A0A5K4F9G1_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F9G1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 60 aa.

						>A0A5K4F9G1_SCHMA|A0A5K4F9G1
MLRHRRKDIEILEKYKKLNNIPSLKQIIFGTLKTSNNSQNKWLYGPITHLSQSNPSHSAF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.3	Low	68.9	Low	227 Å²	227	147.2 Å²	147.2	100%	1.118	66%	0.658	S	S	*	*				0	-20.5	0	-77.9	172	174.5	0	0	115.4	R3	M1-R3 PolarHBondContact O-N 2.92Å
2	L	58.3	Low	69.5	Low	136 Å²	136	137 Å²	137	71%	0.712	61%	0.614	S	S	*	*	H	α-helix	trans	-69.2	-26	-178.7	-104.2	85.6	0	0	0	116.7	H4 R5 R6	L2-H4 PolarHBondContact O-N 3.47Å; L2-R5 PolarHBondContact O-N 2.91Å; L2-R6 PolarHBondContact O-N 3.02Å
3	R	57.9	Low	70.4	Confident	221 Å²	221	134.8 Å²	134.8	83%	0.834	61%	0.606	S	S	*	*	H	α-helix	trans	-68	-33.3	-171.6	-67.3	-170	-169.8	-159.6	3.4	113.9	M1	M1-R3 PolarHBondContact O-N 2.92Å
4	H	55.8	Low	71.3	Confident	146 Å²	146	135.3 Å²	135.3	68%	0.676	61%	0.607	S	S	*	*	H	α-helix	trans	-68.9	-42.1	178.3	-72.9	78.1	0	0	0	110.7	L2 R6 K7 D8	L2-H4 PolarHBondContact O-N 3.47Å; H4-R6 VanDerWaalsContact C-N 3.26Å; H4-R6 PolarHBondContact O-N 3.13Å; H4-K7 PolarHBondContact O-N 2.99Å; H4-K7 VanDerWaalsContact O-N 3.12Å; H4-D8 PolarHBondContact O-N 3.5Å; H4-D8 VanDerWaalsContact O-N 3.14Å
5	R	65.5	Low	71.6	Confident	189 Å²	189	133.1 Å²	133.1	71%	0.713	59%	0.593	S	S	*	*	H	α-helix	trans	-58.6	-34.3	178.7	-130.8	-176.6	-173.5	176.8	2.2	113.5	L2 I9	L2-R5 PolarHBondContact O-N 2.91Å; R5-I9 WeakPolarHBondContact O-CD1 3.43Å; R5-I9 VanDerWaalsContact O-CG1 3.24Å; R5-I9 WeakPolarHBondContact O-CG1 3.26Å; R5-I9 PolarHBondContact O-N 3.33Å; R5-I9 VanDerWaalsContact O-N 3.15Å
6	R	74.1	Confident	72	Confident	182 Å²	182	128.9 Å²	128.9	69%	0.687	57%	0.574	S	S	*	*	H	α-helix	trans	-66.2	-44.7	176.6	-83.9	-175.2	164.7	150.7	-2.7	112.6	L2 H4 D8 I9 E10	L2-R6 PolarHBondContact O-N 3.02Å; H4-R6 VanDerWaalsContact C-N 3.26Å; H4-R6 PolarHBondContact O-N 3.13Å; R6-D8 VanDerWaalsContact C-N 3.31Å; R6-D8 PolarHBondContact O-N 3.19Å; R6-I9 PolarHBondContact O-N 2.72Å; R6-E10 PolarHBondContact O-N 2.82Å
7	K	77.2	Confident	72.6	Confident	143 Å²	143	131.1 Å²	131.1	62%	0.622	58%	0.582	S	S	*	*	H	α-helix	trans	-62.7	-40.5	176.8	-77.1	-174.1	174.4	-176.2	0	111.5	H4 I9 E10 I11	H4-K7 PolarHBondContact O-N 2.99Å; H4-K7 VanDerWaalsContact O-N 3.12Å; K7-I9 VanDerWaalsContact C-N 3.31Å; K7-I9 PolarHBondContact O-N 3.18Å; K7-E10 PolarHBondContact O-N 3.46Å; K7-I11 VanDerWaalsContact O-CG1 3.29Å; K7-I11 WeakPolarHBondContact O-CG1 3.47Å; K7-I11 PolarHBondContact O-N 3.39Å
8	D	71.4	Confident	73	Confident	74 Å²	74	130.8 Å²	130.8	40%	0.396	59%	0.587	S	S	.	*	H	α-helix	trans	-62.1	-41.1	177.8	-59.8	-30.7	0	0	0	111.4	H4 R6 I11 L12	H4-D8 PolarHBondContact O-N 3.5Å; H4-D8 VanDerWaalsContact O-N 3.14Å; R6-D8 VanDerWaalsContact C-N 3.31Å; R6-D8 PolarHBondContact O-N 3.19Å; D8-I11 PolarHBondContact O-N 3.43Å; D8-L12 VanDerWaalsContact O-CB 3.29Å; D8-L12 WeakPolarHBondContact O-CB 3.49Å; D8-L12 PolarHBondContact O-N 3.15Å
