A0A5K4F9F2_SCHMA Loading...

HAMP domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4F9F2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 85 aa.

						>A0A5K4F9F2_SCHMA|A0A5K4F9F2
MASALDTNQADVKQNPEEIQDLTASISVMLKNIQESFNTMSEQLLEKNILFLKSFHFELLSNIYLSKLFWFANRFWQYQLFLISI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.9	Very low	45.7	Very low	247 Å²	247	129 Å²	129	100%	1.217	76%	0.76	S	S	*	*				0	127.8	0	-83.7	160.3	119.9	0	0	107.4
2	A	43.8	Very low	46.6	Very low	102 Å²	102	126.9 Å²	126.9	84%	0.843	75%	0.749	S	S	*	*			trans	-50.8	153.8	173.1	0	0	0	0	0	110.4
3	S	47.2	Very low	47.2	Very low	105 Å²	105	130.7 Å²	130.7	73%	0.734	75%	0.75	S	S	*	*			cis	-164.2	118.1	38.7	-167.9	0	0	0	0	106
4	A	46.9	Very low	48.1	Very low	73 Å²	73	129.4 Å²	129.4	60%	0.603	73%	0.734	S	S	*	*				51.8	101.8	111.3	0	0	0	0	0	114.1	D6	A4-D6 VanDerWaalsContact C-N 3.28Å; A4-D6 PolarHBondContact O-N 3.35Å
5	L	46.2	Very low	49.2	Very low	146 Å²	146	124.7 Å²	124.7	76%	0.764	71%	0.707	S	S	*	*				53.5	34	113.3	-145	92.3	0	0	0	117.4
6	D	46.9	Very low	50.8	Low	119 Å²	119	122 Å²	122	64%	0.636	70%	0.695	S	S	*	*			trans	-96.8	2.1	169	-107.1	-34.2	0	0	0	113.2	A4 N8 Q9	A4-D6 VanDerWaalsContact C-N 3.28Å; A4-D6 PolarHBondContact O-N 3.35Å; D6-N8 PolarHBondContact O-N 3.05Å; D6-Q9 PolarHBondContact O-N 2.89Å
7	T	47.9	Very low	52.4	Low	129 Å²	129	122.4 Å²	122.4	79%	0.791	69%	0.69	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.6	-7.4	173	-29.8	0	0	0	0	112.9	Q9 A10	T7-Q9 VanDerWaalsContact C-N 3.3Å; T7-A10 PolarHBondContact O-N 3.01Å
8	N	44.8	Very low	54.1	Low	135 Å²	135	122.7 Å²	122.7	72%	0.722	68%	0.684	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.7	-4.4	174.3	-75.3	-23.9	0	0	0	113.5	D6 A10	D6-N8 PolarHBondContact O-N 3.05Å; N8-A10 PolarHBondContact O-N 3.29Å; N8-A10 VanDerWaalsContact O-N 3.15Å
9	Q	44.4	Very low	55.7	Low	158 Å²	158	119.6 Å²	119.6	74%	0.738	67%	0.666	S	S	*	*			trans	-83.5	58.1	152.5	-68.4	-169.9	-7.2	0	0	108.4	D6 T7 D11	D6-Q9 PolarHBondContact O-N 2.89Å; T7-Q9 VanDerWaalsContact C-N 3.3Å; Q9-D11 PolarHBondContact O-N 2.83Å
10	A	50.7	Low	57.1	Low	73 Å²	73	120.4 Å²	120.4	60%	0.603	66%	0.664	S	S	*	*			trans	-58.1	81.4	148.1	0	0	0	0	0	105.2	T7 N8 V12	T7-A10 PolarHBondContact O-N 3.01Å; N8-A10 PolarHBondContact O-N 3.29Å; N8-A10 VanDerWaalsContact O-N 3.15Å; A10-V12 WeakPolarHBondContact O-CG2 3.34Å; A10-V12 PolarHBondContact O-N 3.22Å
11	D	48.1	Very low	58.6	Low	132 Å²	132	120 Å²	120	71%	0.706	66%	0.661	S	S	*	*				29	43.1	121.5	-142.8	25.7	0	0	0	114.4	Q9 K13	Q9-D11 PolarHBondContact O-N 2.83Å; D11-K13 PolarHBondContact O-N 2.98Å; D11-K13 WeakPolarHBondContact OD1-CB 3.46Å
12	V	56.3	Low	61.1	Low	104 Å²	104	113.2 Å²	113.2	63%	0.63	63%	0.629	S	S	*	*			trans	-67.8	56.3	146.4	-170.8	0	0	0	0	105.6	A10 Q14	A10-V12 WeakPolarHBondContact O-CG2 3.34Å; A10-V12 PolarHBondContact O-N 3.22Å; V12-Q14 HydrophobicContact CG1-CB 3.95Å; V12-Q14 HydrophobicContact CG1-CG 3.29Å; V12-Q14 PolarHBondContact O-N 2.77Å
13	K	55.1	Low	63.4	Low	176 Å²	176	112.4 Å²	112.4	77%	0.765	61%	0.614	S	S	*	*			trans	-71.8	57.9	152.7	-159.1	178.6	-168.2	-179.4	0	105.1	D11 N15	D11-K13 PolarHBondContact O-N 2.98Å; D11-K13 WeakPolarHBondContact OD1-CB 3.46Å; K13-N15 PolarHBondContact O-N 2.89Å
14	Q	59.8	Low	65.5	Low	113 Å²	113	109.9 Å²	109.9	53%	0.528	60%	0.599	S	S	.	*			trans	-54.2	115.5	169.5	-95.7	165.4	-1.8	0	0	104.3	V12 P16 I19	V12-Q14 HydrophobicContact CG1-CB 3.95Å; V12-Q14 HydrophobicContact CG1-CG 3.29Å; V12-Q14 PolarHBondContact O-N 2.77Å; Q14-P16 WeakPolarHBondContact O-CD 3.35Å; Q14-P16 VanDerWaalsContact O-N 3.07Å; Q14-I19 HydrophobicContact CB-CD1 3.45Å; Q14-I19 VanDerWaalsContact CB-CD1 3.45Å; Q14-I19 HydrophobicContact CB-CG1 3.54Å; Q14-I19 HydrophobicContact CG-CD1 4.09Å; Q14-I19 HydrophobicContact CG-CG1 3.93Å
15	N	64	Low	67.7	Low	59 Å²	59	110 Å²	110	32%	0.316	60%	0.595	S	S	.	*			trans	-55	119.7	171.5	-178.9	2.4	0	0	0	106.1	K13 E17 E18 I19	K13-N15 PolarHBondContact O-N 2.89Å; N15-E17 PolarHBondContact O-N 3.48Å; N15-E17 PolarHBondContact OD1-N 3.44Å; N15-E18 HydrophobicContact CB-CB 4.15Å; N15-E18 HydrophobicContact CB-CG 3.86Å; N15-E18 WeakPolarHBondContact O-CB 3.33Å; N15-E18 PolarHBondContact O-N 2.9Å; N15-I19 PolarHBondContact O-N 2.69Å; N15-I19 VanDerWaalsContact O-N 3.12Å
16	P	75.1	Confident	70	Confident	81 Å²	81	106.9 Å²	106.9	53%	0.526	58%	0.579	S	S	.	*	H	α-helix	trans	-55.5	-27.6	-178.1	20.5	-32.7	0	0	0	112	Q14 Q20	Q14-P16 WeakPolarHBondContact O-CD 3.35Å; Q14-P16 VanDerWaalsContact O-N 3.07Å; P16-Q20 WeakPolarHBondContact O-CB 3.41Å; P16-Q20 WeakPolarHBondContact O-CG 3.32Å; P16-Q20 PolarHBondContact O-N 3.12Å
17	E	78.3	Confident	72.3	Confident	129 Å²	129	104.8 Å²	104.8	60%	0.603	57%	0.573	S	S	*	*	H	α-helix	trans	-64.2	-44.6	172.4	-61.3	179.8	167	0	0	112.1	N15 I19 Q20 D21	N15-E17 PolarHBondContact O-N 3.48Å; N15-E17 PolarHBondContact OD1-N 3.44Å; E17-I19 PolarHBondContact O-N 2.95Å; E17-Q20 PolarHBondContact O-N 2.86Å; E17-D21 PolarHBondContact O-N 2.68Å
