A0A5K4F9J6_SCHMA Loading...

Ovule protein

AlphaFold DB , UniProt , Accession A0A5K4F9J6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 80 aa.

						>A0A5K4F9J6_SCHMA|A0A5K4F9J6
MHNIHQSKRNTTHLLHSTRSPVTSINNIYTAHTHTLHTRTHTIIYQSSSGGKYGDLDRPLTKWTEYRMVIGSGVLTGESQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.9	Very low	42.4	Very low	241 Å²	241	163.6 Å²	163.6	100%	1.187	80%	0.799	S	S	*	*				0	122	0	-74.9	175.7	-160.4	0	0	107.9
2	H	32.5	Very low	42.9	Very low	181 Å²	181	157.5 Å²	157.5	84%	0.838	78%	0.778	S	S	*	*			trans	-88.2	110.6	-179.6	-135	109.3	0	0	0	107.4	I4	H2-I4 PolarHBondContact O-N 3.02Å
3	N	36.5	Very low	43	Very low	151 Å²	151	155.3 Å²	155.3	81%	0.807	76%	0.764	S	S	*	*			trans	-74	95.9	171.8	-92.3	15	0	0	0	108	H5	N3-H5 PolarHBondContact O-N 2.91Å
4	I	43.6	Very low	43.5	Very low	131 Å²	131	151.4 Å²	151.4	67%	0.672	75%	0.747	S	S	*	*			trans	-70.8	91.2	168.2	-55.2	176.7	0	0	0	106.5	H2 Q6	H2-I4 PolarHBondContact O-N 3.02Å; I4-Q6 HydrophobicContact CG2-CG 3.49Å; I4-Q6 VanDerWaalsContact CG2-CG 3.49Å; I4-Q6 PolarHBondContact O-N 2.92Å
5	H	48.5	Very low	44.2	Very low	163 Å²	163	149.3 Å²	149.3	76%	0.755	74%	0.739	S	S	*	*			trans	-69.2	82.9	165.3	-171.2	97.4	0	0	0	107.6	N3 S7	N3-H5 PolarHBondContact O-N 2.91Å; H5-S7 PolarHBondContact O-N 3.06Å
6	Q	39.6	Very low	44.5	Very low	160 Å²	160	148.9 Å²	148.9	75%	0.748	73%	0.734	S	S	*	*			trans	-72.1	97.3	168.9	-65.4	-159.1	-20	0	0	108.2	I4 K8	I4-Q6 HydrophobicContact CG2-CG 3.49Å; I4-Q6 VanDerWaalsContact CG2-CG 3.49Å; I4-Q6 PolarHBondContact O-N 2.92Å; Q6-K8 PolarHBondContact O-N 2.93Å
7	S	43.2	Very low	44.7	Very low	89 Å²	89	144.1 Å²	144.1	62%	0.622	72%	0.719	S	S	*	*			trans	-56.7	108.3	160.1	-62.7	0	0	0	0	107.8	H5 R9	H5-S7 PolarHBondContact O-N 3.06Å; S7-R9 PolarHBondContact O-N 2.99Å
8	K	38.5	Very low	45.2	Very low	202 Å²	202	140.8 Å²	140.8	88%	0.878	71%	0.708	S	S	*	*			trans	-60.7	101.8	175.1	-66.9	179.4	-180	178.9	0	108.4	Q6 N10	Q6-K8 PolarHBondContact O-N 2.93Å; K8-N10 PolarHBondContact O-N 3.09Å; K8-N10 VanDerWaalsContact O-N 3.09Å
9	R	48.8	Very low	45.6	Very low	239 Å²	239	143.3 Å²	143.3	90%	0.902	71%	0.708	S	S	*	*			trans	-67.1	103.4	164.1	-71.7	-175.2	-155.1	123.1	5.6	107.3	S7 T11	S7-R9 PolarHBondContact O-N 2.99Å; R9-T11 VanDerWaalsContact C-N 3.33Å; R9-T11 PolarHBondContact O-N 3.19Å; R9-T11 VanDerWaalsContact O-N 3.08Å
10	N	44.8	Very low	45.9	Very low	147 Å²	147	139.3 Å²	139.3	79%	0.786	69%	0.694	S	S	*	*			trans	-75.4	92.8	166.3	-160.2	5.2	0	0	0	106.9	K8 T12	K8-N10 PolarHBondContact O-N 3.09Å; K8-N10 VanDerWaalsContact O-N 3.09Å; N10-T12 PolarHBondContact O-N 3.08Å