9	I	77.6	Confident	73.1	Confident	98 Å²	98	128.7 Å²	128.7	50%	0.503	58%	0.582	S	S	.	*	H	α-helix	trans	-65	-44.6	176.3	-67.7	164.6	0	0	0	111.3	R5 R6 K7 I11 L12 E13	R5-I9 WeakPolarHBondContact O-CD1 3.43Å; R5-I9 VanDerWaalsContact O-CG1 3.24Å; R5-I9 WeakPolarHBondContact O-CG1 3.26Å; R5-I9 PolarHBondContact O-N 3.33Å; R5-I9 VanDerWaalsContact O-N 3.15Å; R6-I9 PolarHBondContact O-N 2.72Å; K7-I9 VanDerWaalsContact C-N 3.31Å; K7-I9 PolarHBondContact O-N 3.18Å; I9-I11 PolarHBondContact O-N 3.06Å; I9-L12 WeakPolarHBondContact O-CB 3.2Å; I9-L12 PolarHBondContact O-N 3.3Å; I9-L12 VanDerWaalsContact O-N 3.14Å; I9-E13 PolarHBondContact O-N 2.98Å
10	E	83.2	Confident	73.3	Confident	138 Å²	138	129.5 Å²	129.5	65%	0.645	59%	0.591	S	S	*	*	H	α-helix	trans	-60.5	-44.3	176.8	-79.1	176.5	-177	0	0	112.2	R6 K7 L12 E13 K14	R6-E10 PolarHBondContact O-N 2.82Å; K7-E10 PolarHBondContact O-N 3.46Å; E10-L12 VanDerWaalsContact C-N 3.26Å; E10-L12 PolarHBondContact O-N 2.86Å; E10-E13 PolarHBondContact O-N 3.46Å; E10-K14 WeakPolarHBondContact O-CB 3.41Å; E10-K14 PolarHBondContact O-N 3.39Å
11	I	80.7	Confident	73.3	Confident	65 Å²	65	125.7 Å²	125.7	33%	0.333	58%	0.575	S	S	.	*	H	α-helix	trans	-59.9	-42.8	175.1	-68.7	167.4	0	0	0	109.7	K7 D8 I9 K14 Y15 I27	K7-I11 VanDerWaalsContact O-CG1 3.29Å; K7-I11 WeakPolarHBondContact O-CG1 3.47Å; K7-I11 PolarHBondContact O-N 3.39Å; D8-I11 PolarHBondContact O-N 3.43Å; I9-I11 PolarHBondContact O-N 3.06Å; I11-K14 PolarHBondContact O-N 3.44Å; I11-Y15 HydrophobicContact CG2-CD2 3.82Å; I11-Y15 HydrophobicContact CG2-CE2 4.11Å; I11-Y15 WeakPolarHBondContact O-CB 3.42Å; I11-Y15 WeakPolarHBondContact O-CD2 3.24Å; I11-Y15 PolarHBondContact O-N 3.36Å; I11-I27 HydrophobicContact CG2-CD1 4.29Å
12	L	75.8	Confident	73.9	Confident	25 Å²	25	119.9 Å²	119.9	13%	0.131	55%	0.554	C	S	.	*	H	α-helix	trans	-64	-44.5	-179.9	-155.1	147.9	0	0	0	112.3	D8 I9 E10 Y15 K16 L24 I27	D8-L12 VanDerWaalsContact O-CB 3.29Å; D8-L12 WeakPolarHBondContact O-CB 3.49Å; D8-L12 PolarHBondContact O-N 3.15Å; I9-L12 WeakPolarHBondContact O-CB 3.2Å; I9-L12 PolarHBondContact O-N 3.3Å; I9-L12 VanDerWaalsContact O-N 3.14Å; E10-L12 VanDerWaalsContact C-N 3.26Å; E10-L12 PolarHBondContact O-N 2.86Å; L12-Y15 PolarHBondContact O-N 2.71Å; L12-K16 HydrophobicContact CD2-CD 4.17Å; L12-K16 HydrophobicContact CD2-CG 4.36Å; L12-K16 WeakPolarHBondContact O-CG 3.41Å; L12-K16 PolarHBondContact O-N 2.97Å; L12-L24 HydrophobicContact CD2-CD2 4.08Å; L12-L24 HydrophobicContact CG-CD2 4.02Å; L12-I27 VanDerWaalsContact CA-CD1 3.49Å; L12-I27 HydrophobicContact CB-CD1 3.74Å; L12-I27 HydrophobicContact CB-CG1 4.34Å; L12-I27 HydrophobicContact CD1-CB 3.9Å; L12-I27 HydrophobicContact CD1-CD1 4.03Å; L12-I27 HydrophobicContact CD1-CG1 3.68Å; L12-I27 VanDerWaalsContact CD1-N 3.27Å; L12-I27 HydrophobicContact CG-CB 4.47Å; L12-I27 HydrophobicContact CG-CD1 3.63Å; L12-I27 HydrophobicContact CG-CG1 3.75Å
13	E	81.3	Confident	74.5	Confident	109 Å²	109	115.3 Å²	115.3	51%	0.509	53%	0.533	S	S	.	.	H	α-helix	trans	-64.8	-41.1	174.7	-71.2	-150.1	165	0	0	112.7	I9 E10 Y15 K16 K17	I9-E13 PolarHBondContact O-N 2.98Å; E10-E13 PolarHBondContact O-N 3.46Å; E13-Y15 VanDerWaalsContact C-N 3.34Å; E13-Y15 PolarHBondContact O-N 3.12Å; E13-K16 WeakPolarHBondContact O-CB 3.29Å; E13-K16 PolarHBondContact O-N 3.3Å; E13-K17 WeakPolarHBondContact O-CG 3.37Å; E13-K17 PolarHBondContact O-N 3.02Å