18	E	82.9	Confident	74.6	Confident	127 Å²	127	102.6 Å²	102.6	59%	0.593	56%	0.56	S	S	*	*	H	α-helix	trans	-65.7	-38.8	177	-70.1	172.3	-165.2	0	0	112.1	N15 Q20 L22	N15-E18 HydrophobicContact CB-CB 4.15Å; N15-E18 HydrophobicContact CB-CG 3.86Å; N15-E18 WeakPolarHBondContact O-CB 3.33Å; N15-E18 PolarHBondContact O-N 2.9Å; E18-Q20 VanDerWaalsContact C-N 3.34Å; E18-L22 VanDerWaalsContact O-CB 3.26Å; E18-L22 WeakPolarHBondContact O-CB 3.49Å; E18-L22 PolarHBondContact O-N 3.35Å
19	I	83.3	Confident	77	Confident	64 Å²	64	102 Å²	102	33%	0.328	55%	0.554	S	S	.	*	H	α-helix	trans	-63.8	-43.4	173.9	-53.4	178.8	0	0	0	110.1	Q14 N15 E17 L22 T23	Q14-I19 HydrophobicContact CB-CD1 3.45Å; Q14-I19 VanDerWaalsContact CB-CD1 3.45Å; Q14-I19 HydrophobicContact CB-CG1 3.54Å; Q14-I19 HydrophobicContact CG-CD1 4.09Å; Q14-I19 HydrophobicContact CG-CG1 3.93Å; N15-I19 PolarHBondContact O-N 2.69Å; N15-I19 VanDerWaalsContact O-N 3.12Å; E17-I19 PolarHBondContact O-N 2.95Å; I19-L22 PolarHBondContact O-N 3.15Å; I19-T23 VanDerWaalsContact O-CB 3.24Å; I19-T23 WeakPolarHBondContact O-CB 3.21Å; I19-T23 PolarHBondContact O-N 2.81Å; I19-T23 PolarHBondContact O-OG1 3.49Å
20	Q	84.4	Confident	79.5	Confident	136 Å²	136	99.5 Å²	99.5	64%	0.636	55%	0.545	S	S	*	.	H	α-helix	trans	-63.4	-45.6	179.9	-77.5	175.3	20.8	0	0	111.4	P16 E17 E18 T23 A24	P16-Q20 WeakPolarHBondContact O-CB 3.41Å; P16-Q20 WeakPolarHBondContact O-CG 3.32Å; P16-Q20 PolarHBondContact O-N 3.12Å; E17-Q20 PolarHBondContact O-N 2.86Å; E18-Q20 VanDerWaalsContact C-N 3.34Å; Q20-T23 PolarHBondContact O-N 2.8Å; Q20-A24 WeakPolarHBondContact O-CB 3.24Å; Q20-A24 PolarHBondContact O-N 2.64Å
21	D	88	Confident	81.6	Confident	112 Å²	112	102.3 Å²	102.3	60%	0.599	54%	0.544	S	S	*	.	H	α-helix	trans	-63.8	-41.5	177.1	-79.7	-8.2	0	0	0	112	E17 A24 S25	E17-D21 PolarHBondContact O-N 2.68Å; D21-A24 PolarHBondContact O-N 3.28Å; D21-S25 WeakPolarHBondContact O-CB 3.41Å; D21-S25 PolarHBondContact O-N 3.21Å; D21-S25 PolarHBondContact O-OG 2.91Å
22	L	89.5	Confident	84	Confident	105 Å²	105	100.2 Å²	100.2	55%	0.55	53%	0.533	S	S	.	.	H	α-helix	trans	-64.8	-44.4	174.8	179.7	61.8	0	0	0	111.2	E18 I19 A24 S25 I26	E18-L22 VanDerWaalsContact O-CB 3.26Å; E18-L22 WeakPolarHBondContact O-CB 3.49Å; E18-L22 PolarHBondContact O-N 3.35Å; I19-L22 PolarHBondContact O-N 3.15Å; L22-A24 VanDerWaalsContact C-N 3.34Å; L22-A24 PolarHBondContact O-N 3.44Å; L22-S25 WeakPolarHBondContact O-CB 3.47Å; L22-S25 PolarHBondContact O-N 3.41Å; L22-I26 HydrophobicContact CD1-CD1 4.05Å; L22-I26 HydrophobicContact CD1-CG1 4.28Å; L22-I26 HydrophobicContact CG-CD1 3.92Å; L22-I26 VanDerWaalsContact O-CG1 3.31Å; L22-I26 WeakPolarHBondContact O-CG1 3.26Å; L22-I26 PolarHBondContact O-N 3.23Å
23	T	91.3	Very high	85.9	Confident	84 Å²	84	99.7 Å²	99.7	52%	0.515	53%	0.526	S	S	.	.	H	α-helix	trans	-63.4	-42.3	178.7	-58.7	0	0	0	0	110.8	I19 Q20 I26 S27	I19-T23 VanDerWaalsContact O-CB 3.24Å; I19-T23 WeakPolarHBondContact O-CB 3.21Å; I19-T23 PolarHBondContact O-N 2.81Å; I19-T23 PolarHBondContact O-OG1 3.49Å; Q20-T23 PolarHBondContact O-N 2.8Å; T23-I26 PolarHBondContact O-N 3.33Å; T23-S27 VanDerWaalsContact O-CB 3.29Å; T23-S27 WeakPolarHBondContact O-CB 3.49Å; T23-S27 PolarHBondContact O-N 3.5Å
24	A	91.4	Very high	87.8	Confident	52 Å²	52	96.3 Å²	96.3	43%	0.43	51%	0.512	S	S	.	.	H	α-helix	trans	-62.6	-43.8	174.4	0	0	0	0	0	111.2	Q20 D21 L22 S27 V28	Q20-A24 WeakPolarHBondContact O-CB 3.24Å; Q20-A24 PolarHBondContact O-N 2.64Å; D21-A24 PolarHBondContact O-N 3.28Å; L22-A24 VanDerWaalsContact C-N 3.34Å; L22-A24 PolarHBondContact O-N 3.44Å; A24-S27 WeakPolarHBondContact O-CB 3.38Å; A24-S27 PolarHBondContact O-N 2.92Å; A24-V28 WeakPolarHBondContact O-CG2 2.99Å; A24-V28 PolarHBondContact O-N 3.44Å
25	S	93.5	Very high	89.5	Confident	75 Å²	75	95.5 Å²	95.5	52%	0.524	51%	0.508	S	S	.	.	H	α-helix	trans	-62.2	-44.5	177.4	-61.5	0	0	0	0	112.2	D21 L22 V28 M29	D21-S25 WeakPolarHBondContact O-CB 3.41Å; D21-S25 PolarHBondContact O-N 3.21Å; D21-S25 PolarHBondContact O-OG 2.91Å; L22-S25 WeakPolarHBondContact O-CB 3.47Å; L22-S25 PolarHBondContact O-N 3.41Å; S25-V28 PolarHBondContact O-N 3.49Å; S25-M29 WeakPolarHBondContact O-CB 3.29Å; S25-M29 PolarHBondContact O-N 2.85Å
26	I	94.9	Very high	91.1	Very high	82 Å²	82	96.5 Å²	96.5	42%	0.421	52%	0.52	S	S	.	.	H	α-helix	trans	-64.2	-42.1	175	-68.6	168.6	0	0	0	110.3	L22 T23 V28 M29 L30	L22-I26 HydrophobicContact CD1-CD1 4.05Å; L22-I26 HydrophobicContact CD1-CG1 4.28Å; L22-I26 HydrophobicContact CG-CD1 3.92Å; L22-I26 VanDerWaalsContact O-CG1 3.31Å; L22-I26 WeakPolarHBondContact O-CG1 3.26Å; L22-I26 PolarHBondContact O-N 3.23Å; T23-I26 PolarHBondContact O-N 3.33Å; I26-V28 PolarHBondContact O-N 2.9Å; I26-M29 WeakPolarHBondContact O-CB 3.35Å; I26-M29 PolarHBondContact O-N 3.23Å; I26-L30 HydrophobicContact CG2-CD1 3.89Å; I26-L30 HydrophobicContact CG2-CG 4.2Å; I26-L30 WeakPolarHBondContact O-CB 3.44Å; I26-L30 VanDerWaalsContact O-CG 3.32Å; I26-L30 WeakPolarHBondContact O-CG 3.32Å; I26-L30 PolarHBondContact O-N 3.49Å
27	S	94.9	Very high	92.1	Very high	74 Å²	74	98.9 Å²	98.9	52%	0.517	52%	0.522	S	S	.	.	H	α-helix	trans	-60.9	-45.3	178	-174.2	0	0	0	0	111.8	T23 A24 L30 K31	T23-S27 VanDerWaalsContact O-CB 3.29Å; T23-S27 WeakPolarHBondContact O-CB 3.49Å; T23-S27 PolarHBondContact O-N 3.5Å; A24-S27 WeakPolarHBondContact O-CB 3.38Å; A24-S27 PolarHBondContact O-N 2.92Å; S27-L30 PolarHBondContact O-N 2.87Å; S27-K31 WeakPolarHBondContact O-CB 3.43Å; S27-K31 PolarHBondContact O-N 3.28Å
