A0A5K4F9I3_SCHMA Loading...

Tudor domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4F9I3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 70 aa.

						>A0A5K4F9I3_SCHMA|A0A5K4F9I3
MCKYLNSPLIDIKIGDKLDCFVAYKATYWKHTMVYNILSIGVRSNDLSPLNELCNLSNNNKMIHNLIMSD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	31.9	Very low	48.5	Very low	227 Å²	227	128.6 Å²	128.6	100%	1.118	66%	0.658	S	S	*	*				0	108.6	0	-164.7	176.6	-173.3	0	0	107.5	K3	M1-K3 PolarHBondContact O-N 3.43Å
2	C	25.4	Very low	50	Low	110 Å²	110	122 Å²	122	74%	0.743	62%	0.624	S	S	*	*			trans	-65.4	114.3	168.1	-83.9	0	0	0	0	107.3
3	K	28.2	Very low	51	Low	187 Å²	187	122.4 Å²	122.4	81%	0.813	62%	0.619	S	S	*	*			trans	-78.8	118.9	170.1	-69.3	-176.2	177.5	-178.6	0	106.9	M1 L5	M1-K3 PolarHBondContact O-N 3.43Å; K3-L5 PolarHBondContact O-N 3.19Å
4	Y	39.6	Very low	51.8	Low	222 Å²	222	115.5 Å²	115.5	87%	0.871	58%	0.584	S	S	*	*			trans	-66.6	102.5	170.5	-57.4	-88.6	0	0	0	107.3	N6	Y4-N6 PolarHBondContact O-N 3.4Å
5	L	39.8	Very low	52.5	Low	152 Å²	152	111.8 Å²	111.8	80%	0.796	59%	0.586	S	S	*	*			trans	-69.7	119.9	155.6	-84.4	152.4	0	0	0	104.5	K3 S7	K3-L5 PolarHBondContact O-N 3.19Å; L5-S7 PolarHBondContact O-N 3.14Å
6	N	47.5	Very low	53.4	Low	152 Å²	152	114.4 Å²	114.4	81%	0.813	60%	0.601	S	S	*	*			trans	-34.2	117.5	169.6	-67.4	-33.2	0	0	0	108.5	Y4 P8	Y4-N6 PolarHBondContact O-N 3.4Å; N6-P8 WeakPolarHBondContact O-CD 3.49Å; N6-P8 WeakPolarHBondContact O-CG 3.32Å
7	S	53.5	Low	53.7	Low	62 Å²	62	115.5 Å²	115.5	43%	0.434	60%	0.599	S	S	.	*			trans	-45.2	103.2	-173.4	-56.7	0	0	0	0	109.4	L5 L9	L5-S7 PolarHBondContact O-N 3.14Å; S7-L9 PolarHBondContact O-N 2.83Å
8	P	63.9	Low	53.6	Low	49 Å²	49	113.4 Å²	113.4	32%	0.318	59%	0.589	S	S	.	*	P	Polyproline II helix	trans	-66.2	128.3	-171.1	-15.8	28.5	0	0	0	107.2	N6 I10 Y24	N6-P8 WeakPolarHBondContact O-CD 3.49Å; N6-P8 WeakPolarHBondContact O-CG 3.32Å; P8-I10 PolarHBondContact O-N 2.86Å; P8-Y24 HydrophobicContact CB-CE1 3.77Å; P8-Y24 WeakPolarHBondContact CB-OH 3.19Å; P8-Y24 HydrophobicContact CG-CE1 4.1Å; P8-Y24 HydrophobicContact CG-CE2 4.15Å; P8-Y24 WeakPolarHBondContact CG-OH 3.28Å; P8-Y24 VanDerWaalsContact O-CD1 3.27Å; P8-Y24 WeakPolarHBondContact O-CD1 3.27Å; P8-Y24 WeakPolarHBondContact O-CE1 3.43Å
9	L	65.2	Low	54.1	Low	109 Å²	109	109.8 Å²	109.8	57%	0.571	57%	0.571	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-80	118.1	169.4	-63.7	176.6	0	0	0	106.7	S7 F21 A23	S7-L9 PolarHBondContact O-N 2.83Å; L9-F21 HydrophobicContact CD2-CD2 3.84Å; L9-F21 HydrophobicContact CD2-CE2 4.35Å; L9-A23 HydrophobicContact CD2-CB 3.97Å
10	I	70.8	Confident	54.9	Low	61 Å²	61	104.4 Å²	104.4	31%	0.313	54%	0.543	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	125.9	167.9	-73.5	168	0	0	0	107.6	P8 I12 F21 V22 Y24	P8-I10 PolarHBondContact O-N 2.86Å; I10-I12 HydrophobicContact CG2-CG1 4.28Å; I10-I12 PolarHBondContact O-N 2.78Å; I10-F21 WeakPolarHBondContact O-CA 3.39Å; I10-V22 PolarHBondContact N-O 3.06Å; I10-V22 VanDerWaalsContact N-O 3.16Å; I10-V22 PolarHBondContact O-N 3.21Å; I10-Y24 HydrophobicContact CB-CE1 4.39Å; I10-Y24 HydrophobicContact CD1-CD1 4.06Å; I10-Y24 HydrophobicContact CD1-CE1 3.23Å; I10-Y24 HydrophobicContact CG1-CD1 4.46Å; I10-Y24 HydrophobicContact CG1-CE1 3.64Å
11	D	67.5	Low	55.8	Low	84 Å²	84	102.4 Å²	102.4	45%	0.449	53%	0.53	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.3	124.9	167.4	-68.8	-46.9	0	0	0	108.8	R43	D11-R43 IonicContact OD1-CZ 3.43Å; D11-R43 IonicContact OD1-NE 3.29Å; D11-R43 PolarHBondContact OD1-NE 2.78Å; D11-R43 IonicContact OD1-NH2 2.75Å; D11-R43 PolarHBondContact OD1-NH2 3.28Å; D11-R43 IonicContact OD2-NH2 3.44Å; D11-R43 PolarHBondContact OD2-NH2 3.5Å