14	K	83.1	Confident	74.9	Confident	141 Å²	141	105 Å²	105	61%	0.613	50%	0.495	S	S	*	.	H	α-helix	trans	-62.1	-43.8	176.3	-172.2	176.5	179.3	-179.5	0	111	E10 I11 K17 L18	E10-K14 WeakPolarHBondContact O-CB 3.41Å; E10-K14 PolarHBondContact O-N 3.39Å; I11-K14 PolarHBondContact O-N 3.44Å; K14-K17 PolarHBondContact O-N 3.28Å; K14-L18 HydrophobicContact CG-CD1 3.93Å; K14-L18 HydrophobicContact CG-CG 4.49Å; K14-L18 WeakPolarHBondContact O-CB 3.41Å; K14-L18 WeakPolarHBondContact O-CG 3.39Å; K14-L18 PolarHBondContact O-N 3.46Å
15	Y	75.2	Confident	75.6	Confident	102 Å²	102	105.5 Å²	105.5	40%	0.4	50%	0.495	S	S	.	.	H	α-helix	trans	-63.1	-42.1	176.1	-101.7	-86.8	0	0	0	112.6	I11 L12 E13 K17 L18 N19 I27	I11-Y15 HydrophobicContact CG2-CD2 3.82Å; I11-Y15 HydrophobicContact CG2-CE2 4.11Å; I11-Y15 WeakPolarHBondContact O-CB 3.42Å; I11-Y15 WeakPolarHBondContact O-CD2 3.24Å; I11-Y15 PolarHBondContact O-N 3.36Å; L12-Y15 PolarHBondContact O-N 2.71Å; E13-Y15 VanDerWaalsContact C-N 3.34Å; E13-Y15 PolarHBondContact O-N 3.12Å; Y15-K17 VanDerWaalsContact C-N 3.34Å; Y15-K17 PolarHBondContact O-N 3.19Å; Y15-L18 PolarHBondContact O-N 3.15Å; Y15-N19 PolarHBondContact O-N 3.14Å; Y15-N19 VanDerWaalsContact O-N 3.1Å; Y15-N19 PolarHBondContact O-ND2 3.14Å; Y15-I27 HydrophobicContact CD2-CD1 4.44Å; Y15-I27 HydrophobicContact CG-CD1 4.49Å
16	K	78.2	Confident	75.8	Confident	66 Å²	66	101.8 Å²	101.8	29%	0.287	49%	0.486	S	S	.	.	H	α-helix	trans	-56	-48.5	174.6	-77.9	-177.7	170.1	-178.4	0	111.7	L12 E13 N20 I21 L24	L12-K16 HydrophobicContact CD2-CD 4.17Å; L12-K16 HydrophobicContact CD2-CG 4.36Å; L12-K16 WeakPolarHBondContact O-CG 3.41Å; L12-K16 PolarHBondContact O-N 2.97Å; E13-K16 WeakPolarHBondContact O-CB 3.29Å; E13-K16 PolarHBondContact O-N 3.3Å; K16-N20 WeakPolarHBondContact O-CA 3.29Å; K16-N20 PolarHBondContact O-N 3.43Å; K16-I21 WeakPolarHBondContact CG-O 3.46Å; K16-I21 PolarHBondContact O-N 2.88Å; K16-I21 VanDerWaalsContact O-N 3.08Å; K16-L24 HydrophobicContact CD-CB 4.42Å; K16-L24 WeakPolarHBondContact CE-O 3.42Å; K16-L24 HydrophobicContact CG-CB 3.76Å; K16-L24 HydrophobicContact CG-CD2 4.09Å; K16-L24 PolarHBondContact NZ-O 3.34Å
17	K	81.9	Confident	75.5	Confident	166 Å²	166	94.3 Å²	94.3	72%	0.722	46%	0.459	S	S	*	.	H	α-helix	trans	-66.1	-46.1	-179.3	-73.1	179.8	-178.9	175.5	0	111.8	E13 K14 Y15 N19	E13-K17 WeakPolarHBondContact O-CG 3.37Å; E13-K17 PolarHBondContact O-N 3.02Å; K14-K17 PolarHBondContact O-N 3.28Å; Y15-K17 VanDerWaalsContact C-N 3.34Å; Y15-K17 PolarHBondContact O-N 3.19Å; K17-N19 VanDerWaalsContact C-N 3.33Å; K17-N19 PolarHBondContact O-N 3.48Å
18	L	81.3	Confident	75.3	Confident	126 Å²	126	91.7 Å²	91.7	66%	0.66	45%	0.451	S	S	*	.	H	α-helix	trans	-64.1	-35.4	-177.8	-77.1	169.8	0	0	0	113.4	K14 Y15	K14-L18 HydrophobicContact CG-CD1 3.93Å; K14-L18 HydrophobicContact CG-CG 4.49Å; K14-L18 WeakPolarHBondContact O-CB 3.41Å; K14-L18 WeakPolarHBondContact O-CG 3.39Å; K14-L18 PolarHBondContact O-N 3.46Å; Y15-L18 PolarHBondContact O-N 3.15Å
19	N	74.8	Confident	75.5	Confident	92 Å²	92	92 Å²	92	49%	0.492	45%	0.449	S	S	.	.	H	α-helix	trans	-104.3	2.6	-174.9	-61.3	-84.8	0	0	0	113.2	Y15 K17 I21	Y15-N19 PolarHBondContact O-N 3.14Å; Y15-N19 VanDerWaalsContact O-N 3.1Å; Y15-N19 PolarHBondContact O-ND2 3.14Å; K17-N19 VanDerWaalsContact C-N 3.33Å; K17-N19 PolarHBondContact O-N 3.48Å; N19-I21 VanDerWaalsContact C-N 3.29Å; N19-I21 HydrophobicContact CB-CD1 3.71Å; N19-I21 HydrophobicContact CB-CG1 3.72Å; N19-I21 VanDerWaalsContact O-CG1 3.27Å; N19-I21 WeakPolarHBondContact O-CG1 2.68Å; N19-I21 PolarHBondContact O-N 3.14Å