28	V	95.4	Very high	92.9	Very high	83 Å²	83	96.4 Å²	96.4	50%	0.503	51%	0.514	S	S	.	.	H	α-helix	trans	-62.6	-43.8	174.3	172.1	0	0	0	0	110.9	A24 S25 I26 L30 K31 N32	A24-V28 WeakPolarHBondContact O-CG2 2.99Å; A24-V28 PolarHBondContact O-N 3.44Å; S25-V28 PolarHBondContact O-N 3.49Å; I26-V28 PolarHBondContact O-N 2.9Å; V28-L30 PolarHBondContact O-N 3.24Å; V28-K31 PolarHBondContact O-N 2.86Å; V28-N32 WeakPolarHBondContact O-CB 3.31Å; V28-N32 PolarHBondContact O-N 3.45Å; V28-N32 PolarHBondContact O-ND2 2.9Å; V28-N32 PolarHBondContact O-OD1 3.35Å
29	M	95.6	Very high	93.5	Very high	122 Å²	122	93.8 Å²	93.8	60%	0.601	51%	0.506	S	S	*	.	H	α-helix	trans	-60.2	-47.2	177	-176.8	179.6	-179.7	0	0	111.9	S25 I26 K31 N32 I33	S25-M29 WeakPolarHBondContact O-CB 3.29Å; S25-M29 PolarHBondContact O-N 2.85Å; I26-M29 WeakPolarHBondContact O-CB 3.35Å; I26-M29 PolarHBondContact O-N 3.23Å; M29-K31 VanDerWaalsContact C-N 3.34Å; M29-K31 PolarHBondContact O-N 2.91Å; M29-N32 PolarHBondContact O-N 3.48Å; M29-I33 HydrophobicContact CE-CD1 4.12Å; M29-I33 HydrophobicContact CG-CD1 3.98Å; M29-I33 VanDerWaalsContact O-CG1 3.29Å; M29-I33 WeakPolarHBondContact O-CG1 3.45Å; M29-I33 PolarHBondContact O-N 3.41Å
30	L	96.3	Very high	94	Very high	106 Å²	106	96.2 Å²	96.2	56%	0.555	52%	0.517	S	S	*	.	H	α-helix	trans	-63.5	-40.2	178	-72.1	174.6	0	0	0	111.7	I26 S27 V28 I33 Q34	I26-L30 HydrophobicContact CG2-CD1 3.89Å; I26-L30 HydrophobicContact CG2-CG 4.2Å; I26-L30 WeakPolarHBondContact O-CB 3.44Å; I26-L30 VanDerWaalsContact O-CG 3.32Å; I26-L30 WeakPolarHBondContact O-CG 3.32Å; I26-L30 PolarHBondContact O-N 3.49Å; S27-L30 PolarHBondContact O-N 2.87Å; V28-L30 PolarHBondContact O-N 3.24Å; L30-I33 PolarHBondContact O-N 3.36Å; L30-Q34 WeakPolarHBondContact O-CB 3.38Å; L30-Q34 PolarHBondContact O-N 2.95Å
31	K	96.4	Very high	94.5	Very high	133 Å²	133	92.1 Å²	92.1	58%	0.578	50%	0.504	S	S	*	.	H	α-helix	trans	-61.1	-46.8	174.5	-176.2	178.6	173.2	-176.6	0	111.3	S27 V28 M29 I33 Q34 E35	S27-K31 WeakPolarHBondContact O-CB 3.43Å; S27-K31 PolarHBondContact O-N 3.28Å; V28-K31 PolarHBondContact O-N 2.86Å; M29-K31 VanDerWaalsContact C-N 3.34Å; M29-K31 PolarHBondContact O-N 2.91Å; K31-I33 VanDerWaalsContact C-N 3.33Å; K31-I33 PolarHBondContact O-N 3.21Å; K31-Q34 PolarHBondContact O-N 3.43Å; K31-E35 WeakPolarHBondContact CE-OE1 3.27Å; K31-E35 IonicContact NZ-OE1 4Å; K31-E35 WeakPolarHBondContact O-CG 3.5Å; K31-E35 PolarHBondContact O-N 2.94Å
32	N	96.5	Very high	94.8	Very high	88 Å²	88	92.5 Å²	92.5	47%	0.471	50%	0.502	S	S	.	.	H	α-helix	trans	-63.1	-39	177.7	-66.8	-14.2	0	0	0	112	V28 M29 S36	V28-N32 WeakPolarHBondContact O-CB 3.31Å; V28-N32 PolarHBondContact O-N 3.45Å; V28-N32 PolarHBondContact O-ND2 2.9Å; V28-N32 PolarHBondContact O-OD1 3.35Å; M29-N32 PolarHBondContact O-N 3.48Å; N32-S36 VanDerWaalsContact O-CB 3.27Å; N32-S36 WeakPolarHBondContact O-CB 3.29Å; N32-S36 PolarHBondContact O-N 2.79Å
33	I	96.3	Very high	95	Very high	93 Å²	93	92.1 Å²	92.1	48%	0.477	50%	0.498	S	S	.	.	H	α-helix	trans	-63.7	-44.9	174.7	-70	166.2	0	0	0	110.5	M29 L30 K31 S36 F37	M29-I33 HydrophobicContact CE-CD1 4.12Å; M29-I33 HydrophobicContact CG-CD1 3.98Å; M29-I33 VanDerWaalsContact O-CG1 3.29Å; M29-I33 WeakPolarHBondContact O-CG1 3.45Å; M29-I33 PolarHBondContact O-N 3.41Å; L30-I33 PolarHBondContact O-N 3.36Å; K31-I33 VanDerWaalsContact C-N 3.33Å; K31-I33 PolarHBondContact O-N 3.21Å; I33-S36 PolarHBondContact O-N 2.95Å; I33-F37 WeakPolarHBondContact O-CB 3.41Å; I33-F37 PolarHBondContact O-N 3.5Å
34	Q	96.6	Very high	95.1	Very high	104 Å²	104	92.1 Å²	92.1	49%	0.486	49%	0.494	S	S	.	.	H	α-helix	trans	-62.8	-44.3	178.5	-175.6	63.5	50.9	0	0	111.8	L30 K31 F37 N38	L30-Q34 WeakPolarHBondContact O-CB 3.38Å; L30-Q34 PolarHBondContact O-N 2.95Å; K31-Q34 PolarHBondContact O-N 3.43Å; Q34-F37 PolarHBondContact O-N 2.83Å; Q34-N38 PolarHBondContact NE2-OD1 3.37Å; Q34-N38 WeakPolarHBondContact O-CB 3.37Å; Q34-N38 PolarHBondContact O-N 3.41Å; Q34-N38 PolarHBondContact O-ND2 3.46Å; Q34-N38 PolarHBondContact O-OD1 2.92Å
35	E	95.6	Very high	95.2	Very high	96 Å²	96	94.8 Å²	94.8	45%	0.449	50%	0.501	S	S	.	.	H	α-helix	trans	-64	-41.7	177.2	-74	176.5	-174	0	0	111.6	K31 N38 T39	K31-E35 WeakPolarHBondContact CE-OE1 3.27Å; K31-E35 IonicContact NZ-OE1 4Å; K31-E35 WeakPolarHBondContact O-CG 3.5Å; K31-E35 PolarHBondContact O-N 2.94Å; E35-N38 PolarHBondContact O-N 3.49Å; E35-T39 WeakPolarHBondContact O-CB 3.32Å; E35-T39 PolarHBondContact O-N 3.34Å; E35-T39 PolarHBondContact O-OG1 3.5Å
36	S	96	Very high	95.2	Very high	80 Å²	80	97 Å²	97	56%	0.559	50%	0.503	S	S	*	.	H	α-helix	trans	-62.3	-45.7	174.7	-176.9	0	0	0	0	111.7	N32 I33 T39 M40	N32-S36 VanDerWaalsContact O-CB 3.27Å; N32-S36 WeakPolarHBondContact O-CB 3.29Å; N32-S36 PolarHBondContact O-N 2.79Å; I33-S36 PolarHBondContact O-N 2.95Å; S36-T39 PolarHBondContact O-N 2.9Å; S36-M40 WeakPolarHBondContact O-CB 3.36Å; S36-M40 PolarHBondContact O-N 2.92Å
