²	119.9	65%	0.65	62%	0.62	S	S	*	*	P	Polyproline II helix	trans	-65.6	140.8	168.5	-62	0	0	0	0	109.8	N59	N59-S61 PolarHBondContact O-N 2.94Å
62	P	66.3	Low	72.2	Confident	99 Å²	99	117.5 Å²	117.5	64%	0.643	62%	0.615	S	S	*	*	P	Polyproline II helix	trans	-60.7	147.2	172.5	25.6	-32.7	0	0	0	110.3	T64	P62-T64 WeakPolarHBondContact O-CG2 3.41Å; P62-T64 PolarHBondContact O-N 3.44Å; P62-T64 VanDerWaalsContact O-N 3.12Å
63	P	68.6	Low	73.1	Confident	66 Å²	66	116.8 Å²	116.8	43%	0.429	61%	0.61	S	S	.	*	P	Polyproline II helix	trans	-60.4	116.4	-178.5	23.1	-32	0	0	0	110.5	D68	P63-D68 HydrophobicContact CB-CB 3.5Å
64	T	73.6	Confident	74	Confident	121 Å²	121	116 Å²	116	74%	0.742	60%	0.602	S	S	*	*			trans	-97.2	-8.8	-174.1	54.6	0	0	0	0	113.8	P62	P62-T64 WeakPolarHBondContact O-CG2 3.41Å; P62-T64 PolarHBondContact O-N 3.44Å; P62-T64 VanDerWaalsContact O-N 3.12Å
65	T	82.6	Confident	75.2	Confident	63 Å²	63	114.8 Å²	114.8	39%	0.387	60%	0.6	S	S	.	*	S	Bend	trans	-106.8	144.2	177.9	78.4	0	0	0	0	112	R67 D68 M69	T65-R67 PolarHBondContact O-N 3.31Å; T65-R67 VanDerWaalsContact O-N 3.11Å; T65-D68 WeakPolarHBondContact O-CB 3.32Å; T65-D68 PolarHBondContact O-N 3.42Å; T65-D68 PolarHBondContact OG1-N 3.16Å; T65-D68 VanDerWaalsContact OG1-N 3.15Å; T65-D68 PolarHBondContact OG1-OD1 3.3Å; T65-D68 PolarHBondContact OG1-OD2 3.26Å; T65-M69 PolarHBondContact O-N 3.4Å; T65-M69 VanDerWaalsContact O-N 3.14Å
66	T	83.1	Confident	76.5	Confident	96 Å²	96	115.6 Å²	115.6	59%	0.589	59%	0.591	S	S	*	*	H	α-helix	trans	-52.3	-32.1	171	-52	0	0	0	0	111.7	M69 Y70	T66-M69 PolarHBondContact O-N 2.96Å; T66-Y70 HydrophobicContact CG2-CD2 3.86Å; T66-Y70 HydrophobicContact CG2-CE2 3.42Å; T66-Y70 VanDerWaalsContact CG2-CE2 3.42Å; T66-Y70 WeakPolarHBondContact O-CD2 3.38Å; T66-Y70 PolarHBondContact O-N 3.04Å
67	R	89.7	Confident	77.9	Confident	190 Å²	190	108.3 Å²	108.3	72%	0.717	57%	0.567	S	S	*	*	H	α-helix	trans	-65.5	-42.8	176.1	-172.6	175.4	-169.5	168.8	1.9	112.3	T65 M69 Y70 N71	T65-R67 PolarHBondContact O-N 3.31Å; T65-R67 VanDerWaalsContact O-N 3.11Å; R67-M69 VanDerWaalsContact C-N 3.3Å; R67-M69 PolarHBondContact O-N 2.76Å; R67-Y70 PolarHBondContact O-N 3.11Å; R67-N71 WeakPolarHBondContact O-CB 3.37Å; R67-N71 VanDerWaalsContact O-CG 3.3Å; R67-N71 PolarHBondContact O-N 3.46Å
68	D	81	Confident	79.3	Confident	62 Å²	62	106.7 Å²	106.7	33%	0.332	56%	0.561	S	S	.	*	H	α-helix	trans	-67.4	-34.3	177.7	-58.6	-36.6	0	0	0	111.4	P63 T65 T72	P63-D68 HydrophobicContact CB-CB 3.5Å; T65-D68 WeakPolarHBondContact O-CB 3.32Å; T65-D68 PolarHBondContact O-N 3.42Å; T65-D68 PolarHBondContact OG1-N 3.16Å; T65-D68 VanDerWaalsContact OG1-N 3.15Å; T65-D68 PolarHBondContact OG1-OD1 3.3Å; T65-D68 PolarHBondContact OG1-OD2 3.26Å; D68-T72 WeakPolarHBondContact O-CB 3.43Å; D68-T72 PolarHBondContact O-N 3.06Å; D68-T72 PolarHBondContact O-OG1 3.32Å