12	I	66.6	Low	57.9	Low	49 Å²	49	91.9 Å²	91.9	25%	0.251	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108	125	175.9	-57.2	-169.1	0	0	0	108.5	I10 I14 C20 V22	I10-I12 HydrophobicContact CG2-CG1 4.28Å; I10-I12 PolarHBondContact O-N 2.78Å; I12-I14 HydrophobicContact CG2-CG1 3.99Å; I12-C20 HydrophobicContact CB-CB 4.46Å; I12-C20 PolarHBondContact N-O 3.4Å; I12-V22 HydrophobicContact CD1-CB 3.92Å; I12-V22 HydrophobicContact CD1-CG2 3.23Å; I12-V22 HydrophobicContact CG1-CB 4.44Å; I12-V22 HydrophobicContact CG1-CG2 3.95Å
13	K	62.8	Low	60.2	Low	127 Å²	127	87.1 Å²	87.1	55%	0.552	45%	0.447	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.9	121.3	167	-158.4	-177.5	179.8	-167.2	0	109.4	G15 D16 L18	K13-G15 VanDerWaalsContact CE-O 3.24Å; K13-G15 WeakPolarHBondContact CE-O 3.4Å; K13-G15 WeakPolarHBondContact CG-O 3.47Å; K13-D16 WeakPolarHBondContact CE-O 3.27Å; K13-L18 HydrophobicContact CB-CD1 3.57Å; K13-L18 HydrophobicContact CG-CB 4.13Å; K13-L18 HydrophobicContact CG-CD1 3.82Å
14	I	62.9	Low	62.4	Low	26 Å²	26	79.8 Å²	79.8	13%	0.133	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.4	109.2	172.8	-55.6	177	0	0	0	106.9	I12 C20 P49 L53	I12-I14 HydrophobicContact CG2-CG1 3.99Å; I14-C20 HydrophobicContact CD1-CB 4.37Å; I14-P49 HydrophobicContact CD1-CB 4.48Å; I14-L53 HydrophobicContact CD1-CB 4.09Å; I14-L53 HydrophobicContact CD1-CD1 3.89Å; I14-L53 HydrophobicContact CD1-CD2 4.48Å; I14-L53 HydrophobicContact CD1-CG 4.39Å
15	G	62.5	Low	64.2	Low	60 Å²	60	74.8 Å²	74.8	62%	0.619	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.2	-140.9	-173.5	0	0	0	0	0	113	K13	K13-G15 VanDerWaalsContact CE-O 3.24Å; K13-G15 WeakPolarHBondContact CE-O 3.4Å; K13-G15 WeakPolarHBondContact CG-O 3.47Å
16	D	66.2	Low	66	Low	154 Å²	154	69.8 Å²	69.8	82%	0.824	38%	0.378	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.4	-16	178.1	-71.6	-34.6	0	0	0	113.7	K13	K13-D16 WeakPolarHBondContact CE-O 3.27Å
17	K	58.1	Low	67.3	Low	132 Å²	132	65.1 Å²	65.1	57%	0.574	36%	0.355	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.1	104	-178.3	-64	-177.6	177.1	-176.8	0	109.3	D46	K17-D46 IonicContact NZ-OD2 3.84Å
18	L	53	Low	68.4	Low	78 Å²	78	69.1 Å²	69.1	41%	0.408	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.8	138.7	163	-168.2	86.9	0	0	0	107.4	K13	K13-L18 HydrophobicContact CB-CD1 3.57Å; K13-L18 HydrophobicContact CG-CB 4.13Å; K13-L18 HydrophobicContact CG-CD1 3.82Å
19	D	63.1	Low	68.9	Low	46 Å²	46	74.4 Å²	74.4	25%	0.246	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	179.1	14.9	140.2	-89.8	-17.9	0	0	0	114	V42 R43 S44	D19-V42 HydrophobicContact CB-CG1 4.35Å; D19-V42 CarbonylContact O-C 3.28Å; D19-V42 VanDerWaalsContact O-CA 3.28Å; D19-V42 WeakPolarHBondContact O-CA 3.06Å; D19-R43 HydrophobicContact CB-CB 3.9Å; D19-R43 PolarHBondContact O-N 3.1Å; D19-S44 WeakPolarHBondContact OD2-CB 3.49Å
20	C	70.3	Confident	69.6	Low	1 Å²	1	76.4 Å²	76.4	1%	0.007	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.8	138.1	171.6	-67.7	0	0	0	0	111	I12 I14 I40 G41	I12-C20 HydrophobicContact CB-CB 4.46Å; I12-C20 PolarHBondContact N-O 3.4Å; I14-C20 HydrophobicContact CD1-CB 4.37Å; C20-I40 HydrophobicContact CB-CG2 4.41Å; C20-G41 CarbonylContact C-O 3.45Å; C20-G41 WeakPolarHBondContact CA-O 3.44Å
21	F	73.8	Confident	70.1	Confident	62 Å²	62	81.2 Å²	81.2	27%	0.272	40%	0.4	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.5	145	162.5	62.5	-94.9	0	0	0	109.6	L9 I10 I40 G41 R43	L9-F21 HydrophobicContact CD2-CD2 3.84Å; L9-F21 HydrophobicContact CD2-CE2 4.35Å; I10-F21 WeakPolarHBondContact O-CA 3.39Å; F21-I40 WeakPolarHBondContact O-CA 3.33Å; F21-G41 PolarHBondContact N-O 2.79Å; F21-G41 PolarHBondContact O-N 2.94Å; F21-R43 HydrophobicContact CD1-CG 4.06Å; F21-R43 HydrophobicContact CE1-CG 4.49Å