37	F	96.3	Very high	95.1	Very high	131 Å²	131	99.6 Å²	99.6	58%	0.575	51%	0.511	S	S	*	.	H	α-helix	trans	-62.9	-44.9	177	-176.6	-94	0	0	0	111.8	I33 Q34 T39 M40 S41	I33-F37 WeakPolarHBondContact O-CB 3.41Å; I33-F37 PolarHBondContact O-N 3.5Å; Q34-F37 PolarHBondContact O-N 2.83Å; F37-T39 PolarHBondContact O-N 3.06Å; F37-M40 PolarHBondContact O-N 2.76Å; F37-S41 VanDerWaalsContact O-CB 3.29Å; F37-S41 WeakPolarHBondContact O-CB 3.42Å; F37-S41 PolarHBondContact O-N 3.28Å; F37-S41 PolarHBondContact O-OG 3.2Å
38	N	94.9	Very high	95	Very high	78 Å²	78	100.9 Å²	100.9	42%	0.417	51%	0.512	S	S	.	.	H	α-helix	trans	-59.3	-50.1	177.3	-73.8	-10	0	0	0	110.5	Q34 E35 M40 S41 E42	Q34-N38 PolarHBondContact NE2-OD1 3.37Å; Q34-N38 WeakPolarHBondContact O-CB 3.37Å; Q34-N38 PolarHBondContact O-N 3.41Å; Q34-N38 PolarHBondContact O-ND2 3.46Å; Q34-N38 PolarHBondContact O-OD1 2.92Å; E35-N38 PolarHBondContact O-N 3.49Å; N38-M40 VanDerWaalsContact C-N 3.35Å; N38-M40 PolarHBondContact O-N 3.43Å; N38-S41 PolarHBondContact O-N 2.87Å; N38-S41 PolarHBondContact O-OG 3.4Å; N38-E42 WeakPolarHBondContact O-CB 3.21Å; N38-E42 PolarHBondContact O-N 3Å
39	T	95.4	Very high	94.9	Very high	72 Å²	72	101.9 Å²	101.9	44%	0.442	51%	0.513	S	S	.	.	H	α-helix	trans	-58.6	-45.6	178.2	-55.3	0	0	0	0	111.6	E35 S36 F37 E42 Q43	E35-T39 WeakPolarHBondContact O-CB 3.32Å; E35-T39 PolarHBondContact O-N 3.34Å; E35-T39 PolarHBondContact O-OG1 3.5Å; S36-T39 PolarHBondContact O-N 2.9Å; F37-T39 PolarHBondContact O-N 3.06Å; T39-E42 PolarHBondContact O-N 3.36Å; T39-Q43 WeakPolarHBondContact O-CG 3.33Å; T39-Q43 PolarHBondContact O-N 2.85Å
40	M	94.9	Very high	94.8	Very high	114 Å²	114	101.6 Å²	101.6	56%	0.562	51%	0.514	S	S	*	.	H	α-helix	trans	-64.9	-41.9	178.1	-177.2	174.9	177.4	0	0	111.8	S36 F37 N38 Q43 L44	S36-M40 WeakPolarHBondContact O-CB 3.36Å; S36-M40 PolarHBondContact O-N 2.92Å; F37-M40 PolarHBondContact O-N 2.76Å; N38-M40 VanDerWaalsContact C-N 3.35Å; N38-M40 PolarHBondContact O-N 3.43Å; M40-Q43 PolarHBondContact O-N 3.47Å; M40-L44 HydrophobicContact CE-CD1 4.08Å; M40-L44 HydrophobicContact CG-CD1 4.1Å; M40-L44 WeakPolarHBondContact O-CB 3.31Å; M40-L44 VanDerWaalsContact O-CG 3.31Å; M40-L44 WeakPolarHBondContact O-CG 3.37Å; M40-L44 PolarHBondContact O-N 2.89Å
41	S	93.8	Very high	94.7	Very high	51 Å²	51	103.4 Å²	103.4	36%	0.357	52%	0.517	S	S	.	.	H	α-helix	trans	-65.6	-40.3	179.6	73.1	0	0	0	0	112.1	F37 N38 L44 L45	F37-S41 VanDerWaalsContact O-CB 3.29Å; F37-S41 WeakPolarHBondContact O-CB 3.42Å; F37-S41 PolarHBondContact O-N 3.28Å; F37-S41 PolarHBondContact O-OG 3.2Å; N38-S41 PolarHBondContact O-N 2.87Å; N38-S41 PolarHBondContact O-OG 3.4Å; S41-L44 PolarHBondContact O-N 2.89Å; S41-L45 WeakPolarHBondContact O-CB 3.45Å; S41-L45 PolarHBondContact O-N 2.86Å
42	E	94.5	Very high	94.6	Very high	119 Å²	119	101.6 Å²	101.6	56%	0.556	51%	0.514	S	S	*	.	H	α-helix	trans	-64.1	-48.4	176.3	-174.8	170	-155.1	0	0	110.7	N38 T39 L44 L45 E46	N38-E42 WeakPolarHBondContact O-CB 3.21Å; N38-E42 PolarHBondContact O-N 3Å; T39-E42 PolarHBondContact O-N 3.36Å; E42-L44 VanDerWaalsContact C-N 3.33Å; E42-L44 PolarHBondContact O-N 2.82Å; E42-L45 PolarHBondContact O-N 3.4Å; E42-E46 WeakPolarHBondContact O-CG 3.29Å; E42-E46 PolarHBondContact O-N 2.94Å
43	Q	94.1	Very high	94.4	Very high	98 Å²	98	105 Å²	105	46%	0.458	52%	0.524	S	S	.	.	H	α-helix	trans	-60.9	-39.7	176.1	-72.4	179.1	8	0	0	113	T39 M40 K47	T39-Q43 WeakPolarHBondContact O-CG 3.33Å; T39-Q43 PolarHBondContact O-N 2.85Å; M40-Q43 PolarHBondContact O-N 3.47Å; Q43-K47 VanDerWaalsContact O-CB 3.31Å; Q43-K47 WeakPolarHBondContact O-CB 3.31Å; Q43-K47 WeakPolarHBondContact O-CG 3.41Å; Q43-K47 PolarHBondContact O-N 3.17Å
44	L	93.2	Very high	94.3	Very high	84 Å²	84	103.7 Å²	103.7	44%	0.44	52%	0.523	S	S	.	.	H	α-helix	trans	-66.6	-42	176.3	-77.4	172.9	0	0	0	111.2	M40 S41 E42 K47 N48	M40-L44 HydrophobicContact CE-CD1 4.08Å; M40-L44 HydrophobicContact CG-CD1 4.1Å; M40-L44 WeakPolarHBondContact O-CB 3.31Å; M40-L44 VanDerWaalsContact O-CG 3.31Å; M40-L44 WeakPolarHBondContact O-CG 3.37Å; M40-L44 PolarHBondContact O-N 2.89Å; S41-L44 PolarHBondContact O-N 2.89Å; E42-L44 VanDerWaalsContact C-N 3.33Å; E42-L44 PolarHBondContact O-N 2.82Å; L44-K47 PolarHBondContact O-N 2.92Å; L44-N48 VanDerWaalsContact O-CB 3.27Å; L44-N48 WeakPolarHBondContact O-CB 3.43Å; L44-N48 PolarHBondContact O-N 2.92Å; L44-N48 PolarHBondContact O-ND2 3.4Å
45	L	93.5	Very high	94.2	Very high	108 Å²	108	103.8 Å²	103.8	57%	0.565	52%	0.522	S	S	*	.	H	α-helix	trans	-62.5	-48.5	177.4	-176.4	65.3	0	0	0	111.1	S41 E42 K47 N48 I49	S41-L45 WeakPolarHBondContact O-CB 3.45Å; S41-L45 PolarHBondContact O-N 2.86Å; E42-L45 PolarHBondContact O-N 3.4Å; L45-K47 PolarHBondContact O-N 3.33Å; L45-N48 PolarHBondContact O-N 3.47Å; L45-I49 HydrophobicContact CD1-CD1 4.18Å; L45-I49 HydrophobicContact CG-CD1 3.93Å; L45-I49 VanDerWaalsContact O-CG1 3.27Å; L45-I49 WeakPolarHBondContact O-CG1 3.27Å; L45-I49 PolarHBondContact O-N 3.47Å
46	E	93.2	Very high	94	Very high	122 Å²	122	103.7 Å²	103.7	57%	0.57	52%	0.522	S	S	*	.	H	α-helix	trans	-59.3	-46.8	177	-73.4	-174.7	162.2	0	0	112.1	E42 N48 I49 L50	E42-E46 WeakPolarHBondContact O-CG 3.29Å; E42-E46 PolarHBondContact O-N 2.94Å; E46-N48 VanDerWaalsContact C-N 3.35Å; E46-N48 PolarHBondContact O-N 3.28Å; E46-I49 PolarHBondContact O-N 3.22Å; E46-L50 WeakPolarHBondContact O-CB 3.31Å; E46-L50 PolarHBondContact O-N 3.29Å