69	M	84.2	Confident	80.3	Confident	111 Å²	111	105.9 Å²	105.9	55%	0.547	56%	0.557	S	S	.	*	H	α-helix	trans	-64.8	-47.2	173.5	-65.4	-176.7	178.1	0	0	111.9	T65 T66 R67 N71 T72 F73	T65-M69 PolarHBondContact O-N 3.4Å; T65-M69 VanDerWaalsContact O-N 3.14Å; T66-M69 PolarHBondContact O-N 2.96Å; R67-M69 VanDerWaalsContact C-N 3.3Å; R67-M69 PolarHBondContact O-N 2.76Å; M69-N71 PolarHBondContact O-N 3.44Å; M69-T72 PolarHBondContact O-N 3.39Å; M69-F73 WeakPolarHBondContact O-CB 3.47Å; M69-F73 PolarHBondContact O-N 2.72Å
70	Y	89.6	Confident	81.6	Confident	154 Å²	154	101.6 Å²	101.6	60%	0.604	54%	0.537	S	S	*	.	H	α-helix	trans	-63.5	-41	176.1	-76	-59.4	0	0	0	112.4	T66 R67 F73 N74	T66-Y70 HydrophobicContact CG2-CD2 3.86Å; T66-Y70 HydrophobicContact CG2-CE2 3.42Å; T66-Y70 VanDerWaalsContact CG2-CE2 3.42Å; T66-Y70 WeakPolarHBondContact O-CD2 3.38Å; T66-Y70 PolarHBondContact O-N 3.04Å; R67-Y70 PolarHBondContact O-N 3.11Å; Y70-F73 PolarHBondContact O-N 2.85Å; Y70-N74 WeakPolarHBondContact O-CB 3.35Å; Y70-N74 PolarHBondContact O-N 3.36Å; Y70-N74 PolarHBondContact O-ND2 3.49Å
71	N	83.8	Confident	82.4	Confident	91 Å²	91	97.7 Å²	97.7	49%	0.487	53%	0.533	S	S	.	.	H	α-helix	trans	-61.9	-44.1	175.6	-75.3	-13	0	0	0	111.5	R67 M69 N74 L75	R67-N71 WeakPolarHBondContact O-CB 3.37Å; R67-N71 VanDerWaalsContact O-CG 3.3Å; R67-N71 PolarHBondContact O-N 3.46Å; M69-N71 PolarHBondContact O-N 3.44Å; N71-N74 PolarHBondContact O-N 3.31Å; N71-L75 WeakPolarHBondContact O-CB 3.33Å; N71-L75 PolarHBondContact O-N 2.74Å
72	T	85.9	Confident	82.5	Confident	83 Å²	83	99.6 Å²	99.6	51%	0.509	53%	0.53	S	S	.	.	H	α-helix	trans	-63.4	-44.1	176.7	-58.1	0	0	0	0	111.3	D68 M69 L75 F76	D68-T72 WeakPolarHBondContact O-CB 3.43Å; D68-T72 PolarHBondContact O-N 3.06Å; D68-T72 PolarHBondContact O-OG1 3.32Å; M69-T72 PolarHBondContact O-N 3.39Å; T72-L75 PolarHBondContact O-N 3.41Å; T72-F76 WeakPolarHBondContact O-CB 3.38Å; T72-F76 PolarHBondContact O-N 3.05Å
