A0A5K4F9G8_SCHMA Loading...

30S ribosomal protein S21

AlphaFold DB , UniProt , Accession A0A5K4F9G8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 68 aa.

						>A0A5K4F9G8_SCHMA|A0A5K4F9G8
MVPFRYGLTLILTRYLVRYLRLKGKAPQVQENDRLRNLAKEGAEISRERLKARMARSRRNVLMKRNQR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63	Low	77.4	Confident	216 Å²	216	123.2 Å²	123.2	100%	1.064	62%	0.621	S	S	*	*				0	17.2	0	-63.7	175.2	176.4	0	0	114.1
2	V	69.5	Low	78	Confident	92 Å²	92	120.3 Å²	120.3	56%	0.558	61%	0.608	S	S	*	*	H	α-helix	trans	-80.5	-41	-174.6	-179.3	0	0	0	0	115.3	F4 R5 Y6	V2-F4 VanDerWaalsContact C-N 3.27Å; V2-F4 PolarHBondContact O-N 2.86Å; V2-R5 PolarHBondContact O-N 3.29Å; V2-Y6 HydrophobicContact CG1-CD2 3.86Å; V2-Y6 HydrophobicContact CG1-CE2 3.44Å; V2-Y6 VanDerWaalsContact CG1-CE2 3.44Å; V2-Y6 WeakPolarHBondContact O-CD2 3.46Å
3	P	74	Confident	78.4	Confident	107 Å²	107	117.2 Å²	117.2	70%	0.695	60%	0.599	S	S	*	*	H	α-helix	trans	-68.1	-28.4	-172.5	25.2	-33	0	0	0	113	R5 Y6 G7	P3-R5 PolarHBondContact O-N 3.45Å; P3-Y6 PolarHBondContact O-N 3.18Å; P3-G7 PolarHBondContact O-N 3.09Å
4	F	76.7	Confident	78.6	Confident	162 Å²	162	123.6 Å²	123.6	71%	0.711	61%	0.611	S	S	*	*	H	α-helix	trans	-66.4	-36.5	178.7	-158.4	-96	0	0	0	112.3	V2 G7 L8	V2-F4 VanDerWaalsContact C-N 3.27Å; V2-F4 PolarHBondContact O-N 2.86Å; F4-G7 PolarHBondContact O-N 3Å; F4-L8 VanDerWaalsContact O-CB 3.23Å; F4-L8 WeakPolarHBondContact O-CB 3.39Å; F4-L8 PolarHBondContact O-N 2.77Å
5	R	73.7	Confident	78.8	Confident	190 Å²	190	126.1 Å²	126.1	72%	0.717	61%	0.613	S	S	*	*	H	α-helix	trans	-63.9	-42.8	176.7	-69.5	-178.5	68.4	166.4	0.5	111.5	V2 P3 T9	V2-R5 PolarHBondContact O-N 3.29Å; P3-R5 PolarHBondContact O-N 3.45Å; R5-T9 WeakPolarHBondContact O-CB 3.4Å; R5-T9 PolarHBondContact O-N 2.89Å; R5-T9 PolarHBondContact O-OG1 2.78Å
6	Y	78.1	Confident	79	Confident	162 Å²	162	124.3 Å²	124.3	64%	0.635	61%	0.606	S	S	*	*	H	α-helix	trans	-67.1	-44.5	177.4	-72.9	-72.4	0	0	0	111.9	V2 P3 T9 L10	V2-Y6 HydrophobicContact CG1-CD2 3.86Å; V2-Y6 HydrophobicContact CG1-CE2 3.44Å; V2-Y6 VanDerWaalsContact CG1-CE2 3.44Å; V2-Y6 WeakPolarHBondContact O-CD2 3.46Å; P3-Y6 PolarHBondContact O-N 3.18Å; Y6-T9 PolarHBondContact O-N 3.08Å; Y6-L10 WeakPolarHBondContact O-CG 3.43Å; Y6-L10 PolarHBondContact O-N 3.07Å
7	G	82.5	Confident	78.9	Confident	30 Å²	30	121 Å²	121	31%	0.309	60%	0.595	S	S	.	*	H	α-helix	trans	-60.8	-46	176	0	0	0	0	0	112.6	P3 F4 T9 L10 I11	P3-G7 PolarHBondContact O-N 3.09Å; F4-G7 PolarHBondContact O-N 3Å; G7-T9 VanDerWaalsContact C-N 3.34Å; G7-T9 PolarHBondContact O-N 3.38Å; G7-L10 PolarHBondContact O-N 2.86Å; G7-I11 VanDerWaalsContact O-CG1 3.32Å; G7-I11 WeakPolarHBondContact O-CG1 3.42Å; G7-I11 PolarHBondContact O-N 2.84Å
8	L	82.8	Confident	78.8	Confident	87 Å²	87	123.8 Å²	123.8	46%	0.455	60%	0.598	S	S	.	*	H	α-helix	trans	-60.9	-43.9	177.1	-174.1	65.5	0	0	0	111.3	F4 L10 I11 L12	F4-L8 VanDerWaalsContact O-CB 3.23Å; F4-L8 WeakPolarHBondContact O-CB 3.39Å; F4-L8 PolarHBondContact O-N 2.77Å; L8-L10 PolarHBondContact O-N 3.27Å; L8-I11 PolarHBondContact O-N 3.44Å; L8-L12 HydrophobicContact CD1-CD1 3.53Å; L8-L12 HydrophobicContact CD2-CD1 4.34Å; L8-L12 HydrophobicContact CG-CD1 3.49Å; L8-L12 VanDerWaalsContact CG-CD1 3.49Å; L8-L12 WeakPolarHBondContact O-CD1 3.31Å; L8-L12 PolarHBondContact O-N 3.47Å
9	T	83.5	Confident	78.7	Confident	83 Å²	83	124.5 Å²	124.5	51%	0.509	60%	0.595	S	S	.	*	H	α-helix	trans	-60.8	-45.3	177.4	-54.8	0	0	0	0	111.5	R5 Y6 G7 I11 L12 T13	R5-T9 WeakPolarHBondContact O-CB 3.4Å; R5-T9 PolarHBondContact O-N 2.89Å; R5-T9 PolarHBondContact O-OG1 2.78Å; Y6-T9 PolarHBondContact O-N 3.08Å; G7-T9 VanDerWaalsContact C-N 3.34Å; G7-T9 PolarHBondContact O-N 3.38Å; T9-I11 VanDerWaalsContact C-N 3.32Å; T9-I11 PolarHBondContact O-N 2.99Å; T9-L12 PolarHBondContact O-N 3.31Å; T9-T13 WeakPolarHBondContact O-CB 3.41Å; T9-T13 PolarHBondContact O-N 2.83Å; T9-T13 PolarHBondContact O-OG1 3.32Å