22	V	75.1	Confident	70.3	Confident	6 Å²	6	80.3 Å²	80.3	4%	0.036	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.1	122	177.6	175.7	0	0	0	0	109.7	I10 I12 I37 S39 I40	I10-V22 PolarHBondContact N-O 3.06Å; I10-V22 VanDerWaalsContact N-O 3.16Å; I10-V22 PolarHBondContact O-N 3.21Å; I12-V22 HydrophobicContact CD1-CB 3.92Å; I12-V22 HydrophobicContact CD1-CG2 3.23Å; I12-V22 HydrophobicContact CG1-CB 4.44Å; I12-V22 HydrophobicContact CG1-CG2 3.95Å; V22-I37 HydrophobicContact CG1-CB 4.26Å; V22-I37 HydrophobicContact CG1-CD1 4.26Å; V22-I37 HydrophobicContact CG1-CG1 3.89Å; V22-I37 HydrophobicContact CG1-CG2 3.73Å; V22-S39 WeakPolarHBondContact CA-O 3.46Å; V22-I40 HydrophobicContact CG2-CB 4.42Å; V22-I40 HydrophobicContact CG2-CD1 4.33Å; V22-I40 HydrophobicContact CG2-CG1 4.01Å; V22-I40 HydrophobicContact CG2-CG2 4.06Å
23	A	74.8	Confident	70.7	Confident	11 Å²	11	81 Å²	81	9%	0.091	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.5	128.4	162.9	0	0	0	0	0	107.9	L9 L38 S39	L9-A23 HydrophobicContact CD2-CB 3.97Å; A23-L38 HydrophobicContact CB-CB 4.4Å; A23-L38 WeakPolarHBondContact O-CB 3.36Å; A23-L38 PolarHBondContact O-N 2.94Å; A23-S39 WeakPolarHBondContact CB-OG 3.13Å; A23-S39 PolarHBondContact N-O 3.03Å; A23-S39 PolarHBondContact O-N 3.49Å
24	Y	74.3	Confident	71.1	Confident	32 Å²	32	76.3 Å²	76.3	13%	0.125	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.7	163.5	179	69	-87.9	0	0	0	111.9	P8 I10 A26 Y35 N36	P8-Y24 HydrophobicContact CB-CE1 3.77Å; P8-Y24 WeakPolarHBondContact CB-OH 3.19Å; P8-Y24 HydrophobicContact CG-CE1 4.1Å; P8-Y24 HydrophobicContact CG-CE2 4.15Å; P8-Y24 WeakPolarHBondContact CG-OH 3.28Å; P8-Y24 VanDerWaalsContact O-CD1 3.27Å; P8-Y24 WeakPolarHBondContact O-CD1 3.27Å; P8-Y24 WeakPolarHBondContact O-CE1 3.43Å; I10-Y24 HydrophobicContact CB-CE1 4.39Å; I10-Y24 HydrophobicContact CD1-CD1 4.06Å; I10-Y24 HydrophobicContact CD1-CE1 3.23Å; I10-Y24 HydrophobicContact CG1-CD1 4.46Å; I10-Y24 HydrophobicContact CG1-CE1 3.64Å; Y24-A26 HydrophobicContact CD2-CB 4.35Å; Y24-A26 HydrophobicContact CE2-CB 4.02Å; Y24-Y35 AromaticContact CD2-CD1 3.5Å; Y24-Y35 HydrophobicContact CD2-CD1 3.5Å; Y24-Y35 VanDerWaalsContact CD2-CD1 3.5Å; Y24-Y35 HydrophobicContact CD2-CE1 4.37Å; Y24-Y35 HydrophobicContact CD2-CG 4.33Å; Y24-Y35 AromaticContact CE2-CD1 3.35Å; Y24-Y35 HydrophobicContact CE2-CD1 3.35Å; Y24-Y35 AromaticContact CE2-CE1 3.78Å; Y24-Y35 HydrophobicContact CE2-CE1 3.78Å; Y24-Y35 HydrophobicContact CG-CD1 4.34Å; Y24-N36 CarbonylContact C-O 3.47Å; Y24-N36 WeakPolarHBondContact CA-O 3.45Å; Y24-N36 WeakPolarHBondContact CB-O 3.43Å
25	K	76.1	Confident	71.5	Confident	117 Å²	117	76.6 Å²	76.6	51%	0.509	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	110.2	169.5	179.8	-176.8	175.7	-175.5	0	109.8	N36 L38	K25-N36 HydrophobicContact CB-CB 4.46Å; K25-N36 PolarHBondContact N-O 2.76Å; K25-N36 PolarHBondContact O-N 3.16Å; K25-N36 PolarHBondContact O-ND2 3.49Å; K25-L38 HydrophobicContact CB-CD1 4.29Å; K25-L38 HydrophobicContact CB-CD2 4.16Å; K25-L38 HydrophobicContact CB-CG 4.28Å
26	A	78	Confident	71.7	Confident	48 Å²	48	76.6 Å²	76.6	40%	0.397	37%	0.368	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.2	128.3	170.2	0	0	0	0	0	110.5	Y24 M33 V34 Y35	Y24-A26 HydrophobicContact CD2-CB 4.35Å; Y24-A26 HydrophobicContact CE2-CB 4.02Å; A26-M33 HydrophobicContact CB-CG 4.31Å; A26-M33 HydrophobicContact CB-SD 4.19Å; A26-V34 CarbonylContact C-O 3.33Å; A26-V34 WeakPolarHBondContact CA-O 3.48Å; A26-Y35 HydrophobicContact CB-CD1 4.08Å; A26-Y35 HydrophobicContact CB-CE1 4.14Å
27	T	75.1	Confident	72.1	Confident	54 Å²	54	71.6 Å²	71.6	33%	0.331	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129	127.7	173	-54.6	0	0	0	0	108.5	V34	T27-V34 PolarHBondContact N-O 3.29Å; T27-V34 PolarHBondContact O-N 2.75Å