20	N	77.1	Confident	75.7	Confident	144 Å²	144	88.1 Å²	88.1	77%	0.77	43%	0.433	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.2	45.4	-173.3	-163.3	26.6	0	0	0	113.6	K16 P22	K16-N20 WeakPolarHBondContact O-CA 3.29Å; K16-N20 PolarHBondContact O-N 3.43Å; N20-P22 VanDerWaalsContact C-CD 3.5Å; N20-P22 WeakPolarHBondContact O-CD 3.34Å
21	I	71.6	Confident	75.6	Confident	50 Å²	50	85.5 Å²	85.5	26%	0.256	43%	0.427	S	S	.	.			trans	-114.3	81	-178	-49.2	179.5	0	0	0	109.9	K16 N19 S23 L24 L50	K16-I21 WeakPolarHBondContact CG-O 3.46Å; K16-I21 PolarHBondContact O-N 2.88Å; K16-I21 VanDerWaalsContact O-N 3.08Å; N19-I21 VanDerWaalsContact C-N 3.29Å; N19-I21 HydrophobicContact CB-CD1 3.71Å; N19-I21 HydrophobicContact CB-CG1 3.72Å; N19-I21 VanDerWaalsContact O-CG1 3.27Å; N19-I21 WeakPolarHBondContact O-CG1 2.68Å; N19-I21 PolarHBondContact O-N 3.14Å; I21-S23 PolarHBondContact O-N 3.47Å; I21-L24 HydrophobicContact CG2-CB 4.32Å; I21-L24 HydrophobicContact CG2-CD1 4.43Å; I21-L24 PolarHBondContact O-N 3.42Å; I21-L50 HydrophobicContact CB-CD2 4.36Å; I21-L50 HydrophobicContact CD1-CD2 4.04Å; I21-L50 HydrophobicContact CG2-CD2 3.12Å
22	P	70.4	Confident	75.6	Confident	104 Å²	104	85.6 Å²	85.6	68%	0.675	43%	0.428	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.4	-26.3	-178.7	23.2	-32.2	0	0	0	112.9	N20 L24	N20-P22 VanDerWaalsContact C-CD 3.5Å; N20-P22 WeakPolarHBondContact O-CD 3.34Å; P22-L24 VanDerWaalsContact C-N 3.3Å; P22-L24 PolarHBondContact O-N 2.97Å
23	S	69.4	Low	75.8	Confident	40 Å²	40	94.6 Å²	94.6	28%	0.28	47%	0.466	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82.3	3.2	-175	67.3	0	0	0	0	115.8	I21 K25 S51	I21-S23 PolarHBondContact O-N 3.47Å; S23-K25 PolarHBondContact O-N 2.88Å; S23-K25 VanDerWaalsContact O-N 3.13Å; S23-S51 WeakPolarHBondContact CB-O 3.47Å; S23-S51 PolarHBondContact O-N 3.08Å; S23-S51 PolarHBondContact O-OG 3.04Å; S23-S51 PolarHBondContact OG-O 3.36Å
24	L	68.3	Low	75.8	Confident	4 Å²	4	91.8 Å²	91.8	2%	0.021	46%	0.456	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.3	111.5	175.2	-156.2	81.9	0	0	0	109.8	L12 K16 I21 P22 I27 T48 L50	L12-L24 HydrophobicContact CD2-CD2 4.08Å; L12-L24 HydrophobicContact CG-CD2 4.02Å; K16-L24 HydrophobicContact CD-CB 4.42Å; K16-L24 WeakPolarHBondContact CE-O 3.42Å; K16-L24 HydrophobicContact CG-CB 3.76Å; K16-L24 HydrophobicContact CG-CD2 4.09Å; K16-L24 PolarHBondContact NZ-O 3.34Å; I21-L24 HydrophobicContact CG2-CB 4.32Å; I21-L24 HydrophobicContact CG2-CD1 4.43Å; I21-L24 PolarHBondContact O-N 3.42Å; P22-L24 VanDerWaalsContact C-N 3.3Å; P22-L24 PolarHBondContact O-N 2.97Å; L24-I27 HydrophobicContact CD2-CD1 4.17Å; L24-I27 HydrophobicContact CD2-CG1 4.1Å; L24-T48 HydrophobicContact CD1-CG2 3.6Å; L24-T48 HydrophobicContact CD2-CG2 4.13Å; L24-T48 HydrophobicContact CG-CG2 4.23Å; L24-L50 HydrophobicContact CD1-CD2 3.66Å; L24-L50 HydrophobicContact CD1-CG 4.35Å