10	L	84	Confident	78.5	Confident	132 Å²	132	122 Å²	122	69%	0.691	58%	0.584	S	S	*	*	H	α-helix	trans	-60.5	-41.3	177	-74.9	166.8	0	0	0	112.2	Y6 G7 L8 R14	Y6-L10 WeakPolarHBondContact O-CG 3.43Å; Y6-L10 PolarHBondContact O-N 3.07Å; G7-L10 PolarHBondContact O-N 2.86Å; L8-L10 PolarHBondContact O-N 3.27Å; L10-R14 WeakPolarHBondContact O-CB 3.49Å; L10-R14 PolarHBondContact O-N 2.82Å; L10-R14 VanDerWaalsContact O-N 3.12Å
11	I	84	Confident	77.9	Confident	94 Å²	94	119.7 Å²	119.7	48%	0.482	57%	0.57	S	S	.	*	H	α-helix	trans	-66.3	-50.7	177.5	-66.2	166.9	0	0	0	110.1	G7 L8 T9 T13 R14 Y15	G7-I11 VanDerWaalsContact O-CG1 3.32Å; G7-I11 WeakPolarHBondContact O-CG1 3.42Å; G7-I11 PolarHBondContact O-N 2.84Å; L8-I11 PolarHBondContact O-N 3.44Å; T9-I11 VanDerWaalsContact C-N 3.32Å; T9-I11 PolarHBondContact O-N 2.99Å; I11-T13 PolarHBondContact O-N 3.49Å; I11-R14 WeakPolarHBondContact O-CB 3.17Å; I11-R14 PolarHBondContact O-N 3.32Å; I11-R14 VanDerWaalsContact O-N 3.15Å; I11-Y15 HydrophobicContact CG2-CD2 3.65Å; I11-Y15 HydrophobicContact CG2-CE2 3.59Å; I11-Y15 VanDerWaalsContact O-CD2 3.29Å; I11-Y15 WeakPolarHBondContact O-CD2 3.21Å; I11-Y15 PolarHBondContact O-N 2.9Å
12	L	83.9	Confident	78.3	Confident	89 Å²	89	116.1 Å²	116.1	47%	0.466	55%	0.554	S	S	.	*	H	α-helix	trans	-58.4	-48.4	178.8	-94.4	101.2	0	0	0	111.6	L8 T9 R14 Y15 L16	L8-L12 HydrophobicContact CD1-CD1 3.53Å; L8-L12 HydrophobicContact CD2-CD1 4.34Å; L8-L12 HydrophobicContact CG-CD1 3.49Å; L8-L12 VanDerWaalsContact CG-CD1 3.49Å; L8-L12 WeakPolarHBondContact O-CD1 3.31Å; L8-L12 PolarHBondContact O-N 3.47Å; T9-L12 PolarHBondContact O-N 3.31Å; L12-R14 PolarHBondContact O-N 2.85Å; L12-Y15 PolarHBondContact O-N 3.5Å; L12-Y15 VanDerWaalsContact O-N 3.09Å; L12-L16 HydrophobicContact CB-CD1 4.35Å; L12-L16 HydrophobicContact CD2-CD1 4.44Å; L12-L16 WeakPolarHBondContact O-CD1 3.3Å; L12-L16 PolarHBondContact O-N 2.88Å
13	T	83.4	Confident	78.4	Confident	80 Å²	80	117.5 Å²	117.5	49%	0.491	55%	0.553	S	S	.	*	H	α-helix	trans	-56.5	-41.3	177.8	-60.2	0	0	0	0	110.9	T9 I11 L16 V17	T9-T13 WeakPolarHBondContact O-CB 3.41Å; T9-T13 PolarHBondContact O-N 2.83Å; T9-T13 PolarHBondContact O-OG1 3.32Å; I11-T13 PolarHBondContact O-N 3.49Å; T13-L16 PolarHBondContact O-N 3.31Å; T13-V17 HydrophobicContact CG2-CG2 4.35Å; T13-V17 WeakPolarHBondContact O-CB 3.46Å; T13-V17 WeakPolarHBondContact O-CG2 3.39Å; T13-V17 PolarHBondContact O-N 2.85Å
14	R	81.9	Confident	77.9	Confident	206 Å²	206	115.5 Å²	115.5	78%	0.777	55%	0.552	S	S	*	*	H	α-helix	trans	-64.1	-42.1	176.9	-166.9	173.4	-175	176.8	1.2	112.6	L10 I11 L12 R18	L10-R14 WeakPolarHBondContact O-CB 3.49Å; L10-R14 PolarHBondContact O-N 2.82Å; L10-R14 VanDerWaalsContact O-N 3.12Å; I11-R14 WeakPolarHBondContact O-CB 3.17Å; I11-R14 PolarHBondContact O-N 3.32Å; I11-R14 VanDerWaalsContact O-N 3.15Å; L12-R14 PolarHBondContact O-N 2.85Å; R14-R18 WeakPolarHBondContact O-CB 3.38Å; R14-R18 PolarHBondContact O-N 3.41Å; R14-R18 VanDerWaalsContact O-N 3.1Å
15	Y	81.5	Confident	77.3	Confident	161 Å²	161	115.4 Å²	115.4	63%	0.631	55%	0.551	S	S	*	*	H	α-helix	trans	-68.4	-43	175.8	-83.5	-77.5	0	0	0	112.2	I11 L12 R18 Y19	I11-Y15 HydrophobicContact CG2-CD2 3.65Å; I11-Y15 HydrophobicContact CG2-CE2 3.59Å; I11-Y15 VanDerWaalsContact O-CD2 3.29Å; I11-Y15 WeakPolarHBondContact O-CD2 3.21Å; I11-Y15 PolarHBondContact O-N 2.9Å; L12-Y15 PolarHBondContact O-N 3.5Å; L12-Y15 VanDerWaalsContact O-N 3.09Å; Y15-R18 PolarHBondContact O-N 3.37Å; Y15-Y19 WeakPolarHBondContact O-CB 3.33Å; Y15-Y19 PolarHBondContact O-N 3.49Å