28	Y	76.6	Confident	72.7	Confident	145 Å²	145	70.2 Å²	70.2	57%	0.569	34%	0.339	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.2	120.8	174.8	-163.3	-110.4	0	0	0	109.7	H31 T32 M33	Y28-H31 VanDerWaalsContact CZ-CA 3.48Å; Y28-H31 VanDerWaalsContact OH-CA 3.32Å; Y28-H31 WeakPolarHBondContact OH-CA 3.4Å; Y28-H31 PolarHBondContact OH-O 3.42Å; Y28-T32 WeakPolarHBondContact CA-O 3.49Å; Y28-M33 HydrophobicContact CD2-CB 4.25Å; Y28-M33 HydrophobicContact CD2-CE 4.39Å
29	W	73.9	Confident	73.5	Confident	160 Å²	160	69.5 Å²	69.5	61%	0.606	34%	0.341	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-134.9	124.7	-179.6	-174.8	60.2	0	0	0	110.6	H31 T32	W29-H31 VanDerWaalsContact C-N 3.3Å; W29-H31 PolarHBondContact O-N 2.88Å; W29-T32 PolarHBondContact N-O 3.2Å; W29-T32 WeakPolarHBondContact O-CB 3.5Å; W29-T32 PolarHBondContact O-N 3.12Å
30	K	79.2	Confident	74.1	Confident	151 Å²	151	69.9 Å²	69.9	66%	0.657	34%	0.342	S	S	*	.	T	Hydrogen-bonded Turn	trans	46.6	47.2	176.3	-62.5	-179.3	176.9	179.1	0	114.1	T32	K30-T32 VanDerWaalsContact C-N 3.27Å; K30-T32 PolarHBondContact O-N 3.34Å
31	H	81.5	Confident	74.1	Confident	162 Å²	162	70.6 Å²	70.6	75%	0.75	35%	0.35	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.9	4	-176.6	-49.3	-78.5	0	0	0	116.8	Y28 W29	Y28-H31 VanDerWaalsContact CZ-CA 3.48Å; Y28-H31 VanDerWaalsContact OH-CA 3.32Å; Y28-H31 WeakPolarHBondContact OH-CA 3.4Å; Y28-H31 PolarHBondContact OH-O 3.42Å; W29-H31 VanDerWaalsContact C-N 3.3Å; W29-H31 PolarHBondContact O-N 2.88Å
32	T	71.7	Confident	74.1	Confident	65 Å²	65	69.1 Å²	69.1	40%	0.399	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	134.2	177.2	-54	0	0	0	0	110.4	Y28 W29 K30 V34 I67	Y28-T32 WeakPolarHBondContact CA-O 3.49Å; W29-T32 PolarHBondContact N-O 3.2Å; W29-T32 WeakPolarHBondContact O-CB 3.5Å; W29-T32 PolarHBondContact O-N 3.12Å; K30-T32 VanDerWaalsContact C-N 3.27Å; K30-T32 PolarHBondContact O-N 3.34Å; T32-V34 HydrophobicContact CG2-CG2 4.42Å; T32-I67 HydrophobicContact CG2-CG2 4.41Å
33	M	75.1	Confident	73.9	Confident	64 Å²	64	76 Å²	76	32%	0.315	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.6	121.3	167.8	-162	167.1	-63	0	0	109.8	A26 Y28 Y35	A26-M33 HydrophobicContact CB-CG 4.31Å; A26-M33 HydrophobicContact CB-SD 4.19Å; Y28-M33 HydrophobicContact CD2-CB 4.25Å; Y28-M33 HydrophobicContact CD2-CE 4.39Å; M33-Y35 HydrophobicContact CB-CE2 3.92Å; M33-Y35 HydrophobicContact CG-CD2 4.32Å; M33-Y35 HydrophobicContact CG-CE1 4.38Å; M33-Y35 HydrophobicContact CG-CE2 3.68Å; M33-Y35 HydrophobicContact SD-CE1 3.99Å; M33-Y35 HydrophobicContact SD-CE2 4.05Å; M33-Y35 PolarHBondContact SD-OH 3.44Å
34	V	71.8	Confident	73.8	Confident	28 Å²	28	77 Å²	77	17%	0.17	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	116.9	-179.9	-177.3	0	0	0	0	108.6	A26 T27 T32	A26-V34 CarbonylContact C-O 3.33Å; A26-V34 WeakPolarHBondContact CA-O 3.48Å; T27-V34 PolarHBondContact N-O 3.29Å; T27-V34 PolarHBondContact O-N 2.75Å; T32-V34 HydrophobicContact CG2-CG2 4.42Å
35	Y	71.9	Confident	73.7	Confident	33 Å²	33	83.7 Å²	83.7	13%	0.129	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.1	103.9	177.5	-54.8	-105.2	0	0	0	109	Y24 A26 M33 L66 M68	Y24-Y35 AromaticContact CD2-CD1 3.5Å; Y24-Y35 HydrophobicContact CD2-CD1 3.5Å; Y24-Y35 VanDerWaalsContact CD2-CD1 3.5Å; Y24-Y35 HydrophobicContact CD2-CE1 4.37Å; Y24-Y35 HydrophobicContact CD2-CG 4.33Å; Y24-Y35 AromaticContact CE2-CD1 3.35Å; Y24-Y35 HydrophobicContact CE2-CD1 3.35Å; Y24-Y35 AromaticContact CE2-CE1 3.78Å; Y24-Y35 HydrophobicContact CE2-CE1 3.78Å; Y24-Y35 HydrophobicContact CG-CD1 4.34Å; A26-Y35 HydrophobicContact CB-CD1 4.08Å; A26-Y35 HydrophobicContact CB-CE1 4.14Å; M33-Y35 HydrophobicContact CB-CE2 3.92Å; M33-Y35 HydrophobicContact CG-CD2 4.32Å; M33-Y35 HydrophobicContact CG-CE1 4.38Å; M33-Y35 HydrophobicContact CG-CE2 3.68Å; M33-Y35 HydrophobicContact SD-CE1 3.99Å; M33-Y35 HydrophobicContact SD-CE2 4.05Å; M33-Y35 PolarHBondContact SD-OH 3.44Å; Y35-L66 VanDerWaalsContact CB-O 3.28Å; Y35-L66 WeakPolarHBondContact CB-O 3.37Å; Y35-L66 VanDerWaalsContact CD2-O 3.27Å; Y35-L66 WeakPolarHBondContact CD2-O 3.24Å; Y35-M68 HydrophobicContact CD2-CB 4.38Å; Y35-M68 HydrophobicContact CE2-CB 3.74Å; Y35-M68 HydrophobicContact CE2-CG 4.23Å