25	K	68.9	Low	75.9	Confident	158 Å²	158	90.8 Å²	90.8	69%	0.687	47%	0.467	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.9	-32.7	-178.7	-74.6	-173.8	179.5	178.8	0	113.2	S23 H49 S51	S23-K25 PolarHBondContact O-N 2.88Å; S23-K25 VanDerWaalsContact O-N 3.13Å; K25-H49 PolarHBondContact N-O 3.48Å; K25-S51 WeakPolarHBondContact CE-OG 3.39Å
26	Q	69.8	Low	76.2	Confident	110 Å²	110	92.3 Å²	92.3	51%	0.514	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.8	138.2	-171.6	-163.8	170.6	-6.8	0	0	111.2	I28 H49	Q26-I28 HydrophobicContact CG-CG1 3.99Å; Q26-H49 PolarHBondContact O-N 3.32Å; Q26-H49 VanDerWaalsContact O-N 3.14Å
27	I	68.9	Low	76.4	Confident	25 Å²	25	90.8 Å²	90.8	13%	0.128	48%	0.477	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.3	125.2	165.5	-67.9	172.4	0	0	0	106.4	I11 L12 Y15 L24 F29 P46 T48	I11-I27 HydrophobicContact CG2-CD1 4.29Å; L12-I27 VanDerWaalsContact CA-CD1 3.49Å; L12-I27 HydrophobicContact CB-CD1 3.74Å; L12-I27 HydrophobicContact CB-CG1 4.34Å; L12-I27 HydrophobicContact CD1-CB 3.9Å; L12-I27 HydrophobicContact CD1-CD1 4.03Å; L12-I27 HydrophobicContact CD1-CG1 3.68Å; L12-I27 VanDerWaalsContact CD1-N 3.27Å; L12-I27 HydrophobicContact CG-CB 4.47Å; L12-I27 HydrophobicContact CG-CD1 3.63Å; L12-I27 HydrophobicContact CG-CG1 3.75Å; Y15-I27 HydrophobicContact CD2-CD1 4.44Å; Y15-I27 HydrophobicContact CG-CD1 4.49Å; L24-I27 HydrophobicContact CD2-CD1 4.17Å; L24-I27 HydrophobicContact CD2-CG1 4.1Å; I27-F29 HydrophobicContact CG2-CD2 4.19Å; I27-F29 HydrophobicContact CG2-CE2 3.8Å; I27-F29 HydrophobicContact CG2-CZ 4.15Å; I27-P46 HydrophobicContact CG2-CB 3.82Å; I27-T48 HydrophobicContact CD1-CG2 4.49Å; I27-T48 HydrophobicContact CG1-CG2 3.75Å
28	I	73.5	Confident	76.5	Confident	88 Å²	88	85.7 Å²	85.7	45%	0.451	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.6	128.4	173.1	-56.8	175.5	0	0	0	105.9	Q26 I47	Q26-I28 HydrophobicContact CG-CG1 3.99Å; I28-I47 PolarHBondContact N-O 2.94Å; I28-I47 WeakPolarHBondContact O-CA 3.45Å; I28-I47 WeakPolarHBondContact O-CB 3.39Å; I28-I47 PolarHBondContact O-N 3.11Å
29	F	75.1	Confident	76.6	Confident	82 Å²	82	88.2 Å²	88.2	36%	0.36	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.8	136.2	171.6	-70.5	-91.7	0	0	0	109.7	I27 Y44 P46	I27-F29 HydrophobicContact CG2-CD2 4.19Å; I27-F29 HydrophobicContact CG2-CE2 3.8Å; I27-F29 HydrophobicContact CG2-CZ 4.15Å; F29-Y44 HydrophobicContact CB-CE1 3.93Å; F29-Y44 HydrophobicContact CB-CE2 4.49Å; F29-Y44 WeakPolarHBondContact CB-OH 3.27Å; F29-Y44 HydrophobicContact CD1-CE1 4.17Å; F29-Y44 HydrophobicContact CG-CE1 4.46Å; F29-P46 HydrophobicContact CD1-CB 4.19Å; F29-P46 HydrophobicContact CE1-CB 3.85Å; F29-P46 HydrophobicContact CE1-CG 4.38Å; F29-P46 HydrophobicContact CZ-CB 4.3Å
30	G	81	Confident	77.1	Confident	16 Å²	16	90.9 Å²	90.9	17%	0.165	49%	0.485	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-165.5	172.6	-179.2	0	0	0	0	0	113.1	Y44 G45	G30-Y44 VanDerWaalsContact C-CD2 3.48Å; G30-Y44 WeakPolarHBondContact O-CA 3.35Å; G30-Y44 WeakPolarHBondContact O-CD2 3.13Å; G30-G45 PolarHBondContact N-O 3.39Å; G30-G45 PolarHBondContact O-N 3.45Å
31	T	80.5	Confident	77.4	Confident	83 Å²	83	91.3 Å²	91.3	51%	0.509	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78	121.9	171.3	46.6	0	0	0	0	110	W42 L43 Y44	T31-W42 HydrophobicContact CG2-CB 4.15Å; T31-L43 CarbonylContact C-O 3.57Å; T31-L43 WeakPolarHBondContact CA-O 3.5Å; T31-Y44 HydrophobicContact CG2-CD2 4.16Å