47	K	93.7	Very high	93.9	Very high	135 Å²	135	107.1 Å²	107.1	59%	0.587	53%	0.527	S	S	*	.	H	α-helix	trans	-61.9	-42.1	177.1	-76.7	175.4	-179.7	175.5	0	111.9	Q43 L44 L45 L50 F51	Q43-K47 VanDerWaalsContact O-CB 3.31Å; Q43-K47 WeakPolarHBondContact O-CB 3.31Å; Q43-K47 WeakPolarHBondContact O-CG 3.41Å; Q43-K47 PolarHBondContact O-N 3.17Å; L44-K47 PolarHBondContact O-N 2.92Å; L45-K47 PolarHBondContact O-N 3.33Å; K47-L50 PolarHBondContact O-N 2.93Å; K47-F51 VanDerWaalsContact O-CB 3.31Å; K47-F51 WeakPolarHBondContact O-CB 3.27Å; K47-F51 PolarHBondContact O-N 3.28Å
48	N	92.7	Very high	93.8	Very high	102 Å²	102	107.3 Å²	107.3	55%	0.545	53%	0.53	S	S	.	.	H	α-helix	trans	-65.2	-42.1	178.1	-74.2	-19.9	0	0	0	111.6	L44 L45 E46 F51 L52	L44-N48 VanDerWaalsContact O-CB 3.27Å; L44-N48 WeakPolarHBondContact O-CB 3.43Å; L44-N48 PolarHBondContact O-N 2.92Å; L44-N48 PolarHBondContact O-ND2 3.4Å; L45-N48 PolarHBondContact O-N 3.47Å; E46-N48 VanDerWaalsContact C-N 3.35Å; E46-N48 PolarHBondContact O-N 3.28Å; N48-F51 PolarHBondContact O-N 2.89Å; N48-L52 VanDerWaalsContact O-CB 3.26Å; N48-L52 WeakPolarHBondContact O-CB 3.41Å; N48-L52 PolarHBondContact O-N 3.48Å
49	I	93.5	Very high	93.8	Very high	103 Å²	103	107.5 Å²	107.5	53%	0.528	53%	0.53	S	S	.	.	H	α-helix	trans	-63.2	-45.4	176.1	-68.9	166.3	0	0	0	110.5	L45 E46 L52 K53	L45-I49 HydrophobicContact CD1-CD1 4.18Å; L45-I49 HydrophobicContact CG-CD1 3.93Å; L45-I49 VanDerWaalsContact O-CG1 3.27Å; L45-I49 WeakPolarHBondContact O-CG1 3.27Å; L45-I49 PolarHBondContact O-N 3.47Å; E46-I49 PolarHBondContact O-N 3.22Å; I49-L52 PolarHBondContact O-N 2.87Å; I49-K53 WeakPolarHBondContact O-CB 3.26Å; I49-K53 PolarHBondContact O-N 3.46Å
50	L	93.1	Very high	93.8	Very high	116 Å²	116	109.5 Å²	109.5	61%	0.607	54%	0.538	S	S	*	.	H	α-helix	trans	-62.1	-47.6	177.9	-171.4	80.7	0	0	0	111.3	E46 K47 L52 K53 S54	E46-L50 WeakPolarHBondContact O-CB 3.31Å; E46-L50 PolarHBondContact O-N 3.29Å; K47-L50 PolarHBondContact O-N 2.93Å; L50-L52 VanDerWaalsContact C-N 3.34Å; L50-L52 PolarHBondContact O-N 2.96Å; L50-K53 PolarHBondContact O-N 3.14Å; L50-S54 PolarHBondContact O-N 2.86Å; L50-S54 PolarHBondContact O-OG 3.41Å
51	F	94.1	Very high	93.7	Very high	145 Å²	145	106.4 Å²	106.4	64%	0.636	53%	0.527	S	S	*	.	H	α-helix	trans	-58.9	-46.6	177.5	178.4	-97.5	0	0	0	111.2	K47 N48 K53 S54 F55	K47-F51 VanDerWaalsContact O-CB 3.31Å; K47-F51 WeakPolarHBondContact O-CB 3.27Å; K47-F51 PolarHBondContact O-N 3.28Å; N48-F51 PolarHBondContact O-N 2.89Å; F51-K53 VanDerWaalsContact C-N 3.33Å; F51-K53 PolarHBondContact O-N 3.4Å; F51-S54 PolarHBondContact O-N 2.92Å; F51-F55 WeakPolarHBondContact O-CB 3.47Å; F51-F55 PolarHBondContact O-N 3.25Å
52	L	94.2	Very high	93.7	Very high	95 Å²	95	108.5 Å²	108.5	50%	0.497	53%	0.534	S	S	.	.	H	α-helix	trans	-61	-43.4	179	-169.5	64.7	0	0	0	111.3	N48 I49 L50 F55 H56	N48-L52 VanDerWaalsContact O-CB 3.26Å; N48-L52 WeakPolarHBondContact O-CB 3.41Å; N48-L52 PolarHBondContact O-N 3.48Å; I49-L52 PolarHBondContact O-N 2.87Å; L50-L52 VanDerWaalsContact C-N 3.34Å; L50-L52 PolarHBondContact O-N 2.96Å; L52-F55 PolarHBondContact O-N 2.95Å; L52-H56 VanDerWaalsContact CD1-CE1 3.43Å; L52-H56 WeakPolarHBondContact CD1-CE1 3.26Å; L52-H56 WeakPolarHBondContact O-CB 3.43Å; L52-H56 PolarHBondContact O-N 3.41Å; L52-H56 PolarHBondContact O-ND1 2.92Å
53	K	93.1	Very high	93.8	Very high	158 Å²	158	106.6 Å²	106.6	69%	0.687	53%	0.527	S	S	*	.	H	α-helix	trans	-63.3	-45.4	177.4	-174.1	177.9	179.2	-179.5	0	111.8	I49 L50 F51 H56 F57	I49-K53 WeakPolarHBondContact O-CB 3.26Å; I49-K53 PolarHBondContact O-N 3.46Å; L50-K53 PolarHBondContact O-N 3.14Å; F51-K53 VanDerWaalsContact C-N 3.33Å; F51-K53 PolarHBondContact O-N 3.4Å; K53-H56 PolarHBondContact O-N 2.9Å; K53-F57 WeakPolarHBondContact O-CB 3.49Å; K53-F57 PolarHBondContact O-N 3.46Å
54	S	93.9	Very high	93.8	Very high	67 Å²	67	109.4 Å²	109.4	47%	0.469	53%	0.534	S	S	.	.	H	α-helix	trans	-62.5	-45.6	177.1	-64.8	0	0	0	0	111.7	L50 F51 H56 F57 E58	L50-S54 PolarHBondContact O-N 2.86Å; L50-S54 PolarHBondContact O-OG 3.41Å; F51-S54 PolarHBondContact O-N 2.92Å; S54-H56 PolarHBondContact O-N 3.48Å; S54-F57 PolarHBondContact O-N 3.47Å; S54-E58 WeakPolarHBondContact O-CB 3.34Å; S54-E58 PolarHBondContact O-N 3.46Å
55	F	94.8	Very high	93.9	Very high	105 Å²	105	110 Å²	110	46%	0.461	54%	0.538	S	S	.	.	H	α-helix	trans	-61	-44.9	176.5	178.8	-99.8	0	0	0	112.1	F51 L52 F57 E58 L59	F51-F55 WeakPolarHBondContact O-CB 3.47Å; F51-F55 PolarHBondContact O-N 3.25Å; L52-F55 PolarHBondContact O-N 2.95Å; F55-F57 VanDerWaalsContact C-N 3.34Å; F55-F57 PolarHBondContact O-N 2.87Å; F55-E58 PolarHBondContact O-N 3.5Å; F55-L59 WeakPolarHBondContact O-CB 3.43Å; F55-L59 PolarHBondContact O-N 3.37Å