16	L	81.5	Confident	76.4	Confident	97 Å²	97	108 Å²	108	51%	0.508	53%	0.531	S	S	.	.	H	α-helix	trans	-60.7	-47.8	176.7	-95.8	87.5	0	0	0	111.4	L12 T13 R18 Y19 L20	L12-L16 HydrophobicContact CB-CD1 4.35Å; L12-L16 HydrophobicContact CD2-CD1 4.44Å; L12-L16 WeakPolarHBondContact O-CD1 3.3Å; L12-L16 PolarHBondContact O-N 2.88Å; T13-L16 PolarHBondContact O-N 3.31Å; L16-R18 VanDerWaalsContact C-N 3.3Å; L16-R18 PolarHBondContact O-N 3.04Å; L16-Y19 PolarHBondContact O-N 3.04Å; L16-L20 WeakPolarHBondContact O-CB 3.33Å; L16-L20 WeakPolarHBondContact O-CG 3.34Å; L16-L20 PolarHBondContact O-N 3.47Å
17	V	77.1	Confident	75.6	Confident	69 Å²	69	105.7 Å²	105.7	42%	0.418	54%	0.535	S	S	.	.	H	α-helix	trans	-60.9	-41.5	177.6	170.9	0	0	0	0	110.6	T13 R21	T13-V17 HydrophobicContact CG2-CG2 4.35Å; T13-V17 WeakPolarHBondContact O-CB 3.46Å; T13-V17 WeakPolarHBondContact O-CG2 3.39Å; T13-V17 PolarHBondContact O-N 2.85Å; V17-R21 VanDerWaalsContact O-CB 3.29Å; V17-R21 WeakPolarHBondContact O-CB 3.38Å; V17-R21 PolarHBondContact O-N 3.27Å
18	R	77.6	Confident	74.4	Confident	171 Å²	171	111.8 Å²	111.8	65%	0.645	56%	0.556	S	S	*	*	H	α-helix	trans	-64.4	-43	175.8	-169.2	175.7	-176.1	-179.5	1.7	111.9	R14 Y15 L16 R21 L22	R14-R18 WeakPolarHBondContact O-CB 3.38Å; R14-R18 PolarHBondContact O-N 3.41Å; R14-R18 VanDerWaalsContact O-N 3.1Å; Y15-R18 PolarHBondContact O-N 3.37Å; L16-R18 VanDerWaalsContact C-N 3.3Å; L16-R18 PolarHBondContact O-N 3.04Å; R18-R21 PolarHBondContact O-N 2.85Å; R18-L22 HydrophobicContact CG-CD1 4.35Å; R18-L22 WeakPolarHBondContact O-CG 3.29Å; R18-L22 PolarHBondContact O-N 3.4Å
19	Y	76.3	Confident	73.3	Confident	138 Å²	138	109.5 Å²	109.5	54%	0.541	55%	0.546	S	S	.	.	H	α-helix	trans	-64.8	-44.8	177.4	-179.5	-96.1	0	0	0	112	Y15 L16 R21 L22 K23	Y15-Y19 WeakPolarHBondContact O-CB 3.33Å; Y15-Y19 PolarHBondContact O-N 3.49Å; L16-Y19 PolarHBondContact O-N 3.04Å; Y19-R21 VanDerWaalsContact C-N 3.31Å; Y19-R21 PolarHBondContact O-N 2.85Å; Y19-L22 PolarHBondContact O-N 3.48Å; Y19-K23 HydrophobicContact CE1-CD 3.91Å; Y19-K23 WeakPolarHBondContact O-CB 3.41Å; Y19-K23 PolarHBondContact O-N 2.9Å; Y19-K23 PolarHBondContact OH-NZ 3.49Å
20	L	75.3	Confident	71.9	Confident	73 Å²	73	114.4 Å²	114.4	38%	0.382	56%	0.563	S	S	.	*	H	α-helix	trans	-62.2	-38.1	175.9	-78.1	160.6	0	0	0	112.2	L16 K23 G24 K25 A26	L16-L20 WeakPolarHBondContact O-CB 3.33Å; L16-L20 WeakPolarHBondContact O-CG 3.34Å; L16-L20 PolarHBondContact O-N 3.47Å; L20-K23 PolarHBondContact O-N 2.99Å; L20-G24 PolarHBondContact O-N 2.92Å; L20-K25 HydrophobicContact CD2-CB 4.42Å; L20-K25 PolarHBondContact O-N 3.42Å; L20-A26 HydrophobicContact CB-CB 4.41Å; L20-A26 PolarHBondContact O-N 2.95Å
21	R	65.8	Low	70.7	Confident	74 Å²	74	114.1 Å²	114.1	28%	0.279	56%	0.558	S	S	.	*	H	α-helix	trans	-68.6	-40.2	175.3	-163.9	-179.3	-69	-175.9	-4.6	111.9	V17 R18 Y19 K23 G24 V29 N32	V17-R21 VanDerWaalsContact O-CB 3.29Å; V17-R21 WeakPolarHBondContact O-CB 3.38Å; V17-R21 PolarHBondContact O-N 3.27Å; R18-R21 PolarHBondContact O-N 2.85Å; Y19-R21 VanDerWaalsContact C-N 3.31Å; Y19-R21 PolarHBondContact O-N 2.85Å; R21-K23 VanDerWaalsContact C-N 3.34Å; R21-G24 PolarHBondContact O-N 3.23Å; R21-V29 VanDerWaalsContact NH2-CG2 3.27Å; R21-N32 PolarHBondContact NH1-ND2 2.9Å; R21-N32 PolarHBondContact NH1-OD1 2.79Å
22	L	71.4	Confident	69.3	Low	141 Å²	141	113.2 Å²	113.2	74%	0.738	55%	0.554	S	S	*	*	H	α-helix	trans	-66.3	-34.6	174.6	-75.2	169.3	0	0	0	112.5	R18 Y19 G24	R18-L22 HydrophobicContact CG-CD1 4.35Å; R18-L22 WeakPolarHBondContact O-CG 3.29Å; R18-L22 PolarHBondContact O-N 3.4Å; Y19-L22 PolarHBondContact O-N 3.48Å; L22-G24 PolarHBondContact O-N 3.37Å
23	K	72	Confident	68.3	Low	121 Å²	121	114.2 Å²	114.2	53%	0.526	56%	0.559	S	S	.	*	T	Hydrogen-bonded Turn	trans	-79.3	3.3	178.8	-150.8	173.3	-172.5	168.3	0	113.5	Y19 L20 R21 K25	Y19-K23 HydrophobicContact CE1-CD 3.91Å; Y19-K23 WeakPolarHBondContact O-CB 3.41Å; Y19-K23 PolarHBondContact O-N 2.9Å; Y19-K23 PolarHBondContact OH-NZ 3.49Å; L20-K23 PolarHBondContact O-N 2.99Å; R21-K23 VanDerWaalsContact C-N 3.34Å; K23-K25 PolarHBondContact O-N 3.32Å; K23-K25 VanDerWaalsContact O-N 3.14Å