11	T	43.5	Very low	46.1	Very low	96 Å²	96	137.4 Å²	137.4	59%	0.589	69%	0.693	S	S	*	*			trans	-75.2	99.7	175.1	-177	0	0	0	0	108.1	R9 H13	R9-T11 VanDerWaalsContact C-N 3.33Å; R9-T11 PolarHBondContact O-N 3.19Å; R9-T11 VanDerWaalsContact O-N 3.08Å; T11-H13 VanDerWaalsContact C-N 3.33Å; T11-H13 VanDerWaalsContact CG2-NE2 3.33Å; T11-H13 WeakPolarHBondContact CG2-NE2 3.33Å; T11-H13 PolarHBondContact O-CD2 3.08Å; T11-H13 PolarHBondContact O-N 3.01Å; T11-H13 PolarHBondContact OG1-CD2 3.1Å; T11-H13 PolarHBondContact OG1-NE2 3.4Å; T11-H13 VanDerWaalsContact OG1-NE2 3.1Å
12	T	48.2	Very low	46.3	Very low	90 Å²	90	129.3 Å²	129.3	55%	0.552	66%	0.657	S	S	*	*			trans	-76.3	88.5	174.3	-46	0	0	0	0	107.9	N10 L14 L36	N10-T12 PolarHBondContact O-N 3.08Å; T12-L14 PolarHBondContact O-N 3.46Å; T12-L36 HydrophobicContact CG2-CD2 3.69Å
13	H	44.7	Very low	47	Very low	129 Å²	129	126.4 Å²	126.4	60%	0.597	65%	0.652	S	S	*	*			trans	-68.2	101.4	168.6	-69.4	-97.3	0	0	0	108.2	T11 L15	T11-H13 VanDerWaalsContact C-N 3.33Å; T11-H13 VanDerWaalsContact CG2-NE2 3.33Å; T11-H13 WeakPolarHBondContact CG2-NE2 3.33Å; T11-H13 PolarHBondContact O-CD2 3.08Å; T11-H13 PolarHBondContact O-N 3.01Å; T11-H13 PolarHBondContact OG1-CD2 3.1Å; T11-H13 PolarHBondContact OG1-NE2 3.4Å; T11-H13 VanDerWaalsContact OG1-NE2 3.1Å; H13-L15 HydrophobicContact CB-CD2 4.49Å; H13-L15 PolarHBondContact O-N 3.05Å; H13-L15 VanDerWaalsContact O-N 3.08Å
14	L	49.9	Very low	47.6	Very low	101 Å²	101	122.5 Å²	122.5	53%	0.529	64%	0.636	S	S	.	*			trans	-74	94.2	172.2	-155	86.3	0	0	0	107.8	T12 S17	T12-L14 PolarHBondContact O-N 3.46Å; L14-S17 VanDerWaalsContact CD2-OG 3.28Å; L14-S17 WeakPolarHBondContact CD2-OG 3.28Å
15	L	53.8	Low	47.6	Very low	119 Å²	119	124.2 Å²	124.2	62%	0.623	65%	0.645	S	S	*	*			trans	-73	-40	-171.2	-70.7	167.6	0	0	0	112.2	H13	H13-L15 HydrophobicContact CB-CD2 4.49Å; H13-L15 PolarHBondContact O-N 3.05Å; H13-L15 VanDerWaalsContact O-N 3.08Å
16	H	49.5	Very low	47.5	Very low	143 Å²	143	123.3 Å²	123.3	66%	0.662	65%	0.646	S	S	*	*			trans	-153.9	142.2	179.8	-53.7	88.3	0	0	0	110.2
17	S	47.5	Very low	47.9	Very low	67 Å²	67	117.5 Å²	117.5	47%	0.469	62%	0.62	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-127.1	126.3	169.8	-61.3	0	0	0	0	108.3	L14	L14-S17 VanDerWaalsContact CD2-OG 3.28Å; L14-S17 WeakPolarHBondContact CD2-OG 3.28Å
18	T	54.5	Low	48.4	Very low	85 Å²	85	118.4 Å²	118.4	52%	0.521	62%	0.617	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-108.7	131.8	170.2	50.1	0	0	0	0	109.2	T33	T18-T33 PolarHBondContact O-N 3.27Å
19	R	52.4	Low	49.2	Very low	188 Å²	188	111.3 Å²	111.3	71%	0.709	58%	0.584	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-105.7	124.2	173.3	-178.2	-177.7	-180	-174.3	1.5	107.6	T30	R19-T30 HydrophobicContact CG-CG2 3.86Å