73	F	87.6	Confident	82.3	Confident	111 Å²	111	100.8 Å²	100.8	49%	0.487	54%	0.535	S	S	.	.	H	α-helix	trans	-62.2	-47.1	176.5	-179.6	-95.6	0	0	0	111.8	M69 Y70 L75 F76 M77	M69-F73 WeakPolarHBondContact O-CB 3.47Å; M69-F73 PolarHBondContact O-N 2.72Å; Y70-F73 PolarHBondContact O-N 2.85Å; F73-L75 VanDerWaalsContact C-N 3.35Å; F73-L75 PolarHBondContact O-N 2.91Å; F73-F76 WeakPolarHBondContact O-CB 3.41Å; F73-F76 PolarHBondContact O-N 3.49Å; F73-M77 HydrophobicContact CD1-CG 4.03Å; F73-M77 HydrophobicContact CE1-CG 3.57Å; F73-M77 HydrophobicContact CE1-SD 4.38Å; F73-M77 HydrophobicContact CE2-CG 4.22Å; F73-M77 HydrophobicContact CE2-SD 4.33Å; F73-M77 HydrophobicContact CZ-CG 3.68Å; F73-M77 HydrophobicContact CZ-SD 3.9Å; F73-M77 WeakPolarHBondContact O-CG 3.32Å; F73-M77 PolarHBondContact O-N 3.5Å
74	N	86.8	Confident	81.3	Confident	82 Å²	82	110.2 Å²	110.2	44%	0.439	57%	0.573	S	S	.	*	H	α-helix	trans	-61.8	-43.3	178.1	-73.7	-21.7	0	0	0	111.5	Y70 N71 F76 M77 M78	Y70-N74 WeakPolarHBondContact O-CB 3.35Å; Y70-N74 PolarHBondContact O-N 3.36Å; Y70-N74 PolarHBondContact O-ND2 3.49Å; N71-N74 PolarHBondContact O-N 3.31Å; N74-F76 VanDerWaalsContact C-N 3.32Å; N74-F76 PolarHBondContact O-N 3.16Å; N74-M77 PolarHBondContact O-N 3.09Å; N74-M78 WeakPolarHBondContact O-CG 3.37Å; N74-M78 PolarHBondContact O-N 3.12Å
75	L	88.8	Confident	81.7	Confident	104 Å²	104	109.7 Å²	109.7	55%	0.545	57%	0.565	S	S	.	*	H	α-helix	trans	-61.2	-43	175.4	-176.6	63.9	0	0	0	111.3	N71 T72 F73 M78 T79	N71-L75 WeakPolarHBondContact O-CB 3.33Å; N71-L75 PolarHBondContact O-N 2.74Å; T72-L75 PolarHBondContact O-N 3.41Å; F73-L75 VanDerWaalsContact C-N 3.35Å; F73-L75 PolarHBondContact O-N 2.91Å; L75-M78 PolarHBondContact O-N 2.96Å; L75-T79 HydrophobicContact CD1-CG2 4.11Å; L75-T79 WeakPolarHBondContact O-CB 3.46Å; L75-T79 WeakPolarHBondContact O-CG2 3.39Å; L75-T79 PolarHBondContact O-N 3.38Å; L75-T79 PolarHBondContact O-OG1 3.41Å
76	F	89.5	Confident	81.6	Confident	114 Å²	114	112.1 Å²	112.1	50%	0.5	57%	0.574	S	S	.	*	H	α-helix	trans	-62.1	-44.2	175.2	177.9	-96.6	0	0	0	112.2	T72 F73 N74 T79 S80	T72-F76 WeakPolarHBondContact O-CB 3.38Å; T72-F76 PolarHBondContact O-N 3.05Å; F73-F76 WeakPolarHBondContact O-CB 3.41Å; F73-F76 PolarHBondContact O-N 3.49Å; N74-F76 VanDerWaalsContact C-N 3.32Å; N74-F76 PolarHBondContact O-N 3.16Å; F76-T79 PolarHBondContact O-N 2.99Å; F76-T79 PolarHBondContact O-OG1 3.23Å; F76-S80 WeakPolarHBondContact O-CB 3.5Å; F76-S80 PolarHBondContact O-N 2.97Å; F76-S80 PolarHBondContact O-OG 3.11Å
77	M	90	Very high	81.6	Confident	65 Å²	65	113 Å²	113	32%	0.32	57%	0.573	S	S	.	*	H	α-helix	trans	-64.3	-42.9	177.8	-69.7	-61.4	-72.5	0	0	112.1	F73 N74 T79 K82	F73-M77 HydrophobicContact CD1-CG 4.03Å; F73-M77 HydrophobicContact CE1-CG 3.57Å; F73-M77 HydrophobicContact CE1-SD 4.38Å; F73-M77 HydrophobicContact CE2-CG 4.22Å; F73-M77 HydrophobicContact CE2-SD 4.33Å; F73-M77 HydrophobicContact CZ-CG 3.68Å; F73-M77 HydrophobicContact CZ-SD 3.9Å; F73-M77 WeakPolarHBondContact O-CG 3.32Å; F73-M77 PolarHBondContact O-N 3.5Å; N74-M77 PolarHBondContact O-N 3.09Å; M77-T79 PolarHBondContact O-N 3.2Å; M77-K82 HydrophobicContact CE-CB 4.26Å; M77-K82 WeakPolarHBondContact CE-O 3.11Å; M77-K82 HydrophobicContact SD-CB 4.48Å