36	N	66.7	Low	73.7	Confident	59 Å²	59	81.1 Å²	81.1	32%	0.316	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.5	116.7	175.7	-62	-87.2	0	0	0	108.5	Y24 K25 L38	Y24-N36 CarbonylContact C-O 3.47Å; Y24-N36 WeakPolarHBondContact CA-O 3.45Å; Y24-N36 WeakPolarHBondContact CB-O 3.43Å; K25-N36 HydrophobicContact CB-CB 4.46Å; K25-N36 PolarHBondContact N-O 2.76Å; K25-N36 PolarHBondContact O-N 3.16Å; K25-N36 PolarHBondContact O-ND2 3.49Å; N36-L38 PolarHBondContact O-N 2.82Å
37	I	74.2	Confident	73.6	Confident	50 Å²	50	83.7 Å²	83.7	26%	0.256	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.7	125	174.4	-61.9	179.9	0	0	0	108.8	V22 I40 I63	V22-I37 HydrophobicContact CG1-CB 4.26Å; V22-I37 HydrophobicContact CG1-CD1 4.26Å; V22-I37 HydrophobicContact CG1-CG1 3.89Å; V22-I37 HydrophobicContact CG1-CG2 3.73Å; I37-I40 HydrophobicContact CG2-CD1 4.04Å; I37-I40 HydrophobicContact CG2-CG1 3.72Å; I37-I63 HydrophobicContact CD1-CG2 3.9Å; I37-I63 WeakPolarHBondContact CD1-O 3.45Å
38	L	71.4	Confident	73.6	Confident	102 Å²	102	83.4 Å²	83.4	53%	0.534	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.6	-45.7	176.5	-61.2	177.1	0	0	0	110.9	A23 K25 N36	A23-L38 HydrophobicContact CB-CB 4.4Å; A23-L38 WeakPolarHBondContact O-CB 3.36Å; A23-L38 PolarHBondContact O-N 2.94Å; K25-L38 HydrophobicContact CB-CD1 4.29Å; K25-L38 HydrophobicContact CB-CD2 4.16Å; K25-L38 HydrophobicContact CB-CG 4.28Å; N36-L38 PolarHBondContact O-N 2.82Å
39	S	68.9	Low	73.4	Confident	64 Å²	64	76.9 Å²	76.9	45%	0.448	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.6	157.4	178.7	62	0	0	0	0	110.9	V22 A23	V22-S39 WeakPolarHBondContact CA-O 3.46Å; A23-S39 WeakPolarHBondContact CB-OG 3.13Å; A23-S39 PolarHBondContact N-O 3.03Å; A23-S39 PolarHBondContact O-N 3.49Å
40	I	75.5	Confident	73.3	Confident	53 Å²	53	71.8 Å²	71.8	27%	0.272	37%	0.374	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.3	127.9	176.6	-48.6	-170.7	0	0	0	106.5	C20 F21 V22 I37 L50 L53	C20-I40 HydrophobicContact CB-CG2 4.41Å; F21-I40 WeakPolarHBondContact O-CA 3.33Å; V22-I40 HydrophobicContact CG2-CB 4.42Å; V22-I40 HydrophobicContact CG2-CD1 4.33Å; V22-I40 HydrophobicContact CG2-CG1 4.01Å; V22-I40 HydrophobicContact CG2-CG2 4.06Å; I37-I40 HydrophobicContact CG2-CD1 4.04Å; I37-I40 HydrophobicContact CG2-CG1 3.72Å; I40-L50 HydrophobicContact CB-CD1 4.47Å; I40-L50 HydrophobicContact CG2-CD1 4.18Å; I40-L53 HydrophobicContact CD1-CD2 3.32Å; I40-L53 HydrophobicContact CG1-CD2 4.49Å; I40-L53 HydrophobicContact CG2-CD2 3.88Å
41	G	71.7	Confident	73	Confident	16 Å²	16	69.1 Å²	69.1	17%	0.165	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121	156.6	174.9	0	0	0	0	0	111	C20 F21	C20-G41 CarbonylContact C-O 3.45Å; C20-G41 WeakPolarHBondContact CA-O 3.44Å; F21-G41 PolarHBondContact N-O 2.79Å; F21-G41 PolarHBondContact O-N 2.94Å
42	V	73.7	Confident	72.7	Confident	31 Å²	31	66.2 Å²	66.2	19%	0.188	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	134	175.3	-171.2	0	0	0	0	108.3	D19 S44 D46 L50	D19-V42 HydrophobicContact CB-CG1 4.35Å; D19-V42 CarbonylContact O-C 3.28Å; D19-V42 VanDerWaalsContact O-CA 3.28Å; D19-V42 WeakPolarHBondContact O-CA 3.06Å; V42-S44 VanDerWaalsContact CG1-OG 3.25Å; V42-S44 WeakPolarHBondContact CG1-OG 3.41Å; V42-D46 WeakPolarHBondContact CG1-O 3.37Å; V42-L50 HydrophobicContact CG2-CB 3.87Å