56	H	91.8	Very high	93.9	Very high	95 Å²	95	108.1 Å²	108.1	44%	0.44	53%	0.533	S	S	.	.	H	α-helix	trans	-61.5	-42.5	175.9	-82.6	78.5	0	0	0	111.9	L52 K53 S54 L59 L60	L52-H56 VanDerWaalsContact CD1-CE1 3.43Å; L52-H56 WeakPolarHBondContact CD1-CE1 3.26Å; L52-H56 WeakPolarHBondContact O-CB 3.43Å; L52-H56 PolarHBondContact O-N 3.41Å; L52-H56 PolarHBondContact O-ND1 2.92Å; K53-H56 PolarHBondContact O-N 2.9Å; S54-H56 PolarHBondContact O-N 3.48Å; H56-L59 PolarHBondContact O-N 2.93Å; H56-L60 WeakPolarHBondContact O-CB 3.38Å; H56-L60 VanDerWaalsContact O-CG 3.23Å; H56-L60 WeakPolarHBondContact O-CG 3.23Å; H56-L60 PolarHBondContact O-N 2.77Å
57	F	94.4	Very high	94	Very high	152 Å²	152	108.5 Å²	108.5	67%	0.667	53%	0.533	S	S	*	.	H	α-helix	trans	-63.3	-45.7	177.4	178.9	-98	0	0	0	111.7	K53 S54 F55 L59 L60 S61	K53-F57 WeakPolarHBondContact O-CB 3.49Å; K53-F57 PolarHBondContact O-N 3.46Å; S54-F57 PolarHBondContact O-N 3.47Å; F55-F57 VanDerWaalsContact C-N 3.34Å; F55-F57 PolarHBondContact O-N 2.87Å; F57-L59 PolarHBondContact O-N 3.39Å; F57-L60 PolarHBondContact O-N 2.86Å; F57-S61 VanDerWaalsContact O-CB 3.26Å; F57-S61 WeakPolarHBondContact O-CB 3.35Å; F57-S61 PolarHBondContact O-N 3.37Å
58	E	94.4	Very high	94.1	Very high	135 Å²	135	106.3 Å²	106.3	63%	0.631	53%	0.528	S	S	*	.	H	α-helix	trans	-61.5	-44.4	177.5	-172.6	174.6	-179.1	0	0	111.5	S54 F55 S61 N62	S54-E58 WeakPolarHBondContact O-CB 3.34Å; S54-E58 PolarHBondContact O-N 3.46Å; F55-E58 PolarHBondContact O-N 3.5Å; E58-S61 PolarHBondContact O-N 3.46Å; E58-N62 VanDerWaalsContact O-CB 3.31Å; E58-N62 WeakPolarHBondContact O-CB 3.31Å; E58-N62 PolarHBondContact O-N 2.91Å
59	L	94.3	Very high	94.2	Very high	82 Å²	82	109 Å²	109	43%	0.429	53%	0.534	S	S	.	.	H	α-helix	trans	-61.3	-48	176.6	-177	66.3	0	0	0	111.7	F55 H56 F57 N62 I63	F55-L59 WeakPolarHBondContact O-CB 3.43Å; F55-L59 PolarHBondContact O-N 3.37Å; H56-L59 PolarHBondContact O-N 2.93Å; F57-L59 PolarHBondContact O-N 3.39Å; L59-N62 PolarHBondContact O-N 3.21Å; L59-I63 HydrophobicContact CD1-CD1 4.29Å; L59-I63 HydrophobicContact CG-CD1 4Å; L59-I63 VanDerWaalsContact O-CG1 3.26Å; L59-I63 WeakPolarHBondContact O-CG1 3.34Å; L59-I63 PolarHBondContact O-N 3.48Å
60	L	94.1	Very high	94.2	Very high	114 Å²	114	110.5 Å²	110.5	60%	0.597	53%	0.534	S	S	*	.	H	α-helix	trans	-63.7	-41.9	178.6	-72.7	173	0	0	0	111.8	H56 F57 I63 Y64	H56-L60 WeakPolarHBondContact O-CB 3.38Å; H56-L60 VanDerWaalsContact O-CG 3.23Å; H56-L60 WeakPolarHBondContact O-CG 3.23Å; H56-L60 PolarHBondContact O-N 2.77Å; F57-L60 PolarHBondContact O-N 2.86Å; L60-I63 PolarHBondContact O-N 2.89Å; L60-Y64 WeakPolarHBondContact O-CB 3.39Å; L60-Y64 PolarHBondContact O-N 2.93Å
61	S	93.8	Very high	94.3	Very high	48 Å²	48	111.2 Å²	111.2	34%	0.336	53%	0.532	S	S	.	.	H	α-helix	trans	-60.8	-46.4	175.4	-176.5	0	0	0	0	111.1	F57 E58 I63 Y64 L65	F57-S61 VanDerWaalsContact O-CB 3.26Å; F57-S61 WeakPolarHBondContact O-CB 3.35Å; F57-S61 PolarHBondContact O-N 3.37Å; E58-S61 PolarHBondContact O-N 3.46Å; S61-I63 PolarHBondContact O-N 2.85Å; S61-Y64 PolarHBondContact O-N 3.43Å; S61-L65 WeakPolarHBondContact O-CB 3.34Å; S61-L65 WeakPolarHBondContact O-CG 3.46Å; S61-L65 PolarHBondContact O-N 2.83Å
62	N	94.7	Very high	94.3	Very high	96 Å²	96	107 Å²	107	51%	0.513	53%	0.525	S	S	.	.	H	α-helix	trans	-63.2	-43.3	178.2	-168.2	-8.8	0	0	0	112	E58 L59 Y64 L65 S66	E58-N62 VanDerWaalsContact O-CB 3.31Å; E58-N62 WeakPolarHBondContact O-CB 3.31Å; E58-N62 PolarHBondContact O-N 2.91Å; L59-N62 PolarHBondContact O-N 3.21Å; N62-Y64 VanDerWaalsContact C-N 3.33Å; N62-Y64 PolarHBondContact O-N 3.34Å; N62-L65 PolarHBondContact O-N 3.43Å; N62-S66 VanDerWaalsContact O-CB 3.27Å; N62-S66 WeakPolarHBondContact O-CB 3.26Å; N62-S66 PolarHBondContact O-N 3.23Å; N62-S66 PolarHBondContact O-OG 3.25Å; N62-S66 PolarHBondContact OD1-OG 3.46Å
63	I	94.9	Very high	94.3	Very high	78 Å²	78	105.9 Å²	105.9	40%	0.4	52%	0.519	S	S	.	.	H	α-helix	trans	-60.7	-44.1	174.2	-69.3	166	0	0	0	110.7	L59 L60 S61 S66 K67	L59-I63 HydrophobicContact CD1-CD1 4.29Å; L59-I63 HydrophobicContact CG-CD1 4Å; L59-I63 VanDerWaalsContact O-CG1 3.26Å; L59-I63 WeakPolarHBondContact O-CG1 3.34Å; L59-I63 PolarHBondContact O-N 3.48Å; L60-I63 PolarHBondContact O-N 2.89Å; S61-I63 PolarHBondContact O-N 2.85Å; I63-S66 PolarHBondContact O-N 3.45Å; I63-K67 HydrophobicContact CG2-CD 4.49Å; I63-K67 WeakPolarHBondContact O-CG 3.44Å; I63-K67 PolarHBondContact O-N 3.41Å
64	Y	94.7	Very high	94.3	Very high	157 Å²	157	103.4 Å²	103.4	62%	0.616	51%	0.505	S	S	*	.	H	α-helix	trans	-63.1	-48.5	179.2	-179.2	-95.6	0	0	0	111.6	L60 S61 N62 S66 K67 L68	L60-Y64 WeakPolarHBondContact O-CB 3.39Å; L60-Y64 PolarHBondContact O-N 2.93Å; S61-Y64 PolarHBondContact O-N 3.43Å; N62-Y64 VanDerWaalsContact C-N 3.33Å; N62-Y64 PolarHBondContact O-N 3.34Å; Y64-S66 VanDerWaalsContact C-N 3.34Å; Y64-S66 PolarHBondContact O-N 2.86Å; Y64-K67 PolarHBondContact O-N 3.45Å; Y64-L68 WeakPolarHBondContact O-CB 3.36Å; Y64-L68 PolarHBondContact O-N 3.45Å
65	L	94.7	Very high	94.3	Very high	97 Å²	97	106.2 Å²	106.2	51%	0.508	51%	0.509	S	S	.	.	H	α-helix	trans	-62.1	-41.1	177.3	-71.6	174.9	0	0	0	111.9	S61 N62 K67 L68 F69	S61-L65 WeakPolarHBondContact O-CB 3.34Å; S61-L65 WeakPolarHBondContact O-CG 3.46Å; S61-L65 PolarHBondContact O-N 2.83Å; N62-L65 PolarHBondContact O-N 3.43Å; L65-K67 VanDerWaalsContact C-N 3.33Å; L65-K67 PolarHBondContact O-N 2.84Å; L65-L68 PolarHBondContact O-N 3.49Å; L65-F69 WeakPolarHBondContact O-CB 3.27Å; L65-F69 PolarHBondContact O-N 2.88Å