32	L	80.9	Confident	78	Confident	67 Å²	67	96.5 Å²	96.5	35%	0.351	50%	0.496	S	S	.	.			trans	-77.3	128.7	173.7	-67.2	167.9	0	0	0	108.9	T34 N37 L43 I47	L32-T34 HydrophobicContact CB-CG2 4.03Å; L32-T34 PolarHBondContact O-N 3.38Å; L32-T34 VanDerWaalsContact O-N 3.15Å; L32-N37 PolarHBondContact O-ND2 3.13Å; L32-L43 HydrophobicContact CB-CB 4.48Å; L32-L43 HydrophobicContact CD1-CD2 3.9Å; L32-L43 PolarHBondContact N-O 3.31Å; L32-I47 HydrophobicContact CD2-CD1 4.31Å; L32-I47 HydrophobicContact CD2-CG1 3.9Å
33	K	80.8	Confident	78.4	Confident	214 Å²	214	96.3 Å²	96.3	93%	0.93	49%	0.489	S	S	*	.			trans	-74.8	103.7	174.2	-170	176.8	-178.8	-179.8	0	108.6
34	T	81.1	Confident	79	Confident	50 Å²	50	102 Å²	102	31%	0.307	51%	0.505	S	S	.	.			trans	-126.3	155.7	178.8	77.3	0	0	0	0	110.6	L32 N36 N37 L43	L32-T34 HydrophobicContact CB-CG2 4.03Å; L32-T34 PolarHBondContact O-N 3.38Å; L32-T34 VanDerWaalsContact O-N 3.15Å; T34-N36 PolarHBondContact O-N 3.38Å; T34-N36 PolarHBondContact OG1-N 2.95Å; T34-N37 PolarHBondContact N-ND2 2.93Å; T34-N37 WeakPolarHBondContact O-CB 3.35Å; T34-N37 PolarHBondContact O-N 3.35Å; T34-N37 VanDerWaalsContact O-N 3.13Å; T34-N37 PolarHBondContact OG1-N 3.33Å; T34-N37 PolarHBondContact OG1-OD1 3.39Å; T34-L43 HydrophobicContact CG2-CB 4.44Å; T34-L43 HydrophobicContact CG2-CD2 4.2Å
35	S	84.9	Confident	79.5	Confident	119 Å²	119	102.2 Å²	102.2	83%	0.832	51%	0.509	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.9	-20.1	173.5	50.6	0	0	0	0	113.3	N37	S35-N37 VanDerWaalsContact C-N 3.32Å
36	N	81.9	Confident	79.8	Confident	134 Å²	134	97.2 Å²	97.2	72%	0.717	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.9	-5.4	-178.7	-68.5	39	0	0	0	112.3	T34 S38	T34-N36 PolarHBondContact O-N 3.38Å; T34-N36 PolarHBondContact OG1-N 2.95Å; N36-S38 PolarHBondContact O-N 3.1Å
37	N	82.5	Confident	80.1	Confident	34 Å²	34	95.4 Å²	95.4	18%	0.182	49%	0.486	C	S	.	.			trans	-69	125	174.3	-68.6	-7	0	0	0	109	L32 T34 S35 K41 W42 L43	L32-N37 PolarHBondContact O-ND2 3.13Å; T34-N37 PolarHBondContact N-ND2 2.93Å; T34-N37 WeakPolarHBondContact O-CB 3.35Å; T34-N37 PolarHBondContact O-N 3.35Å; T34-N37 VanDerWaalsContact O-N 3.13Å; T34-N37 PolarHBondContact OG1-N 3.33Å; T34-N37 PolarHBondContact OG1-OD1 3.39Å; S35-N37 VanDerWaalsContact C-N 3.32Å; N37-K41 CarbonylContact C-O 3.56Å; N37-K41 VanDerWaalsContact CA-O 3.26Å; N37-K41 WeakPolarHBondContact CA-O 3.44Å; N37-W42 HydrophobicContact CB-CD2 4.49Å; N37-W42 HydrophobicContact CB-CE3 3.99Å; N37-W42 HydrophobicContact CB-CZ3 4.21Å; N37-L43 PolarHBondContact OD1-N 2.97Å
38	S	84.1	Confident	80.1	Confident	59 Å²	59	97.1 Å²	97.1	41%	0.413	50%	0.497	S	S	.	.	B	Isolated β-bridge	trans	-122.1	171.1	173	69.8	0	0	0	0	109.4	N36 N40 K41 W42	N36-S38 PolarHBondContact O-N 3.1Å; S38-N40 PolarHBondContact O-N 3.06Å; S38-K41 PolarHBondContact N-O 3.49Å; S38-K41 PolarHBondContact O-N 3.44Å; S38-K41 VanDerWaalsContact O-O 3.07Å; S38-K41 PolarHBondContact OG-N 3.47Å; S38-W42 PolarHBondContact O-NE1 2.96Å
39	Q	83.5	Confident	79.8	Confident	180 Å²	180	99 Å²	99	84%	0.841	50%	0.504	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.7	-28.7	-177.2	-159.5	163.3	-3.4	0	0	113.1