43	R	71.1	Confident	72.7	Confident	150 Å²	150	64.2 Å²	64.2	57%	0.566	34%	0.341	S	S	*	.	S	Bend	trans	-80.9	-30.8	178	-62.4	179.2	178.1	-116	7.8	111.9	D11 D19 F21	D11-R43 IonicContact OD1-CZ 3.43Å; D11-R43 IonicContact OD1-NE 3.29Å; D11-R43 PolarHBondContact OD1-NE 2.78Å; D11-R43 IonicContact OD1-NH2 2.75Å; D11-R43 PolarHBondContact OD1-NH2 3.28Å; D11-R43 IonicContact OD2-NH2 3.44Å; D11-R43 PolarHBondContact OD2-NH2 3.5Å; D19-R43 HydrophobicContact CB-CB 3.9Å; D19-R43 PolarHBondContact O-N 3.1Å; F21-R43 HydrophobicContact CD1-CG 4.06Å; F21-R43 HydrophobicContact CE1-CG 4.49Å
44	S	72.1	Confident	72.4	Confident	33 Å²	33	64 Å²	64	23%	0.231	34%	0.344	C	S	.	.	S	Bend	trans	-81.1	154.2	174.8	57.6	0	0	0	0	112.6	D19 V42 D46	D19-S44 WeakPolarHBondContact OD2-CB 3.49Å; V42-S44 VanDerWaalsContact CG1-OG 3.25Å; V42-S44 WeakPolarHBondContact CG1-OG 3.41Å; S44-D46 PolarHBondContact O-N 3.26Å; S44-D46 PolarHBondContact OG-O 2.8Å
45	N	72	Confident	72.3	Confident	172 Å²	172	67 Å²	67	92%	0.92	36%	0.36	S	S	*	.	S	Bend	trans	-69.9	-13.4	165.2	-70.1	-23.9	0	0	0	112.6	L47	N45-L47 PolarHBondContact O-N 2.75Å
46	D	76.4	Confident	72.1	Confident	63 Å²	63	69.5 Å²	69.5	34%	0.337	38%	0.375	S	S	.	.			trans	-77.1	112.9	172.5	-175.9	6.8	0	0	0	109.5	K17 V42 S44 S48 P49	K17-D46 IonicContact NZ-OD2 3.84Å; V42-D46 WeakPolarHBondContact CG1-O 3.37Å; S44-D46 PolarHBondContact O-N 3.26Å; S44-D46 PolarHBondContact OG-O 2.8Å; D46-S48 VanDerWaalsContact C-N 3.3Å; D46-S48 WeakPolarHBondContact OD1-CB 3.2Å; D46-S48 PolarHBondContact OD1-N 2.64Å; D46-S48 PolarHBondContact OD1-OG 2.83Å; D46-P49 WeakPolarHBondContact O-CD 3.39Å
47	L	74.5	Confident	72	Confident	102 Å²	102	68 Å²	68	53%	0.534	37%	0.369	S	S	.	.			trans	-85.8	1	178.5	-64.5	178.3	0	0	0	113.3	N45 P49 L50 N51	N45-L47 PolarHBondContact O-N 2.75Å; L47-P49 VanDerWaalsContact C-N 3.31Å; L47-L50 PolarHBondContact O-N 3.01Å; L47-L50 VanDerWaalsContact O-N 3.07Å; L47-N51 PolarHBondContact O-N 2.89Å; L47-N51 VanDerWaalsContact O-N 3.14Å
48	S	77.1	Confident	71.4	Confident	49 Å²	49	71.8 Å²	71.8	34%	0.343	39%	0.39	S	S	.	.	H	α-helix	trans	-51.8	-41.9	178.8	-55.1	0	0	0	0	113.5	D46 L50 N51 E52	D46-S48 VanDerWaalsContact C-N 3.3Å; D46-S48 WeakPolarHBondContact OD1-CB 3.2Å; D46-S48 PolarHBondContact OD1-N 2.64Å; D46-S48 PolarHBondContact OD1-OG 2.83Å; S48-L50 VanDerWaalsContact C-N 3.31Å; S48-L50 PolarHBondContact O-N 3.29Å; S48-N51 PolarHBondContact O-N 2.82Å; S48-E52 PolarHBondContact O-N 3.43Å
49	P	71.9	Confident	70.8	Confident	8 Å²	8	73.2 Å²	73.2	5%	0.052	40%	0.398	C	S	.	.	H	α-helix	trans	-62	-35.7	178.1	-24.2	35.7	0	0	0	113.6	I14 D46 L47 L53	I14-P49 HydrophobicContact CD1-CB 4.48Å; D46-P49 WeakPolarHBondContact O-CD 3.39Å; L47-P49 VanDerWaalsContact C-N 3.31Å; P49-L53 WeakPolarHBondContact O-CB 3.28Å; P49-L53 PolarHBondContact O-N 2.87Å
50	L	72.2	Confident	69.8	Low	52 Å²	52	75 Å²	75	27%	0.272	40%	0.402	S	S	.	.	H	α-helix	trans	-70.8	-40.2	177.7	-172.4	64.6	0	0	0	111	I40 V42 L47 S48 L53 C54	I40-L50 HydrophobicContact CB-CD1 4.47Å; I40-L50 HydrophobicContact CG2-CD1 4.18Å; V42-L50 HydrophobicContact CG2-CB 3.87Å; L47-L50 PolarHBondContact O-N 3.01Å; L47-L50 VanDerWaalsContact O-N 3.07Å; S48-L50 VanDerWaalsContact C-N 3.31Å; S48-L50 PolarHBondContact O-N 3.29Å; L50-L53 PolarHBondContact O-N 3.16Å; L50-C54 WeakPolarHBondContact O-CB 3.25Å; L50-C54 PolarHBondContact O-N 3.42Å; L50-C54 PolarHBondContact O-SG 2.59Å
51	N	72.3	Confident	68.5	Low	96 Å²	96	82 Å²	82	51%	0.513	43%	0.431	S	S	.	.	H	α-helix	trans	-64.1	-41.8	176	-73.3	-21.8	0	0	0	111.7	L47 S48 L53 C54 N55	L47-N51 PolarHBondContact O-N 2.89Å; L47-N51 VanDerWaalsContact O-N 3.14Å; S48-N51 PolarHBondContact O-N 2.82Å; N51-L53 VanDerWaalsContact C-N 3.35Å; N51-C54 PolarHBondContact O-N 2.87Å; N51-N55 WeakPolarHBondContact O-CB 3.29Å; N51-N55 PolarHBondContact O-N 3.28Å; N51-N55 PolarHBondContact O-ND2 2.95Å