24	G	62.7	Low	67.1	Low	65 Å²	65	119.6 Å²	119.6	67%	0.67	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	66.9	11.1	178.5	0	0	0	0	0	115.1	L20 R21 L22	L20-G24 PolarHBondContact O-N 2.92Å; R21-G24 PolarHBondContact O-N 3.23Å; L22-G24 PolarHBondContact O-N 3.37Å
25	K	63.9	Low	66.5	Low	160 Å²	160	114.8 Å²	114.8	70%	0.696	56%	0.56	S	S	*	*			trans	-89.2	-10.9	-179.6	-70.5	-163.5	174.2	-167.1	0	113.8	L20 K23	L20-K25 HydrophobicContact CD2-CB 4.42Å; L20-K25 PolarHBondContact O-N 3.42Å; K23-K25 PolarHBondContact O-N 3.32Å; K23-K25 VanDerWaalsContact O-N 3.14Å
26	A	55.8	Low	65.8	Low	35 Å²	35	114.5 Å²	114.5	29%	0.289	56%	0.558	S	S	.	*	S	Bend	trans	-118.3	133.6	171.7	0	0	0	0	0	108.3	L20 Q28	L20-A26 HydrophobicContact CB-CB 4.41Å; L20-A26 PolarHBondContact O-N 2.95Å; A26-Q28 PolarHBondContact O-N 2.84Å
27	P	60	Low	65.2	Low	113 Å²	113	114.3 Å²	114.3	73%	0.734	56%	0.557	S	S	*	*			trans	-54	132.2	176	22.6	-31.7	0	0	0	108.7	V29	P27-V29 PolarHBondContact O-N 3.17Å
28	Q	58.3	Low	64.9	Low	158 Å²	158	115.6 Å²	115.6	74%	0.738	56%	0.561	S	S	*	*			trans	-60.2	108.9	173	-61.8	-167.7	27.1	0	0	106.6	A26 Q30	A26-Q28 PolarHBondContact O-N 2.84Å; Q28-Q30 PolarHBondContact O-N 3.26Å
29	V	58.5	Low	64.7	Low	40 Å²	40	110.6 Å²	110.6	24%	0.242	56%	0.556	C	S	.	*			trans	-56.3	103	-178.2	171.1	0	0	0	0	107.9	R21 P27 E31 N32	R21-V29 VanDerWaalsContact NH2-CG2 3.27Å; P27-V29 PolarHBondContact O-N 3.17Å; V29-E31 HydrophobicContact CG1-CB 3.34Å; V29-E31 HydrophobicContact CG1-CG 3.59Å; V29-E31 WeakPolarHBondContact CG1-OE2 3.36Å; V29-E31 PolarHBondContact O-N 3.31Å; V29-E31 VanDerWaalsContact O-N 3.11Å; V29-N32 PolarHBondContact O-N 2.82Å; V29-N32 PolarHBondContact O-ND2 2.97Å
30	Q	55.3	Low	64.7	Low	186 Å²	186	109.7 Å²	109.7	87%	0.869	56%	0.555	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.9	-14.2	170.9	-75.4	-179.1	63.9	0	0	110.9	Q28 N32 D33	Q28-Q30 PolarHBondContact O-N 3.26Å; Q30-N32 PolarHBondContact O-N 3.47Å; Q30-D33 PolarHBondContact O-N 3.11Å
31	E	57.5	Low	64.7	Low	126 Å²	126	110.5 Å²	110.5	59%	0.589	56%	0.557	S	S	*	*	H	α-helix	trans	-65	-10.7	168.7	-42.5	169.1	91.4	0	0	113.5	V29 D33 R34 L35	V29-E31 HydrophobicContact CG1-CB 3.34Å; V29-E31 HydrophobicContact CG1-CG 3.59Å; V29-E31 WeakPolarHBondContact CG1-OE2 3.36Å; V29-E31 PolarHBondContact O-N 3.31Å; V29-E31 VanDerWaalsContact O-N 3.11Å; E31-D33 PolarHBondContact O-N 3.13Å; E31-R34 PolarHBondContact O-N 3.29Å; E31-R34 VanDerWaalsContact O-N 3.13Å; E31-L35 WeakPolarHBondContact O-CB 3.5Å; E31-L35 WeakPolarHBondContact O-CG 3.32Å; E31-L35 PolarHBondContact O-N 2.87Å
32	N	55.4	Low	65.2	Low	75 Å²	75	108.4 Å²	108.4	40%	0.401	56%	0.559	S	S	.	*	H	α-helix	trans	-58.7	-35	172.6	-75.1	-65.6	0	0	0	111.1	R21 V29 Q30 R36	R21-N32 PolarHBondContact NH1-ND2 2.9Å; R21-N32 PolarHBondContact NH1-OD1 2.79Å; V29-N32 PolarHBondContact O-N 2.82Å; V29-N32 PolarHBondContact O-ND2 2.97Å; Q30-N32 PolarHBondContact O-N 3.47Å; N32-R36 WeakPolarHBondContact O-CB 3.29Å; N32-R36 PolarHBondContact O-N 3.21Å
33	D	62.5	Low	65.4	Low	109 Å²	109	104.2 Å²	104.2	58%	0.583	54%	0.544	S	S	*	.	H	α-helix	trans	-73.2	-37	176.1	-80	-37.4	0	0	0	111.6	Q30 E31 R36 N37	Q30-D33 PolarHBondContact O-N 3.11Å; E31-D33 PolarHBondContact O-N 3.13Å; D33-R36 PolarHBondContact O-N 3.43Å; D33-R36 IonicContact OD1-NH1 3.56Å; D33-N37 WeakPolarHBondContact O-CB 3.31Å; D33-N37 PolarHBondContact O-N 2.8Å