66	S	94.9	Very high	94.2	Very high	68 Å²	68	109 Å²	109	48%	0.476	52%	0.517	S	S	.	.	H	α-helix	trans	-60.5	-43.3	176.2	-65.8	0	0	0	0	111.6	N62 I63 Y64 W70	N62-S66 VanDerWaalsContact O-CB 3.27Å; N62-S66 WeakPolarHBondContact O-CB 3.26Å; N62-S66 PolarHBondContact O-N 3.23Å; N62-S66 PolarHBondContact O-OG 3.25Å; N62-S66 PolarHBondContact OD1-OG 3.46Å; I63-S66 PolarHBondContact O-N 3.45Å; Y64-S66 VanDerWaalsContact C-N 3.34Å; Y64-S66 PolarHBondContact O-N 2.86Å; S66-W70 WeakPolarHBondContact O-CB 3.47Å; S66-W70 PolarHBondContact O-N 2.86Å
67	K	94.9	Very high	94.3	Very high	130 Å²	130	108.6 Å²	108.6	57%	0.565	52%	0.515	S	S	*	.	H	α-helix	trans	-64.3	-45.9	174	-74.6	-179.3	178.4	-177.8	0	111.5	I63 Y64 L65 F69 W70 F71	I63-K67 HydrophobicContact CG2-CD 4.49Å; I63-K67 WeakPolarHBondContact O-CG 3.44Å; I63-K67 PolarHBondContact O-N 3.41Å; Y64-K67 PolarHBondContact O-N 3.45Å; L65-K67 VanDerWaalsContact C-N 3.33Å; L65-K67 PolarHBondContact O-N 2.84Å; K67-F69 VanDerWaalsContact C-N 3.33Å; K67-F69 PolarHBondContact O-N 2.89Å; K67-W70 PolarHBondContact O-N 3.31Å; K67-F71 VanDerWaalsContact O-CD2 3.22Å; K67-F71 WeakPolarHBondContact O-CD2 3.22Å; K67-F71 PolarHBondContact O-N 3.03Å
68	L	95	Very high	94.3	Very high	90 Å²	90	108.2 Å²	108.2	47%	0.471	51%	0.51	S	S	.	.	H	α-helix	trans	-59.2	-45.3	179.1	-175.3	67.6	0	0	0	111.3	Y64 L65 W70 F71 A72	Y64-L68 WeakPolarHBondContact O-CB 3.36Å; Y64-L68 PolarHBondContact O-N 3.45Å; L65-L68 PolarHBondContact O-N 3.49Å; L68-W70 PolarHBondContact O-N 2.91Å; L68-F71 PolarHBondContact O-N 3.23Å; L68-A72 WeakPolarHBondContact O-CB 3.43Å; L68-A72 PolarHBondContact O-N 3.04Å
69	F	94.6	Very high	94.2	Very high	157 Å²	157	105.5 Å²	105.5	69%	0.689	50%	0.497	S	S	*	.	H	α-helix	trans	-62.1	-43.4	176.9	-171.7	-95.7	0	0	0	111.7	L65 K67 F71 A72 N73	L65-F69 WeakPolarHBondContact O-CB 3.27Å; L65-F69 PolarHBondContact O-N 2.88Å; K67-F69 VanDerWaalsContact C-N 3.33Å; K67-F69 PolarHBondContact O-N 2.89Å; F69-F71 PolarHBondContact O-N 3.42Å; F69-A72 PolarHBondContact O-N 3.5Å; F69-N73 VanDerWaalsContact O-CB 3.27Å; F69-N73 WeakPolarHBondContact O-CB 3.27Å; F69-N73 PolarHBondContact O-N 3.44Å
70	W	95.2	Very high	94.1	Very high	136 Å²	136	105.7 Å²	105.7	52%	0.515	50%	0.498	S	S	.	.	H	α-helix	trans	-60.8	-45.3	175.5	-178.5	87.7	0	0	0	112.3	S66 K67 L68 N73 R74	S66-W70 WeakPolarHBondContact O-CB 3.47Å; S66-W70 PolarHBondContact O-N 2.86Å; K67-W70 PolarHBondContact O-N 3.31Å; L68-W70 PolarHBondContact O-N 2.91Å; W70-N73 PolarHBondContact O-N 2.96Å; W70-R74 HydrophobicContact CD2-CG 4.18Å; W70-R74 HydrophobicContact CE3-CG 4.42Å; W70-R74 HydrophobicContact CH2-CG 4.15Å; W70-R74 HydrophobicContact CZ2-CG 3.88Å; W70-R74 HydrophobicContact CZ3-CG 4.4Å; W70-R74 WeakPolarHBondContact O-CB 3.47Å; W70-R74 PolarHBondContact O-N 3.36Å
71	F	94.5	Very high	94	Very high	130 Å²	130	106.4 Å²	106.4	57%	0.57	50%	0.497	S	S	*	.	H	α-helix	trans	-64.3	-45.4	177.1	-86.7	-70.9	0	0	0	112.1	K67 L68 F69 N73 R74 F75	K67-F71 VanDerWaalsContact O-CD2 3.22Å; K67-F71 WeakPolarHBondContact O-CD2 3.22Å; K67-F71 PolarHBondContact O-N 3.03Å; L68-F71 PolarHBondContact O-N 3.23Å; F69-F71 PolarHBondContact O-N 3.42Å; F71-N73 VanDerWaalsContact C-N 3.33Å; F71-N73 PolarHBondContact O-N 3.4Å; F71-R74 PolarHBondContact O-N 3.22Å; F71-F75 WeakPolarHBondContact O-CB 3.45Å; F71-F75 PolarHBondContact O-N 3.01Å
72	A	94.6	Very high	93.8	Very high	58 Å²	58	109.2 Å²	109.2	48%	0.479	51%	0.507	S	S	.	.	H	α-helix	trans	-60.2	-44.4	177	0	0	0	0	0	111.3	L68 F69 F75 W76	L68-A72 WeakPolarHBondContact O-CB 3.43Å; L68-A72 PolarHBondContact O-N 3.04Å; F69-A72 PolarHBondContact O-N 3.5Å; A72-F75 PolarHBondContact O-N 3.39Å; A72-W76 WeakPolarHBondContact O-CB 3.33Å; A72-W76 PolarHBondContact O-N 3.46Å
73	N	94.2	Very high	93.5	Very high	70 Å²	70	111 Å²	111	37%	0.374	52%	0.515	S	S	.	.	H	α-helix	trans	-62.9	-45.3	176.4	-178.4	54.8	0	0	0	111.9	F69 W70 F71 W76 Q77	F69-N73 VanDerWaalsContact O-CB 3.27Å; F69-N73 WeakPolarHBondContact O-CB 3.27Å; F69-N73 PolarHBondContact O-N 3.44Å; W70-N73 PolarHBondContact O-N 2.96Å; F71-N73 VanDerWaalsContact C-N 3.33Å; F71-N73 PolarHBondContact O-N 3.4Å; N73-W76 PolarHBondContact O-N 3.44Å; N73-Q77 WeakPolarHBondContact O-CG 3.48Å; N73-Q77 PolarHBondContact O-N 3.2Å
74	R	92.9	Very high	93	Very high	106 Å²	106	112 Å²	112	40%	0.4	53%	0.53	S	S	.	.	H	α-helix	trans	-60.9	-47.1	175.4	-83.3	-63.2	-164.5	179.4	3.8	111.9	W70 F71 W76 Q77 Y78	W70-R74 HydrophobicContact CD2-CG 4.18Å; W70-R74 HydrophobicContact CE3-CG 4.42Å; W70-R74 HydrophobicContact CH2-CG 4.15Å; W70-R74 HydrophobicContact CZ2-CG 3.88Å; W70-R74 HydrophobicContact CZ3-CG 4.4Å; W70-R74 WeakPolarHBondContact O-CB 3.47Å; W70-R74 PolarHBondContact O-N 3.36Å; F71-R74 PolarHBondContact O-N 3.22Å; R74-W76 VanDerWaalsContact C-N 3.3Å; R74-W76 PolarHBondContact O-N 3Å; R74-Q77 PolarHBondContact O-N 3.48Å; R74-Y78 HydrophobicContact CB-CE2 4.5Å; R74-Y78 WeakPolarHBondContact O-CD2 3.07Å; R74-Y78 PolarHBondContact O-N 3.02Å