52	E	75.6	Confident	67.4	Low	101 Å²	101	88.6 Å²	88.6	47%	0.472	46%	0.459	S	S	.	.	H	α-helix	trans	-61.1	-44.2	173.4	-74.7	178.6	-152.8	0	0	111.5	S48 N55 L56	S48-E52 PolarHBondContact O-N 3.43Å; E52-N55 PolarHBondContact O-N 2.88Å; E52-L56 WeakPolarHBondContact O-CB 3.44Å; E52-L56 VanDerWaalsContact O-CG 3.29Å; E52-L56 WeakPolarHBondContact O-CG 3.39Å; E52-L56 PolarHBondContact O-N 3.3Å
53	L	71.5	Confident	66.4	Low	23 Å²	23	89.2 Å²	89.2	12%	0.12	46%	0.461	C	S	.	.	H	α-helix	trans	-63.7	-43.3	177.9	-166.2	71.6	0	0	0	112.3	I14 I40 P49 L50 N51 L56 S57 I63	I14-L53 HydrophobicContact CD1-CB 4.09Å; I14-L53 HydrophobicContact CD1-CD1 3.89Å; I14-L53 HydrophobicContact CD1-CD2 4.48Å; I14-L53 HydrophobicContact CD1-CG 4.39Å; I40-L53 HydrophobicContact CD1-CD2 3.32Å; I40-L53 HydrophobicContact CG1-CD2 4.49Å; I40-L53 HydrophobicContact CG2-CD2 3.88Å; P49-L53 WeakPolarHBondContact O-CB 3.28Å; P49-L53 PolarHBondContact O-N 2.87Å; L50-L53 PolarHBondContact O-N 3.16Å; N51-L53 VanDerWaalsContact C-N 3.35Å; L53-L56 PolarHBondContact O-N 2.93Å; L53-S57 PolarHBondContact O-N 3.37Å; L53-I63 HydrophobicContact CD1-CD1 3.53Å; L53-I63 HydrophobicContact CG-CD1 3.84Å; L53-I63 WeakPolarHBondContact O-CD1 3.37Å
54	C	68.2	Low	65.1	Low	58 Å²	58	89 Å²	89	39%	0.392	47%	0.466	S	S	.	.	H	α-helix	trans	-61.9	-43	174.1	-73.7	0	0	0	0	111.6	L50 N51 S57 N58	L50-C54 WeakPolarHBondContact O-CB 3.25Å; L50-C54 PolarHBondContact O-N 3.42Å; L50-C54 PolarHBondContact O-SG 2.59Å; N51-C54 PolarHBondContact O-N 2.87Å; C54-S57 PolarHBondContact O-N 3.2Å; C54-N58 WeakPolarHBondContact O-CB 3.4Å; C54-N58 VanDerWaalsContact O-CG 3.27Å; C54-N58 PolarHBondContact O-N 2.99Å; C54-N58 PolarHBondContact O-ND2 3.36Å
55	N	69	Low	63.8	Low	93 Å²	93	91.2 Å²	91.2	50%	0.497	48%	0.476	S	S	.	.	H	α-helix	trans	-62.5	-42.7	175.1	-74.4	-21.7	0	0	0	111.5	N51 E52 S57 N58 N59	N51-N55 WeakPolarHBondContact O-CB 3.29Å; N51-N55 PolarHBondContact O-N 3.28Å; N51-N55 PolarHBondContact O-ND2 2.95Å; E52-N55 PolarHBondContact O-N 2.88Å; N55-S57 VanDerWaalsContact C-N 3.35Å; N55-S57 PolarHBondContact O-N 3.32Å; N55-N58 PolarHBondContact O-N 2.97Å; N55-N59 VanDerWaalsContact O-CB 3.25Å; N55-N59 WeakPolarHBondContact O-CB 3.25Å; N55-N59 PolarHBondContact O-N 3.07Å; N55-N59 PolarHBondContact O-ND2 3.33Å; N55-N59 VanDerWaalsContact O-ND2 3.16Å
56	L	68.7	Low	62.5	Low	84 Å²	84	86.8 Å²	86.8	44%	0.44	45%	0.452	S	S	.	.	H	α-helix	trans	-61.7	-42	174.3	-73.4	170.7	0	0	0	111.5	E52 L53 N60 I63	E52-L56 WeakPolarHBondContact O-CB 3.44Å; E52-L56 VanDerWaalsContact O-CG 3.29Å; E52-L56 WeakPolarHBondContact O-CG 3.39Å; E52-L56 PolarHBondContact O-N 3.3Å; L53-L56 PolarHBondContact O-N 2.93Å; L56-N60 WeakPolarHBondContact O-CA 3.48Å; L56-N60 WeakPolarHBondContact O-CB 3.36Å; L56-N60 PolarHBondContact O-N 3.14Å; L56-I63 HydrophobicContact CB-CD1 4.12Å
57	S	63.8	Low	60.8	Low	29 Å²	29	89.2 Å²	89.2	20%	0.203	46%	0.463	C	S	.	.	H	α-helix	trans	-67.8	-35.6	176.6	-170.5	0	0	0	0	113.8	L53 C54 N55 N60	L53-S57 PolarHBondContact O-N 3.37Å; C54-S57 PolarHBondContact O-N 3.2Å; N55-S57 VanDerWaalsContact C-N 3.35Å; N55-S57 PolarHBondContact O-N 3.32Å; S57-N60 CarbonylContact C-O 3.53Å; S57-N60 VanDerWaalsContact C-O 3.28Å; S57-N60 WeakPolarHBondContact CA-O 3.19Å; S57-N60 CarbonylContact O-C 3.45Å
58	N	62.9	Low	59	Low	128 Å²	128	89 Å²	89	68%	0.684	46%	0.46	S	S	*	.	H	α-helix	trans	-74.5	-37.6	178.9	-74.5	-20.3	0	0	0	111.1	C54 N55	C54-N58 WeakPolarHBondContact O-CB 3.4Å; C54-N58 VanDerWaalsContact O-CG 3.27Å; C54-N58 PolarHBondContact O-N 2.99Å; C54-N58 PolarHBondContact O-ND2 3.36Å; N55-N58 PolarHBondContact O-N 2.97Å