34	R	59.9	Low	65.5	Low	194 Å²	194	104.5 Å²	104.5	73%	0.732	55%	0.548	S	S	*	.	H	α-helix	trans	-67.4	-44.3	176	-159.2	174.6	-175.5	-178.6	1.5	112.3	E31 N37 L38	E31-R34 PolarHBondContact O-N 3.29Å; E31-R34 VanDerWaalsContact O-N 3.13Å; R34-N37 PolarHBondContact O-N 2.79Å; R34-L38 HydrophobicContact CG-CD1 4.46Å; R34-L38 WeakPolarHBondContact O-CB 3.47Å; R34-L38 VanDerWaalsContact O-CG 3.29Å; R34-L38 WeakPolarHBondContact O-CG 3.39Å; R34-L38 PolarHBondContact O-N 3.33Å
35	L	67.9	Low	66.1	Low	104 Å²	104	105.4 Å²	105.4	55%	0.545	54%	0.536	S	S	.	.	H	α-helix	trans	-69.4	-34.2	176.8	-72.8	173.6	0	0	0	112.3	E31 A39	E31-L35 WeakPolarHBondContact O-CB 3.5Å; E31-L35 WeakPolarHBondContact O-CG 3.32Å; E31-L35 PolarHBondContact O-N 2.87Å; L35-A39 WeakPolarHBondContact O-CB 3.29Å; L35-A39 PolarHBondContact O-N 3.04Å
36	R	67.4	Low	66.6	Low	155 Å²	155	101 Å²	101	59%	0.585	53%	0.525	S	S	*	.	H	α-helix	trans	-75.4	-32.9	175.9	-173.2	170	157.9	-139.4	2.9	111.4	N32 D33 K40	N32-R36 WeakPolarHBondContact O-CB 3.29Å; N32-R36 PolarHBondContact O-N 3.21Å; D33-R36 PolarHBondContact O-N 3.43Å; D33-R36 IonicContact OD1-NH1 3.56Å; R36-K40 VanDerWaalsContact O-CB 3.31Å; R36-K40 WeakPolarHBondContact O-CB 3.38Å; R36-K40 VanDerWaalsContact O-CG 3.3Å; R36-K40 WeakPolarHBondContact O-CG 3.48Å; R36-K40 PolarHBondContact O-N 3.43Å
37	N	68.6	Low	67.6	Low	94 Å²	94	108.6 Å²	108.6	50%	0.503	55%	0.547	S	S	.	.	H	α-helix	trans	-65	-47	168.8	-155.6	65.7	0	0	0	110.4	D33 R34 A39 K40 E41	D33-N37 WeakPolarHBondContact O-CB 3.31Å; D33-N37 PolarHBondContact O-N 2.8Å; R34-N37 PolarHBondContact O-N 2.79Å; N37-A39 PolarHBondContact O-N 2.87Å; N37-K40 CarbonylContact O-C 3.6Å; N37-K40 WeakPolarHBondContact O-CB 3.42Å; N37-K40 PolarHBondContact O-N 3.28Å; N37-E41 PolarHBondContact ND2-OE2 3.44Å; N37-E41 WeakPolarHBondContact O-CB 2.92Å; N37-E41 WeakPolarHBondContact O-CG 3.45Å; N37-E41 PolarHBondContact O-N 2.97Å
38	L	71.2	Confident	68.4	Low	96 Å²	96	109.9 Å²	109.9	50%	0.503	54%	0.543	S	S	.	.	H	α-helix	trans	-62.9	-38.8	174.8	-76.7	165	0	0	0	113.1	R34 G42	R34-L38 HydrophobicContact CG-CD1 4.46Å; R34-L38 WeakPolarHBondContact O-CB 3.47Å; R34-L38 VanDerWaalsContact O-CG 3.29Å; R34-L38 WeakPolarHBondContact O-CG 3.39Å; R34-L38 PolarHBondContact O-N 3.33Å; L38-G42 PolarHBondContact O-N 3.25Å
39	A	73.7	Confident	69.3	Low	65 Å²	65	111 Å²	111	54%	0.537	54%	0.54	S	S	.	.	H	α-helix	trans	-69.6	-35.9	176.3	0	0	0	0	0	111.5	L35 N37 A43	L35-A39 WeakPolarHBondContact O-CB 3.29Å; L35-A39 PolarHBondContact O-N 3.04Å; N37-A39 PolarHBondContact O-N 2.87Å; A39-A43 WeakPolarHBondContact O-CB 3.21Å; A39-A43 PolarHBondContact O-N 3.23Å
40	K	75.8	Confident	70.3	Confident	119 Å²	119	114.2 Å²	114.2	52%	0.517	56%	0.556	S	S	.	*	H	α-helix	trans	-66.1	-49.8	171.1	-81.3	-179.3	174.3	-171.6	0	111	R36 N37 G42 A43 E44	R36-K40 VanDerWaalsContact O-CB 3.31Å; R36-K40 WeakPolarHBondContact O-CB 3.38Å; R36-K40 VanDerWaalsContact O-CG 3.3Å; R36-K40 WeakPolarHBondContact O-CG 3.48Å; R36-K40 PolarHBondContact O-N 3.43Å; N37-K40 CarbonylContact O-C 3.6Å; N37-K40 WeakPolarHBondContact O-CB 3.42Å; N37-K40 PolarHBondContact O-N 3.28Å; K40-G42 VanDerWaalsContact C-N 3.32Å; K40-G42 PolarHBondContact O-N 2.76Å; K40-A43 CarbonylContact O-C 3.56Å; K40-A43 WeakPolarHBondContact O-CB 3.46Å; K40-A43 PolarHBondContact O-N 2.88Å; K40-A43 VanDerWaalsContact O-N 3.08Å; K40-E44 WeakPolarHBondContact O-CG 3.44Å; K40-E44 PolarHBondContact O-N 2.77Å
41	E	75.4	Confident	71.4	Confident	90 Å²	90	113.2 Å²	113.2	42%	0.421	55%	0.548	S	S	.	.	H	α-helix	trans	-56.6	-46.3	175.6	-77	179	88.2	0	0	110.9	N37 A43 E44 I45	N37-E41 PolarHBondContact ND2-OE2 3.44Å; N37-E41 WeakPolarHBondContact O-CB 2.92Å; N37-E41 WeakPolarHBondContact O-CG 3.45Å; N37-E41 PolarHBondContact O-N 2.97Å; E41-A43 PolarHBondContact O-N 2.88Å; E41-E44 PolarHBondContact O-N 2.88Å; E41-I45 WeakPolarHBondContact O-CB 3.32Å; E41-I45 WeakPolarHBondContact O-CD1 3.13Å; E41-I45 WeakPolarHBondContact O-CG1 3.37Å; E41-I45 PolarHBondContact O-N 3.14Å