40	N	84.6	Confident	79.4	Confident	148 Å²	148	99.2 Å²	99.2	79%	0.791	51%	0.508	S	S	*	.	T	Hydrogen-bonded Turn	trans	-112.6	0.7	-178	-60.6	-15.5	0	0	0	114.4	S38	S38-N40 PolarHBondContact O-N 3.06Å
41	K	84.1	Confident	78.5	Confident	153 Å²	153	99.7 Å²	99.7	67%	0.665	51%	0.51	S	S	*	.	B	Isolated β-bridge	trans	-140.3	118.2	-177.8	-66.1	-175.7	-179	178.6	0	110.6	N37 S38	N37-K41 CarbonylContact C-O 3.56Å; N37-K41 VanDerWaalsContact CA-O 3.26Å; N37-K41 WeakPolarHBondContact CA-O 3.44Å; S38-K41 PolarHBondContact N-O 3.49Å; S38-K41 PolarHBondContact O-N 3.44Å; S38-K41 VanDerWaalsContact O-O 3.07Å; S38-K41 PolarHBondContact OG-N 3.47Å
42	W	83.1	Confident	77.4	Confident	159 Å²	159	103.9 Å²	103.9	60%	0.602	52%	0.523	S	S	*	.			trans	-124.1	133.3	177.4	-61.9	84.4	0	0	0	109.4	T31 N37 S38 Y44	T31-W42 HydrophobicContact CG2-CB 4.15Å; N37-W42 HydrophobicContact CB-CD2 4.49Å; N37-W42 HydrophobicContact CB-CE3 3.99Å; N37-W42 HydrophobicContact CB-CZ3 4.21Å; S38-W42 PolarHBondContact O-NE1 2.96Å; W42-Y44 PolarHBondContact O-N 3.36Å
43	L	80.2	Confident	76.1	Confident	100 Å²	100	105.5 Å²	105.5	52%	0.524	54%	0.54	S	S	.	.			trans	-78.1	110.6	172	-153.1	80.8	0	0	0	108.9	T31 L32 T34 N37	T31-L43 CarbonylContact C-O 3.57Å; T31-L43 WeakPolarHBondContact CA-O 3.5Å; L32-L43 HydrophobicContact CB-CB 4.48Å; L32-L43 HydrophobicContact CD1-CD2 3.9Å; L32-L43 PolarHBondContact N-O 3.31Å; T34-L43 HydrophobicContact CG2-CB 4.44Å; T34-L43 HydrophobicContact CG2-CD2 4.2Å; N37-L43 PolarHBondContact OD1-N 2.97Å
44	Y	81.9	Confident	74.7	Confident	158 Å²	158	101.1 Å²	101.1	62%	0.62	53%	0.527	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.1	131.5	176.4	-174.8	-95.1	0	0	0	109.9	F29 G30 T31 W42	F29-Y44 HydrophobicContact CB-CE1 3.93Å; F29-Y44 HydrophobicContact CB-CE2 4.49Å; F29-Y44 WeakPolarHBondContact CB-OH 3.27Å; F29-Y44 HydrophobicContact CD1-CE1 4.17Å; F29-Y44 HydrophobicContact CG-CE1 4.46Å; G30-Y44 VanDerWaalsContact C-CD2 3.48Å; G30-Y44 WeakPolarHBondContact O-CA 3.35Å; G30-Y44 WeakPolarHBondContact O-CD2 3.13Å; T31-Y44 HydrophobicContact CG2-CD2 4.16Å; W42-Y44 PolarHBondContact O-N 3.36Å
45	G	78.9	Confident	73.1	Confident	10 Å²	10	104.5 Å²	104.5	10%	0.103	55%	0.55	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-165.7	175.1	-177.3	0	0	0	0	0	114.2	G30	G30-G45 PolarHBondContact N-O 3.39Å; G30-G45 PolarHBondContact O-N 3.45Å
46	P	75	Confident	71	Confident	53 Å²	53	103.6 Å²	103.6	34%	0.344	54%	0.543	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.9	127.4	175.2	29.2	-31.9	0	0	0	110.7	I27 F29	I27-P46 HydrophobicContact CG2-CB 3.82Å; F29-P46 HydrophobicContact CD1-CB 4.19Å; F29-P46 HydrophobicContact CE1-CB 3.85Å; F29-P46 HydrophobicContact CE1-CG 4.38Å; F29-P46 HydrophobicContact CZ-CB 4.3Å
47	I	74.7	Confident	69.1	Low	72 Å²	72	105.6 Å²	105.6	37%	0.369	55%	0.548	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.9	119	171.2	-56.2	171.2	0	0	0	106.8	I28 L32	I28-I47 PolarHBondContact N-O 2.94Å; I28-I47 WeakPolarHBondContact O-CA 3.45Å; I28-I47 WeakPolarHBondContact O-CB 3.39Å; I28-I47 PolarHBondContact O-N 3.11Å; L32-I47 HydrophobicContact CD2-CD1 4.31Å; L32-I47 HydrophobicContact CD2-CG1 3.9Å