20	S	51	Low	49.7	Very low	63 Å²	63	101 Å²	101	44%	0.441	55%	0.548	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	130.9	172.9	-59.2	0	0	0	0	109.8	V22 A31	S20-V22 PolarHBondContact O-N 2.93Å; S20-A31 PolarHBondContact N-O 3.42Å; S20-A31 PolarHBondContact O-N 2.79Å; S20-A31 VanDerWaalsContact O-N 3.1Å
21	P	51.1	Low	50.4	Low	101 Å²	101	94.4 Å²	94.4	66%	0.656	51%	0.514	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-69.4	128.9	168.5	29.3	-31.1	0	0	0	108.5
22	V	49.6	Very low	51.4	Low	71 Å²	71	92.7 Å²	92.7	43%	0.43	50%	0.499	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.3	112.3	168.2	178.5	0	0	0	0	106.5	S20 Y29 A31	S20-V22 PolarHBondContact O-N 2.93Å; V22-Y29 PolarHBondContact N-O 2.76Å; V22-Y29 WeakPolarHBondContact O-CD2 3.19Å; V22-Y29 PolarHBondContact O-N 2.88Å; V22-A31 HydrophobicContact CG2-CB 4.35Å
23	T	46.9	Very low	52	Low	120 Å²	120	89.8 Å²	89.8	74%	0.736	48%	0.482	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93	120.7	178.2	49	0	0	0	0	109.5
24	S	50.3	Low	52.9	Low	69 Å²	69	85.7 Å²	85.7	48%	0.483	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	157.9	162.5	-172.7	0	0	0	0	108.9	N26 N27	S24-N26 PolarHBondContact O-N 2.9Å; S24-N27 PolarHBondContact N-O 2.75Å; S24-N27 VanDerWaalsContact N-O 3.12Å; S24-N27 PolarHBondContact O-N 2.83Å
25	I	43.8	Very low	53.1	Low	166 Å²	166	83.7 Å²	83.7	85%	0.851	46%	0.455	S	S	*	.	T	Hydrogen-bonded Turn	trans	-47.8	-26	-169.9	-66.9	170.3	0	0	0	113.8
26	N	46.6	Very low	53.6	Low	145 Å²	145	81.2 Å²	81.2	78%	0.775	44%	0.442	S	S	*	.	T	Hydrogen-bonded Turn	trans	-128.2	1.3	179.3	-71.2	-41.5	0	0	0	116	S24	S24-N26 PolarHBondContact O-N 2.9Å
27	N	47.5	Very low	54.2	Low	37 Å²	37	83 Å²	83	20%	0.198	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.4	133.9	-174.2	-78.8	-19.6	0	0	0	111.9	S24 Y29 Q46	S24-N27 PolarHBondContact N-O 2.75Å; S24-N27 VanDerWaalsContact N-O 3.12Å; S24-N27 PolarHBondContact O-N 2.83Å; N27-Y29 HydrophobicContact CB-CD2 4.1Å; N27-Y29 HydrophobicContact CB-CE1 4.12Å; N27-Y29 HydrophobicContact CB-CE2 3.41Å; N27-Y29 VanDerWaalsContact CB-CE2 3.41Å; N27-Y29 VanDerWaalsContact CB-CZ 3.41Å; N27-Y29 WeakPolarHBondContact CB-OH 3.38Å; N27-Y29 PolarHBondContact ND2-OH 2.78Å; N27-Q46 HydrophobicContact CB-CG 4.46Å; N27-Q46 VanDerWaalsContact ND2-CD 3.34Å; N27-Q46 PolarHBondContact ND2-NE2 2.93Å
28	I	53.1	Low	54.8	Low	109 Å²	109	85.5 Å²	85.5	56%	0.559	46%	0.463	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89	113.1	167.3	-60.5	173.9	0	0	0	107.3	S47	I28-S47 WeakPolarHBondContact O-CB 3.15Å; I28-S47 PolarHBondContact O-N 2.83Å; I28-S47 PolarHBondContact O-OG 2.63Å