42	G	75.2	Confident	72.5	Confident	31 Å²	31	109.7 Å²	109.7	32%	0.32	54%	0.541	S	S	.	.	H	α-helix	trans	-63.8	-37.3	175.8	0	0	0	0	0	113.4	L38 K40 S46	L38-G42 PolarHBondContact O-N 3.25Å; K40-G42 VanDerWaalsContact C-N 3.32Å; K40-G42 PolarHBondContact O-N 2.76Å; G42-S46 VanDerWaalsContact O-CB 3.27Å; G42-S46 WeakPolarHBondContact O-CB 3.48Å; G42-S46 PolarHBondContact O-N 3.46Å; G42-S46 PolarHBondContact O-OG 2.92Å
43	A	76.1	Confident	73.5	Confident	52 Å²	52	115.7 Å²	115.7	43%	0.43	56%	0.558	S	S	.	*	H	α-helix	trans	-70.1	-37.1	175	0	0	0	0	0	112.1	A39 K40 E41 S46 R47	A39-A43 WeakPolarHBondContact O-CB 3.21Å; A39-A43 PolarHBondContact O-N 3.23Å; K40-A43 CarbonylContact O-C 3.56Å; K40-A43 WeakPolarHBondContact O-CB 3.46Å; K40-A43 PolarHBondContact O-N 2.88Å; K40-A43 VanDerWaalsContact O-N 3.08Å; E41-A43 PolarHBondContact O-N 2.88Å; A43-S46 PolarHBondContact O-N 3.47Å; A43-R47 WeakPolarHBondContact O-CB 3.17Å; A43-R47 WeakPolarHBondContact O-CG 3.27Å; A43-R47 PolarHBondContact O-N 3.25Å
44	E	75.1	Confident	74.2	Confident	128 Å²	128	116 Å²	116	60%	0.598	56%	0.557	S	S	*	*	H	α-helix	trans	-67.4	-48.4	175.1	-73.3	-167	109.3	0	0	111.1	K40 E41 S46 R47 E48	K40-E44 WeakPolarHBondContact O-CG 3.44Å; K40-E44 PolarHBondContact O-N 2.77Å; E41-E44 PolarHBondContact O-N 2.88Å; E44-S46 PolarHBondContact O-N 3.44Å; E44-R47 WeakPolarHBondContact O-CB 3.34Å; E44-R47 PolarHBondContact O-N 2.94Å; E44-E48 PolarHBondContact O-N 3.3Å
45	I	75.4	Confident	75.1	Confident	84 Å²	84	109.7 Å²	109.7	43%	0.431	55%	0.547	S	S	.	.	H	α-helix	trans	-56.7	-42	173.5	-66.9	164.3	0	0	0	110.6	E41 E48 R49	E41-I45 WeakPolarHBondContact O-CB 3.32Å; E41-I45 WeakPolarHBondContact O-CD1 3.13Å; E41-I45 WeakPolarHBondContact O-CG1 3.37Å; E41-I45 PolarHBondContact O-N 3.14Å; I45-E48 PolarHBondContact O-N 3.4Å; I45-R49 WeakPolarHBondContact O-CB 3.42Å; I45-R49 WeakPolarHBondContact O-CG 3.41Å; I45-R49 PolarHBondContact O-N 2.83Å
46	S	74.1	Confident	75.5	Confident	66 Å²	66	113.9 Å²	113.9	46%	0.462	56%	0.555	S	S	.	*	H	α-helix	trans	-66.7	-39.9	177.7	-64.1	0	0	0	0	112.2	G42 A43 E44 R49 L50	G42-S46 VanDerWaalsContact O-CB 3.27Å; G42-S46 WeakPolarHBondContact O-CB 3.48Å; G42-S46 PolarHBondContact O-N 3.46Å; G42-S46 PolarHBondContact O-OG 2.92Å; A43-S46 PolarHBondContact O-N 3.47Å; E44-S46 PolarHBondContact O-N 3.44Å; S46-R49 PolarHBondContact O-N 3.41Å; S46-L50 WeakPolarHBondContact O-CB 3.37Å; S46-L50 PolarHBondContact O-N 3.27Å
47	R	76.4	Confident	75.8	Confident	196 Å²	196	109.7 Å²	109.7	74%	0.74	55%	0.549	S	S	*	.	H	α-helix	trans	-65.3	-43.7	175.3	-85.4	179.8	167.4	-163.8	-2.8	111.9	A43 E44 L50 K51	A43-R47 WeakPolarHBondContact O-CB 3.17Å; A43-R47 WeakPolarHBondContact O-CG 3.27Å; A43-R47 PolarHBondContact O-N 3.25Å; E44-R47 WeakPolarHBondContact O-CB 3.34Å; E44-R47 PolarHBondContact O-N 2.94Å; R47-L50 PolarHBondContact O-N 3.43Å; R47-K51 WeakPolarHBondContact O-CB 3.37Å; R47-K51 PolarHBondContact O-N 3.1Å
48	E	77.8	Confident	76.1	Confident	140 Å²	140	113.9 Å²	113.9	65%	0.654	56%	0.558	S	S	*	*	H	α-helix	trans	-62.7	-44.7	176.2	-74.6	-165.3	99.2	0	0	111.4	E44 I45 L50 K51 A52	E44-E48 PolarHBondContact O-N 3.3Å; I45-E48 PolarHBondContact O-N 3.4Å; E48-L50 PolarHBondContact O-N 2.97Å; E48-K51 PolarHBondContact O-N 2.82Å; E48-A52 WeakPolarHBondContact O-CB 3.29Å; E48-A52 PolarHBondContact O-N 3.22Å
49	R	76.7	Confident	76.2	Confident	181 Å²	181	117.7 Å²	117.7	68%	0.683	57%	0.566	S	S	*	*	H	α-helix	trans	-61.9	-41.9	174.5	-74.8	-179.2	-179.8	-168.8	1.9	112.3	I45 S46 R53	I45-R49 WeakPolarHBondContact O-CB 3.42Å; I45-R49 WeakPolarHBondContact O-CG 3.41Å; I45-R49 PolarHBondContact O-N 2.83Å; S46-R49 PolarHBondContact O-N 3.41Å; R49-R53 WeakPolarHBondContact O-CB 3.4Å; R49-R53 PolarHBondContact O-N 2.92Å