48	T	70.8	Confident	67	Low	60 Å²	60	109.2 Å²	109.2	37%	0.368	58%	0.576	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-106.7	125.2	-176.3	40.3	0	0	0	0	110.8	L24 I27 L50	L24-T48 HydrophobicContact CD1-CG2 3.6Å; L24-T48 HydrophobicContact CD2-CG2 4.13Å; L24-T48 HydrophobicContact CG-CG2 4.23Å; I27-T48 HydrophobicContact CD1-CG2 4.49Å; I27-T48 HydrophobicContact CG1-CG2 3.75Å; T48-L50 PolarHBondContact O-N 3.36Å
49	H	66.6	Low	64.6	Low	128 Å²	128	110.9 Å²	110.9	59%	0.593	59%	0.594	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-89.5	108.5	170.1	-161.2	-83.2	0	0	0	109.6	K25 Q26	K25-H49 PolarHBondContact N-O 3.48Å; Q26-H49 PolarHBondContact O-N 3.32Å; Q26-H49 VanDerWaalsContact O-N 3.14Å
50	L	65.4	Low	62.9	Low	86 Å²	86	115.4 Å²	115.4	45%	0.45	61%	0.611	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-85.9	107.8	173.2	-67.1	165.8	0	0	0	107.8	I21 L24 T48 Q52	I21-L50 HydrophobicContact CB-CD2 4.36Å; I21-L50 HydrophobicContact CD1-CD2 4.04Å; I21-L50 HydrophobicContact CG2-CD2 3.12Å; L24-L50 HydrophobicContact CD1-CD2 3.66Å; L24-L50 HydrophobicContact CD1-CG 4.35Å; T48-L50 PolarHBondContact O-N 3.36Å; L50-Q52 PolarHBondContact O-N 3.17Å
51	S	63.1	Low	61.8	Low	27 Å²	27	113.8 Å²	113.8	19%	0.189	60%	0.602	C	S	.	*			trans	-78	112.5	166.8	69.5	0	0	0	0	107.6	S23 K25 S53	S23-S51 WeakPolarHBondContact CB-O 3.47Å; S23-S51 PolarHBondContact O-N 3.08Å; S23-S51 PolarHBondContact O-OG 3.04Å; S23-S51 PolarHBondContact OG-O 3.36Å; K25-S51 WeakPolarHBondContact CE-OG 3.39Å; S51-S53 PolarHBondContact O-N 3.4Å; S51-S53 VanDerWaalsContact O-N 3.11Å
52	Q	58.4	Low	60.6	Low	170 Å²	170	111.7 Å²	111.7	79%	0.794	60%	0.598	S	S	*	*			trans	-60.8	118.6	159.3	-75	-174.2	-28.5	0	0	106.4	L50 N54	L50-Q52 PolarHBondContact O-N 3.17Å; Q52-N54 PolarHBondContact O-N 2.78Å
53	S	53.2	Low	59.3	Low	102 Å²	102	109.1 Å²	109.1	71%	0.713	60%	0.598	S	S	*	*			trans	-63.5	99.1	157.9	49.7	0	0	0	0	104.8	S51 P55	S51-S53 PolarHBondContact O-N 3.4Å; S51-S53 VanDerWaalsContact O-N 3.11Å; S53-P55 WeakPolarHBondContact O-CD 3.19Å
54	N	49.9	Very low	58.1	Low	121 Å²	121	109.6 Å²	109.6	65%	0.647	60%	0.603	S	S	*	*			trans	-50.2	127.7	163.8	-87	0.7	0	0	0	106.3	Q52 S56	Q52-N54 PolarHBondContact O-N 2.78Å; N54-S56 PolarHBondContact O-N 2.94Å
55	P	49	Very low	56.6	Low	121 Å²	121	106.6 Å²	106.6	79%	0.786	60%	0.602	S	S	*	*			trans	-68.5	77.7	159.6	29.5	-30	0	0	0	106.6	S53 H57	S53-P55 WeakPolarHBondContact O-CD 3.19Å; P55-H57 PolarHBondContact O-N 2.96Å
56	S	41	Very low	55.1	Low	100 Å²	100	113 Å²	113	70%	0.699	64%	0.635	S	S	*	*			trans	-76.7	70.4	165.7	51.4	0	0	0	0	107.9	N54	N54-S56 PolarHBondContact O-N 2.94Å
57	H	41.2	Very low	53.7	Low	176 Å²	176	117.3 Å²	117.3	82%	0.815	66%	0.656	S	S	*	*			trans	-175.4	103.5	165.9	-99.3	-73.8	0	0	0	103.8	P55	P55-H57 PolarHBondContact O-N 2.96Å
58	S	37.9	Very low	52.1	Low	111 Å²	111	120.8 Å²	120.8	78%	0.776	68%	0.678	S	S	*	*				-155.4	114.3	57.5	45	0	0	0	0	111.1
59	A	33.3	Very low	50.6	Low	94 Å²	94	125.8 Å²	125.8	78%	0.777	70%	0.703	S	S	*	*			trans	-118.4	82.2	154.9	0	0	0	0	0	106.5
60	F	47.6	Very low	49.1	Very low	274 Å²	274	125.6 Å²	125.6	100%	1.202	71%	0.713	S	S	*	*			trans	-150.4	0	162.3	-86.5	-72.8	0	0	0	107.4

Retrieved 60 of 60 residues in 126.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).