29	Y	56.6	Low	54.8	Low	52 Å²	52	89.9 Å²	89.9	20%	0.204	47%	0.469	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.6	139	172.1	-53	-91.7	0	0	0	110.3	V22 N27 I44 Y45 Q46	V22-Y29 PolarHBondContact N-O 2.76Å; V22-Y29 WeakPolarHBondContact O-CD2 3.19Å; V22-Y29 PolarHBondContact O-N 2.88Å; N27-Y29 HydrophobicContact CB-CD2 4.1Å; N27-Y29 HydrophobicContact CB-CE1 4.12Å; N27-Y29 HydrophobicContact CB-CE2 3.41Å; N27-Y29 VanDerWaalsContact CB-CE2 3.41Å; N27-Y29 VanDerWaalsContact CB-CZ 3.41Å; N27-Y29 WeakPolarHBondContact CB-OH 3.38Å; N27-Y29 PolarHBondContact ND2-OH 2.78Å; Y29-I44 HydrophobicContact CD1-CG2 3.77Å; Y29-I44 HydrophobicContact CG-CG2 4.04Å; Y29-Y45 CarbonylContact C-O 3.54Å; Y29-Y45 WeakPolarHBondContact CA-O 3.37Å; Y29-Q46 HydrophobicContact CD1-CB 3.71Å; Y29-Q46 HydrophobicContact CD1-CG 4Å; Y29-Q46 HydrophobicContact CE1-CB 3.62Å; Y29-Q46 HydrophobicContact CE1-CG 3.52Å
30	T	57.9	Low	55.4	Low	23 Å²	23	85.3 Å²	85.3	14%	0.141	46%	0.463	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.2	121.6	165.3	-58.2	0	0	0	0	107.8	R19 Y45	R19-T30 HydrophobicContact CG-CG2 3.86Å; T30-Y45 PolarHBondContact N-O 3.47Å; T30-Y45 WeakPolarHBondContact O-CD2 3.34Å; T30-Y45 PolarHBondContact O-N 3.17Å
31	A	61	Low	56.2	Low	9 Å²	9	86.3 Å²	86.3	7%	0.074	46%	0.46	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	132.4	172.8	0	0	0	0	0	110.2	S20 V22 T42 I43 I44	S20-A31 PolarHBondContact N-O 3.42Å; S20-A31 PolarHBondContact O-N 2.79Å; S20-A31 VanDerWaalsContact O-N 3.1Å; V22-A31 HydrophobicContact CG2-CB 4.35Å; A31-T42 HydrophobicContact CB-CG2 4.1Å; A31-I43 CarbonylContact C-O 3.56Å; A31-I43 WeakPolarHBondContact CA-O 3.41Å; A31-I44 HydrophobicContact CB-CG1 4.47Å
32	H	63.3	Low	56.8	Low	60 Å²	60	85.3 Å²	85.3	28%	0.278	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.6	111.9	169.6	-77	-112.9	0	0	0	108.8	T42 I43 Y45	H32-T42 CarbonylContact O-C 3.5Å; H32-T42 WeakPolarHBondContact O-CA 3.4Å; H32-I43 HydrophobicContact CB-CB 4.36Å; H32-I43 PolarHBondContact N-O 3.25Å; H32-I43 PolarHBondContact O-N 3.25Å; H32-Y45 HydrophobicContact CB-CE2 3.98Å; H32-Y45 AromaticContact CD2-CD2 3.48Å; H32-Y45 VanDerWaalsContact CD2-CD2 3.48Å; H32-Y45 WeakPolarHBondContact CD2-CD2 3.12Å; H32-Y45 AromaticContact CD2-CE2 3.19Å; H32-Y45 WeakPolarHBondContact CD2-CE2 3.47Å; H32-Y45 AromaticContact CG-CE2 3.62Å; H32-Y45 AromaticContact NE2-CE2 3.87Å
33	T	60.3	Low	57.4	Low	29 Å²	29	85.6 Å²	85.6	18%	0.178	45%	0.451	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.7	120.8	177	-53.3	0	0	0	0	109.7	T18 T40 H41	T18-T33 PolarHBondContact O-N 3.27Å; T33-T40 HydrophobicContact CG2-CG2 3.41Å; T33-T40 VanDerWaalsContact CG2-CG2 3.41Å; T33-H41 CarbonylContact C-O 3.56Å; T33-H41 WeakPolarHBondContact CA-O 3.48Å