50	L	78.4	Confident	76.2	Confident	108 Å²	108	119.8 Å²	119.8	57%	0.565	57%	0.568	S	S	*	*	H	α-helix	trans	-63.5	-45.3	175.5	-98.6	158.6	0	0	0	111.6	S46 R47 E48 R53 M54	S46-L50 WeakPolarHBondContact O-CB 3.37Å; S46-L50 PolarHBondContact O-N 3.27Å; R47-L50 PolarHBondContact O-N 3.43Å; E48-L50 PolarHBondContact O-N 2.97Å; L50-R53 PolarHBondContact O-N 3.43Å; L50-M54 VanDerWaalsContact O-CB 3.29Å; L50-M54 WeakPolarHBondContact O-CB 3.38Å; L50-M54 PolarHBondContact O-N 2.8Å
51	K	79.6	Confident	76.2	Confident	164 Å²	164	118.5 Å²	118.5	71%	0.713	57%	0.57	S	S	*	*	H	α-helix	trans	-63.5	-43.4	178.1	-168.4	177.7	-179.6	-175.8	0	111.2	R47 E48 M54 A55	R47-K51 WeakPolarHBondContact O-CB 3.37Å; R47-K51 PolarHBondContact O-N 3.1Å; E48-K51 PolarHBondContact O-N 2.82Å; K51-M54 PolarHBondContact O-N 3.09Å; K51-A55 WeakPolarHBondContact O-CB 3.22Å; K51-A55 PolarHBondContact O-N 3.32Å
52	A	79.1	Confident	76.2	Confident	53 Å²	53	120.1 Å²	120.1	44%	0.438	58%	0.581	S	S	.	*	H	α-helix	trans	-63.4	-43	175.1	0	0	0	0	0	112.2	E48 A55 R56	E48-A52 WeakPolarHBondContact O-CB 3.29Å; E48-A52 PolarHBondContact O-N 3.22Å; A52-A55 PolarHBondContact O-N 3.27Å; A52-R56 WeakPolarHBondContact O-CG 3.41Å; A52-R56 PolarHBondContact O-N 3.12Å
53	R	77.9	Confident	76.1	Confident	200 Å²	200	124.1 Å²	124.1	76%	0.755	59%	0.593	S	S	*	*	H	α-helix	trans	-62.6	-43.2	173.8	-88.7	-173.1	148.8	-166.2	-5.6	112	R49 L50 R56 S57	R49-R53 WeakPolarHBondContact O-CB 3.4Å; R49-R53 PolarHBondContact O-N 2.92Å; L50-R53 PolarHBondContact O-N 3.43Å; R53-R56 PolarHBondContact O-N 3.45Å; R53-S57 WeakPolarHBondContact O-CB 3.19Å; R53-S57 PolarHBondContact O-N 3.36Å
54	M	76.4	Confident	76	Confident	117 Å²	117	129.8 Å²	129.8	58%	0.576	61%	0.608	S	S	*	*	H	α-helix	trans	-68.4	-37.7	-179.3	-157.8	-177.5	-70.8	0	0	111.4	L50 K51 S57 R58	L50-M54 VanDerWaalsContact O-CB 3.29Å; L50-M54 WeakPolarHBondContact O-CB 3.38Å; L50-M54 PolarHBondContact O-N 2.8Å; K51-M54 PolarHBondContact O-N 3.09Å; M54-S57 PolarHBondContact O-N 2.86Å; M54-R58 WeakPolarHBondContact O-CB 3.32Å; M54-R58 WeakPolarHBondContact O-CG 3.37Å; M54-R58 PolarHBondContact O-N 3.47Å
55	A	78.9	Confident	75.9	Confident	61 Å²	61	133.7 Å²	133.7	50%	0.504	62%	0.617	S	S	.	*	H	α-helix	trans	-63.2	-44.5	173	0	0	0	0	0	112.1	K51 A52 R58 R59	K51-A55 WeakPolarHBondContact O-CB 3.22Å; K51-A55 PolarHBondContact O-N 3.32Å; A52-A55 PolarHBondContact O-N 3.27Å; A55-R58 PolarHBondContact O-N 3Å; A55-R59 WeakPolarHBondContact O-CB 3.42Å; A55-R59 PolarHBondContact O-N 3.15Å
56	R	77.5	Confident	75.5	Confident	191 Å²	191	137 Å²	137	72%	0.721	64%	0.635	S	S	*	*	H	α-helix	trans	-63.8	-43.6	174.5	-71.9	-177.1	-175.5	-161.5	2	112	A52 R53 R59 N60	A52-R56 WeakPolarHBondContact O-CG 3.41Å; A52-R56 PolarHBondContact O-N 3.12Å; R53-R56 PolarHBondContact O-N 3.45Å; R56-R59 PolarHBondContact O-N 2.94Å; R56-N60 PolarHBondContact O-N 2.87Å
57	S	73.6	Confident	75.1	Confident	67 Å²	67	142.3 Å²	142.3	47%	0.469	65%	0.653	S	S	.	*	H	α-helix	trans	-63.4	-44.7	178.3	-177	0	0	0	0	111.4	R53 M54 R59 N60 V61	R53-S57 WeakPolarHBondContact O-CB 3.19Å; R53-S57 PolarHBondContact O-N 3.36Å; M54-S57 PolarHBondContact O-N 2.86Å; S57-R59 VanDerWaalsContact C-N 3.32Å; S57-R59 PolarHBondContact O-N 3.4Å; S57-N60 PolarHBondContact O-N 3.25Å; S57-V61 VanDerWaalsContact O-CG2 3.29Å; S57-V61 WeakPolarHBondContact O-CG2 3.29Å; S57-V61 PolarHBondContact O-N 3.05Å
58	R	74	Confident	74	Confident	183 Å²	183	147 Å²	147	69%	0.691	67%	0.671	S	S	*	*	H	α-helix	trans	-58.4	-43.2	173.7	-83.7	-175.4	153.7	-158.3	-5.6	112.2	M54 A55 V61 L62	M54-R58 WeakPolarHBondContact O-CB 3.32Å; M54-R58 WeakPolarHBondContact O-CG 3.37Å; M54-R58 PolarHBondContact O-N 3.47Å; A55-R58 PolarHBondContact O-N 3Å; R58-V61 PolarHBondContact O-N 3.02Å; R58-L62 WeakPolarHBondContact O-CB 3.23Å; R58-L62 PolarHBondContact O-N 3.3Å