75	F	93.6	Very high	92	Very high	127 Å²	127	112.9 Å²	112.9	56%	0.557	54%	0.543	S	S	*	.	H	α-helix	trans	-56.8	-46	177.7	178.6	-99	0	0	0	111.3	F71 A72 Q77 Y78 Q79	F71-F75 WeakPolarHBondContact O-CB 3.45Å; F71-F75 PolarHBondContact O-N 3.01Å; A72-F75 PolarHBondContact O-N 3.39Å; F75-Q77 PolarHBondContact O-N 2.83Å; F75-Y78 PolarHBondContact O-N 3.3Å; F75-Q79 HydrophobicContact CD1-CG 4.25Å; F75-Q79 HydrophobicContact CE1-CG 3.83Å; F75-Q79 HydrophobicContact CE2-CG 4.49Å; F75-Q79 HydrophobicContact CZ-CG 3.97Å; F75-Q79 WeakPolarHBondContact O-CG 3.35Å; F75-Q79 PolarHBondContact O-N 2.9Å
76	W	92.8	Very high	91.9	Very high	164 Å²	164	113.7 Å²	113.7	62%	0.621	55%	0.545	S	S	*	.	H	α-helix	trans	-61.7	-43.7	177.4	-170.7	-103.1	0	0	0	112.8	A72 N73 R74 Y78 Q79 L80	A72-W76 WeakPolarHBondContact O-CB 3.33Å; A72-W76 PolarHBondContact O-N 3.46Å; N73-W76 PolarHBondContact O-N 3.44Å; R74-W76 VanDerWaalsContact C-N 3.3Å; R74-W76 PolarHBondContact O-N 3Å; W76-Y78 VanDerWaalsContact C-N 3.31Å; W76-Y78 PolarHBondContact O-N 3.32Å; W76-Q79 PolarHBondContact O-N 3.23Å; W76-L80 PolarHBondContact O-N 3.02Å
77	Q	94	Very high	91.7	Very high	85 Å²	85	116.1 Å²	116.1	40%	0.397	55%	0.549	S	S	.	.	H	α-helix	trans	-59.8	-40.4	175.1	-71.8	175.7	-10.3	0	0	112.3	N73 R74 F75 L80 F81	N73-Q77 WeakPolarHBondContact O-CG 3.48Å; N73-Q77 PolarHBondContact O-N 3.2Å; R74-Q77 PolarHBondContact O-N 3.48Å; F75-Q77 PolarHBondContact O-N 2.83Å; Q77-L80 PolarHBondContact O-N 3.44Å; Q77-F81 WeakPolarHBondContact O-CB 3.34Å; Q77-F81 PolarHBondContact O-N 3.03Å
78	Y	93.3	Very high	91.6	Very high	145 Å²	145	115.3 Å²	115.3	57%	0.569	55%	0.548	S	S	*	.	H	α-helix	trans	-64.6	-41.1	174.9	-78.9	-67.9	0	0	0	112.4	R74 F75 W76 F81 L82	R74-Y78 HydrophobicContact CB-CE2 4.5Å; R74-Y78 WeakPolarHBondContact O-CD2 3.07Å; R74-Y78 PolarHBondContact O-N 3.02Å; F75-Y78 PolarHBondContact O-N 3.3Å; W76-Y78 VanDerWaalsContact C-N 3.31Å; W76-Y78 PolarHBondContact O-N 3.32Å; Y78-F81 PolarHBondContact O-N 3Å; Y78-L82 WeakPolarHBondContact O-CG 3.39Å; Y78-L82 PolarHBondContact O-N 3.4Å
79	Q	92.3	Very high	91.4	Very high	77 Å²	77	116.8 Å²	116.8	36%	0.36	55%	0.552	S	S	.	*	H	α-helix	trans	-62.3	-45.1	176.3	-68	-62	-36.2	0	0	111.8	F75 W76 F81 L82 I83	F75-Q79 HydrophobicContact CD1-CG 4.25Å; F75-Q79 HydrophobicContact CE1-CG 3.83Å; F75-Q79 HydrophobicContact CE2-CG 4.49Å; F75-Q79 HydrophobicContact CZ-CG 3.97Å; F75-Q79 WeakPolarHBondContact O-CG 3.35Å; F75-Q79 PolarHBondContact O-N 2.9Å; W76-Q79 PolarHBondContact O-N 3.23Å; Q79-F81 VanDerWaalsContact C-N 3.31Å; Q79-F81 PolarHBondContact O-N 3.3Å; Q79-L82 PolarHBondContact O-N 3.4Å; Q79-I83 WeakPolarHBondContact O-CG1 3.48Å; Q79-I83 PolarHBondContact O-N 2.82Å; Q79-I83 VanDerWaalsContact O-N 3.15Å
80	L	92.3	Very high	91.2	Very high	86 Å²	86	114.3 Å²	114.3	45%	0.45	54%	0.544	S	S	.	.	H	α-helix	trans	-61.7	-39.4	176.1	-71.8	173.4	0	0	0	112.4	W76 Q77 I83 S84	W76-L80 PolarHBondContact O-N 3.02Å; Q77-L80 PolarHBondContact O-N 3.44Å; L80-I83 PolarHBondContact O-N 3.47Å; L80-S84 PolarHBondContact O-N 3.15Å; L80-S84 PolarHBondContact O-OG 3.42Å
81	F	91.2	Very high	90.9	Very high	129 Å²	129	112.8 Å²	112.8	57%	0.566	55%	0.546	S	S	*	.	H	α-helix	trans	-63.3	-44.2	176.3	179.5	-101.4	0	0	0	111.9	Q77 Y78 Q79 I83 S84 I85	Q77-F81 WeakPolarHBondContact O-CB 3.34Å; Q77-F81 PolarHBondContact O-N 3.03Å; Y78-F81 PolarHBondContact O-N 3Å; Q79-F81 VanDerWaalsContact C-N 3.31Å; Q79-F81 PolarHBondContact O-N 3.3Å; F81-I83 VanDerWaalsContact C-N 3.31Å; F81-I83 PolarHBondContact O-N 3.29Å; F81-S84 PolarHBondContact O-N 3.14Å; F81-S84 VanDerWaalsContact O-N 3.14Å; F81-I85 HydrophobicContact CD1-CD1 4.25Å; F81-I85 HydrophobicContact CE1-CD1 3.63Å; F81-I85 HydrophobicContact CZ-CD1 3.8Å
82	L	90.5	Very high	90.6	Very high	107 Å²	107	111.6 Å²	111.6	56%	0.56	54%	0.544	S	S	*	.	H	α-helix	trans	-64.7	-32	178.8	-72.6	171.3	0	0	0	113.3	Y78 Q79 S84	Y78-L82 WeakPolarHBondContact O-CG 3.39Å; Y78-L82 PolarHBondContact O-N 3.4Å; Q79-L82 PolarHBondContact O-N 3.4Å; L82-S84 VanDerWaalsContact C-N 3.28Å
83	I	88.5	Confident	90.3	Very high	133 Å²	133	115.7 Å²	115.7	68%	0.682	55%	0.549	S	S	*	.	H	α-helix	trans	-75.1	-20.6	176.8	-65.1	163.6	0	0	0	111.7	Q79 L80 F81	Q79-I83 WeakPolarHBondContact O-CG1 3.48Å; Q79-I83 PolarHBondContact O-N 2.82Å; Q79-I83 VanDerWaalsContact O-N 3.15Å; L80-I83 PolarHBondContact O-N 3.47Å; F81-I83 VanDerWaalsContact C-N 3.31Å; F81-I83 PolarHBondContact O-N 3.29Å
84	S	83.3	Confident	90	Very high	101 Å²	101	119.5 Å²	119.5	71%	0.706	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.6	-4.6	-176.2	-56.9	0	0	0	0	114.2	L80 F81 L82	L80-S84 PolarHBondContact O-N 3.15Å; L80-S84 PolarHBondContact O-OG 3.42Å; F81-S84 PolarHBondContact O-N 3.14Å; F81-S84 VanDerWaalsContact O-N 3.14Å; L82-S84 VanDerWaalsContact C-N 3.28Å
85	I	75.4	Confident	89.7	Confident	174 Å²	174	120.7 Å²	120.7	89%	0.892	58%	0.578	S	S	*	*			trans	-102.6	0	178.3	-62.4	174	0	0	0	108.8	F81	F81-I85 HydrophobicContact CD1-CD1 4.25Å; F81-I85 HydrophobicContact CE1-CD1 3.63Å; F81-I85 HydrophobicContact CZ-CD1 3.8Å

Retrieved 85 of 85 residues in 53 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).