34	H	63.3	Low	58.1	Low	42 Å²	42	83.2 Å²	83.2	19%	0.194	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.7	116.6	174.3	-61.8	-64.9	0	0	0	109.8	H41	H34-H41 HydrophobicContact CB-CB 4.43Å; H34-H41 PolarHBondContact N-O 3.26Å; H34-H41 PolarHBondContact O-N 2.85Å
35	T	55	Low	58.4	Low	59 Å²	59	83.8 Å²	83.8	36%	0.362	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.3	114.9	170.7	-52.1	0	0	0	0	109.5	R39	T35-R39 CarbonylContact C-O 3.52Å; T35-R39 WeakPolarHBondContact CA-O 3.38Å
36	L	64.9	Low	58.8	Low	68 Å²	68	80.3 Å²	80.3	36%	0.356	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	111.3	174	-64.8	175	0	0	0	108.7	T12 T38 R39	T12-L36 HydrophobicContact CG2-CD2 3.69Å; L36-T38 PolarHBondContact O-N 2.78Å; L36-R39 PolarHBondContact N-O 3.4Å; L36-R39 PolarHBondContact O-N 2.91Å
37	H	61.3	Low	59	Low	181 Å²	181	75.7 Å²	75.7	84%	0.838	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.1	-91.1	-179.5	-162.6	73	0	0	0	113.6
38	T	60.4	Low	59.1	Low	119 Å²	119	78.2 Å²	78.2	73%	0.73	40%	0.404	S	S	*	.	T	Hydrogen-bonded Turn	trans	-121.9	8.1	177.9	51.5	0	0	0	0	112.6	L36	L36-T38 PolarHBondContact O-N 2.78Å
39	R	53.8	Low	58.8	Low	176 Å²	176	78 Å²	78	66%	0.664	41%	0.412	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.2	127.3	-177.7	-70.2	-178.1	170.6	-179	-3.8	110.9	T35 L36	T35-R39 CarbonylContact C-O 3.52Å; T35-R39 WeakPolarHBondContact CA-O 3.38Å; L36-R39 PolarHBondContact N-O 3.4Å; L36-R39 PolarHBondContact O-N 2.91Å
40	T	65.9	Low	58.3	Low	92 Å²	92	80.2 Å²	80.2	56%	0.564	45%	0.452	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.9	117.7	174.2	-56.1	0	0	0	0	109	T33	T33-T40 HydrophobicContact CG2-CG2 3.41Å; T33-T40 VanDerWaalsContact CG2-CG2 3.41Å
41	H	67.6	Low	57.4	Low	85 Å²	85	82.1 Å²	82.1	39%	0.394	48%	0.475	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	121.2	175.4	-62.8	-87.5	0	0	0	109	T33 H34	T33-H41 CarbonylContact C-O 3.56Å; T33-H41 WeakPolarHBondContact CA-O 3.48Å; H34-H41 HydrophobicContact CB-CB 4.43Å; H34-H41 PolarHBondContact N-O 3.26Å; H34-H41 PolarHBondContact O-N 2.85Å
42	T	63.3	Low	56.5	Low	79 Å²	79	91.3 Å²	91.3	49%	0.485	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110	114.6	174.5	-54.5	0	0	0	0	109.2	A31 H32 I44	A31-T42 HydrophobicContact CB-CG2 4.1Å; H32-T42 CarbonylContact O-C 3.5Å; H32-T42 WeakPolarHBondContact O-CA 3.4Å; T42-I44 HydrophobicContact CG2-CG1 4.13Å
43	I	63.4	Low	55.7	Low	78 Å²	78	99.9 Å²	99.9	40%	0.4	55%	0.546	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.2	123.2	173.7	-56	174.1	0	0	0	107.4	A31 H32 Y45	A31-I43 CarbonylContact C-O 3.56Å; A31-I43 WeakPolarHBondContact CA-O 3.41Å; H32-I43 HydrophobicContact CB-CB 4.36Å; H32-I43 PolarHBondContact N-O 3.25Å; H32-I43 PolarHBondContact O-N 3.25Å; I43-Y45 HydrophobicContact CB-CE2 4.19Å; I43-Y45 HydrophobicContact CG2-CD2 4.21Å; I43-Y45 HydrophobicContact CG2-CE1 4.39Å; I43-Y45 HydrophobicContact CG2-CE2 3.63Å