59	R	74.2	Confident	73.9	Confident	175 Å²	175	147.4 Å²	147.4	66%	0.66	67%	0.672	S	S	*	*	H	α-helix	trans	-63	-41.9	177.9	-164.1	172.5	172.7	165.8	-2.3	111.7	A55 R56 S57 L62 M63	A55-R59 WeakPolarHBondContact O-CB 3.42Å; A55-R59 PolarHBondContact O-N 3.15Å; R56-R59 PolarHBondContact O-N 2.94Å; S57-R59 VanDerWaalsContact C-N 3.32Å; S57-R59 PolarHBondContact O-N 3.4Å; R59-L62 PolarHBondContact O-N 2.72Å; R59-M63 WeakPolarHBondContact O-CB 3.47Å; R59-M63 WeakPolarHBondContact O-CG 3.43Å; R59-M63 PolarHBondContact O-N 3Å
60	N	73.1	Confident	73.7	Confident	110 Å²	110	145.6 Å²	145.6	59%	0.588	67%	0.671	S	S	*	*	H	α-helix	trans	-67.6	-38.1	174.9	-75.7	-1.2	0	0	0	112.8	R56 S57 M63 K64	R56-N60 PolarHBondContact O-N 2.87Å; S57-N60 PolarHBondContact O-N 3.25Å; N60-M63 PolarHBondContact O-N 3.32Å; N60-K64 VanDerWaalsContact O-CB 3.31Å; N60-K64 WeakPolarHBondContact O-CB 3.18Å; N60-K64 PolarHBondContact O-N 3.45Å
61	V	74.9	Confident	73.4	Confident	91 Å²	91	147.7 Å²	147.7	55%	0.552	68%	0.677	S	S	*	*	H	α-helix	trans	-67.1	-42.4	176.3	172	0	0	0	0	110.9	S57 R58 K64 R65	S57-V61 VanDerWaalsContact O-CG2 3.29Å; S57-V61 WeakPolarHBondContact O-CG2 3.29Å; S57-V61 PolarHBondContact O-N 3.05Å; R58-V61 PolarHBondContact O-N 3.02Å; V61-K64 PolarHBondContact O-N 3.25Å; V61-R65 WeakPolarHBondContact O-CB 3.38Å; V61-R65 PolarHBondContact O-N 2.89Å
62	L	75.6	Confident	73.1	Confident	124 Å²	124	146.7 Å²	146.7	65%	0.649	68%	0.675	S	S	*	*	H	α-helix	trans	-62.2	-45.9	173.8	-95.9	143.7	0	0	0	111.8	R58 R59 K64 R65 N66	R58-L62 WeakPolarHBondContact O-CB 3.23Å; R58-L62 PolarHBondContact O-N 3.3Å; R59-L62 PolarHBondContact O-N 2.72Å; L62-K64 VanDerWaalsContact C-N 3.34Å; L62-K64 PolarHBondContact O-N 3.43Å; L62-R65 PolarHBondContact O-N 3.01Å; L62-N66 PolarHBondContact O-N 3.38Å; L62-N66 VanDerWaalsContact O-N 3.09Å
63	M	74.2	Confident	72.7	Confident	116 Å²	116	152.6 Å²	152.6	57%	0.571	69%	0.689	S	S	*	*	H	α-helix	trans	-60.5	-42.3	175.3	-78.9	177.4	147.7	0	0	112	R59 N60 R65 N66	R59-M63 WeakPolarHBondContact O-CB 3.47Å; R59-M63 WeakPolarHBondContact O-CG 3.43Å; R59-M63 PolarHBondContact O-N 3Å; N60-M63 PolarHBondContact O-N 3.32Å; M63-R65 VanDerWaalsContact C-N 3.29Å; M63-R65 PolarHBondContact O-N 3.47Å; M63-N66 PolarHBondContact O-N 3.23Å
64	K	72.9	Confident	72.4	Confident	171 Å²	171	149.4 Å²	149.4	74%	0.743	69%	0.685	S	S	*	*	H	α-helix	trans	-67.6	-28.9	177.2	-166.2	173.5	-176.4	179.1	0	112.7	N60 V61 L62	N60-K64 VanDerWaalsContact O-CB 3.31Å; N60-K64 WeakPolarHBondContact O-CB 3.18Å; N60-K64 PolarHBondContact O-N 3.45Å; V61-K64 PolarHBondContact O-N 3.25Å; L62-K64 VanDerWaalsContact C-N 3.34Å; L62-K64 PolarHBondContact O-N 3.43Å
65	R	72.2	Confident	72.1	Confident	210 Å²	210	151.7 Å²	151.7	79%	0.792	69%	0.693	S	S	*	*	H	α-helix	trans	-76.8	-27.3	177.2	-150	178.8	-160.4	-177.7	4.2	112.7	V61 L62 M63 Q67	V61-R65 WeakPolarHBondContact O-CB 3.38Å; V61-R65 PolarHBondContact O-N 2.89Å; L62-R65 PolarHBondContact O-N 3.01Å; M63-R65 VanDerWaalsContact C-N 3.29Å; M63-R65 PolarHBondContact O-N 3.47Å; R65-Q67 VanDerWaalsContact C-N 3.29Å
66	N	68	Low	71.5	Confident	153 Å²	153	158.7 Å²	158.7	82%	0.818	71%	0.707	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.3	-0.4	179.4	-138.4	43.8	0	0	0	113.6	L62 M63	L62-N66 PolarHBondContact O-N 3.38Å; L62-N66 VanDerWaalsContact O-N 3.09Å; M63-N66 PolarHBondContact O-N 3.23Å
67	Q	64.9	Low	71.1	Confident	178 Å²	178	156 Å²	156	83%	0.832	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-107.5	7.3	-179.3	-130.6	-177.6	6.3	0	0	112.9	R65	R65-Q67 VanDerWaalsContact C-N 3.29Å
68	R	54.8	Low	70.8	Confident	294 Å²	294	164.1 Å²	164.1	100%	1.109	73%	0.728	S	S	*	*			trans	-114.8	0	170.5	-108.8	-170.7	-177.2	-168.8	-0.2	108.6

Retrieved 68 of 68 residues in 27.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).