78	M	87.8	Confident	81.1	Confident	133 Å²	133	108.5 Å²	108.5	66%	0.655	57%	0.565	S	S	*	*	H	α-helix	trans	-65.9	-35.3	177.4	-70.9	-174.7	-67.8	0	0	113.1	N74 L75	N74-M78 WeakPolarHBondContact O-CG 3.37Å; N74-M78 PolarHBondContact O-N 3.12Å; L75-M78 PolarHBondContact O-N 2.96Å
79	T	87	Confident	81.1	Confident	102 Å²	102	111.4 Å²	111.4	63%	0.626	58%	0.579	S	S	*	*	H	α-helix	trans	-93.6	-29.7	-174	54.3	0	0	0	0	114.1	L75 F76 M77 G81	L75-T79 HydrophobicContact CD1-CG2 4.11Å; L75-T79 WeakPolarHBondContact O-CB 3.46Å; L75-T79 WeakPolarHBondContact O-CG2 3.39Å; L75-T79 PolarHBondContact O-N 3.38Å; L75-T79 PolarHBondContact O-OG1 3.41Å; F76-T79 PolarHBondContact O-N 2.99Å; F76-T79 PolarHBondContact O-OG1 3.23Å; M77-T79 PolarHBondContact O-N 3.2Å; T79-G81 PolarHBondContact O-N 3.14Å
80	S	85.4	Confident	80.9	Confident	46 Å²	46	111.4 Å²	111.4	32%	0.322	58%	0.582	S	S	.	*	T	Hydrogen-bonded Turn	trans	-73.9	-0.1	179	64.1	0	0	0	0	113.9	F76 K82	F76-S80 WeakPolarHBondContact O-CB 3.5Å; F76-S80 PolarHBondContact O-N 2.97Å; F76-S80 PolarHBondContact O-OG 3.11Å; S80-K82 PolarHBondContact O-N 3.15Å
81	G	73.5	Confident	80.3	Confident	65 Å²	65	108.4 Å²	108.4	67%	0.67	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	70.4	6.7	-178.1	0	0	0	0	0	113.9	T79 V83	T79-G81 PolarHBondContact O-N 3.14Å; G81-V83 VanDerWaalsContact C-N 3.29Å; G81-V83 PolarHBondContact O-N 2.65Å; G81-V83 VanDerWaalsContact O-N 3.15Å
82	K	67.1	Low	80	Confident	134 Å²	134	109.7 Å²	109.7	58%	0.583	59%	0.587	S	S	*	*			trans	-86.9	71.2	174.4	-64.2	-179.8	-178.2	175	0	109.3	M77 S80	M77-K82 HydrophobicContact CE-CB 4.26Å; M77-K82 WeakPolarHBondContact CE-O 3.11Å; M77-K82 HydrophobicContact SD-CB 4.48Å; S80-K82 PolarHBondContact O-N 3.15Å
83	V	63.1	Low	79.5	Confident	123 Å²	123	111.9 Å²	111.9	75%	0.745	59%	0.594	S	S	*	*			trans	-106.4	106.8	161.4	-175.5	0	0	0	0	105.8	G81	G81-V83 VanDerWaalsContact C-N 3.29Å; G81-V83 PolarHBondContact O-N 2.65Å; G81-V83 VanDerWaalsContact O-N 3.15Å
84	Q	47.5	Very low	78.8	Confident	264 Å²	264	112 Å²	112	100%	1.234	60%	0.603	S	S	*	*			trans	-117.3	0	166.6	-137.7	177.7	10.4	0	0	107.9

Retrieved 84 of 84 residues in 105.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).