59	N	57.9	Low	56.7	Low	133 Å²	133	91.8 Å²	91.8	71%	0.711	48%	0.48	S	S	*	.	H	α-helix	trans	-80.4	-34.9	179.6	-68.1	-25.6	0	0	0	112.4	N55	N55-N59 VanDerWaalsContact O-CB 3.25Å; N55-N59 WeakPolarHBondContact O-CB 3.25Å; N55-N59 PolarHBondContact O-N 3.07Å; N55-N59 PolarHBondContact O-ND2 3.33Å; N55-N59 VanDerWaalsContact O-ND2 3.16Å
60	N	48.7	Very low	54.7	Low	101 Å²	101	101.8 Å²	101.8	54%	0.54	53%	0.533	S	S	.	.	S	Bend	trans	-119.6	112.8	172.9	-66	-47.2	0	0	0	107.6	L56 S57 M62	L56-N60 WeakPolarHBondContact O-CA 3.48Å; L56-N60 WeakPolarHBondContact O-CB 3.36Å; L56-N60 PolarHBondContact O-N 3.14Å; S57-N60 CarbonylContact C-O 3.53Å; S57-N60 VanDerWaalsContact C-O 3.28Å; S57-N60 WeakPolarHBondContact CA-O 3.19Å; S57-N60 CarbonylContact O-C 3.45Å; N60-M62 HydrophobicContact CB-CB 4.38Å; N60-M62 PolarHBondContact O-N 2.9Å
61	K	48.1	Very low	53.9	Low	201 Å²	201	104.3 Å²	104.3	87%	0.874	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.6	27.4	179.3	-64.5	179.8	176.6	177.1	0	115.3
62	M	47.6	Very low	52.9	Low	154 Å²	154	104.7 Å²	104.7	76%	0.759	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-117.9	1.5	-156.7	-156.2	176	-143.4	0	0	115	N60	N60-M62 HydrophobicContact CB-CB 4.38Å; N60-M62 PolarHBondContact O-N 2.9Å
63	I	52	Low	51.6	Low	43 Å²	43	104.9 Å²	104.9	22%	0.221	55%	0.552	C	S	.	*	T	Hydrogen-bonded Turn	trans	-85.2	-13.5	176.5	-55.7	-166.8	0	0	0	112.8	I37 L53 L56 N65	I37-I63 HydrophobicContact CD1-CG2 3.9Å; I37-I63 WeakPolarHBondContact CD1-O 3.45Å; L53-I63 HydrophobicContact CD1-CD1 3.53Å; L53-I63 HydrophobicContact CG-CD1 3.84Å; L53-I63 WeakPolarHBondContact O-CD1 3.37Å; L56-I63 HydrophobicContact CB-CD1 4.12Å; I63-N65 PolarHBondContact O-N 3.32Å; I63-N65 VanDerWaalsContact O-N 3.12Å
64	H	45.4	Very low	50.5	Low	145 Å²	145	109.8 Å²	109.8	67%	0.671	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.7	-24.3	177.5	-79.3	-76.2	0	0	0	113.6
65	N	43.8	Very low	49.4	Very low	81 Å²	81	113 Å²	113	43%	0.433	59%	0.59	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-136.6	100.5	178.7	-63	-49.7	0	0	0	110.1	I63 I67	I63-N65 PolarHBondContact O-N 3.32Å; I63-N65 VanDerWaalsContact O-N 3.12Å; N65-I67 HydrophobicContact CB-CG1 4.24Å; N65-I67 PolarHBondContact O-N 3.44Å; N65-I67 VanDerWaalsContact O-N 3.1Å
66	L	45.6	Very low	48	Very low	79 Å²	79	114.3 Å²	114.3	41%	0.414	60%	0.596	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-71.8	101.5	162.3	-173.6	71.5	0	0	0	106.8	Y35 M68	Y35-L66 VanDerWaalsContact CB-O 3.28Å; Y35-L66 WeakPolarHBondContact CB-O 3.37Å; Y35-L66 VanDerWaalsContact CD2-O 3.27Å; Y35-L66 WeakPolarHBondContact CD2-O 3.24Å; L66-M68 HydrophobicContact CD2-CG 4.22Å; L66-M68 HydrophobicContact CD2-SD 4.31Å; L66-M68 HydrophobicContact CG-CG 4.15Å
67	I	40.9	Very low	46.6	Very low	114 Å²	114	116.5 Å²	116.5	59%	0.585	61%	0.607	S	S	*	*			trans	-91.2	105.2	171.7	-57.3	174.7	0	0	0	106.1	T32 N65	T32-I67 HydrophobicContact CG2-CG2 4.41Å; N65-I67 HydrophobicContact CB-CG1 4.24Å; N65-I67 PolarHBondContact O-N 3.44Å; N65-I67 VanDerWaalsContact O-N 3.1Å
68	M	36.8	Very low	45.2	Very low	96 Å²	96	123.2 Å²	123.2	47%	0.473	64%	0.638	S	S	.	*			trans	-88.9	119.9	164.7	-60.3	-173.6	67.1	0	0	107.4	Y35 L66	Y35-M68 HydrophobicContact CD2-CB 4.38Å; Y35-M68 HydrophobicContact CE2-CB 3.74Å; Y35-M68 HydrophobicContact CE2-CG 4.23Å; L66-M68 HydrophobicContact CD2-CG 4.22Å; L66-M68 HydrophobicContact CD2-SD 4.31Å; L66-M68 HydrophobicContact CG-CG 4.15Å
69	S	27.2	Very low	43.8	Very low	109 Å²	109	122.8 Å²	122.8	76%	0.762	63%	0.634	S	S	*	*			trans	-77.8	148.4	165.6	61.2	0	0	0	0	109.4
70	D	31.4	Very low	42.5	Very low	218 Å²	218	121.9 Å²	121.9	100%	1.166	63%	0.627	S	S	*	*			trans	-52.6	0	170.2	-66	-24.6	0	0	0	112.3

Retrieved 70 of 70 residues in 34.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).