44	I	60.3	Low	55.1	Low	69 Å²	69	101.6 Å²	101.6	35%	0.354	57%	0.568	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-108.1	116.4	179.6	-57.4	177.2	0	0	0	108.2	Y29 A31 T42	Y29-I44 HydrophobicContact CD1-CG2 3.77Å; Y29-I44 HydrophobicContact CG-CG2 4.04Å; A31-I44 HydrophobicContact CB-CG1 4.47Å; T42-I44 HydrophobicContact CG2-CG1 4.13Å
45	Y	57.2	Low	54.2	Low	82 Å²	82	107 Å²	107	32%	0.322	60%	0.599	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-91.1	123.8	173.6	-60.1	-95.3	0	0	0	108.4	Y29 T30 H32 I43	Y29-Y45 CarbonylContact C-O 3.54Å; Y29-Y45 WeakPolarHBondContact CA-O 3.37Å; T30-Y45 PolarHBondContact N-O 3.47Å; T30-Y45 WeakPolarHBondContact O-CD2 3.34Å; T30-Y45 PolarHBondContact O-N 3.17Å; H32-Y45 HydrophobicContact CB-CE2 3.98Å; H32-Y45 AromaticContact CD2-CD2 3.48Å; H32-Y45 VanDerWaalsContact CD2-CD2 3.48Å; H32-Y45 WeakPolarHBondContact CD2-CD2 3.12Å; H32-Y45 AromaticContact CD2-CE2 3.19Å; H32-Y45 WeakPolarHBondContact CD2-CE2 3.47Å; H32-Y45 AromaticContact CG-CE2 3.62Å; H32-Y45 AromaticContact NE2-CE2 3.87Å; I43-Y45 HydrophobicContact CB-CE2 4.19Å; I43-Y45 HydrophobicContact CG2-CD2 4.21Å; I43-Y45 HydrophobicContact CG2-CE1 4.39Å; I43-Y45 HydrophobicContact CG2-CE2 3.63Å
46	Q	53.2	Low	54	Low	92 Å²	92	110.4 Å²	110.4	43%	0.43	61%	0.614	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-90	120.3	172.2	-179.7	176.7	-31.7	0	0	109.4	N27 Y29 S48	N27-Q46 HydrophobicContact CB-CG 4.46Å; N27-Q46 VanDerWaalsContact ND2-CD 3.34Å; N27-Q46 PolarHBondContact ND2-NE2 2.93Å; Y29-Q46 HydrophobicContact CD1-CB 3.71Å; Y29-Q46 HydrophobicContact CD1-CG 4Å; Y29-Q46 HydrophobicContact CE1-CB 3.62Å; Y29-Q46 HydrophobicContact CE1-CG 3.52Å; Q46-S48 PolarHBondContact O-N 3.1Å
47	S	50.3	Low	53.2	Low	49 Å²	49	114 Å²	114	34%	0.343	63%	0.634	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-86.7	106.4	169.7	-43.3	0	0	0	0	108.1	I28	I28-S47 WeakPolarHBondContact O-CB 3.15Å; I28-S47 PolarHBondContact O-N 2.83Å; I28-S47 PolarHBondContact O-OG 2.63Å
48	S	48.4	Very low	52.5	Low	89 Å²	89	115.9 Å²	115.9	62%	0.622	63%	0.634	S	S	*	*			trans	-82.7	121.5	173.9	51.9	0	0	0	0	111	Q46	Q46-S48 PolarHBondContact O-N 3.1Å
49	S	48	Very low	51.9	Low	104 Å²	104	114.6 Å²	114.6	73%	0.727	63%	0.627	S	S	*	*	S	Bend	trans	53.1	117.6	155.7	64.6	0	0	0	0	119.2	G51	S49-G51 PolarHBondContact O-N 3.48Å
50	G	45.7	Very low	51.7	Low	100 Å²	100	111.5 Å²	111.5	100%	1.031	62%	0.623	S	S	*	*	S	Bend	trans	52.3	12.1	133.4	0	0	0	0	0	119.9
51	G	39	Very low	50.6	Low	62 Å²	62	113.6 Å²	113.6	64%	0.639	64%	0.636	S	S	*	*			trans	-112.2	139.2	-173.3	0	0	0	0	0	109.9	S49	S49-G51 PolarHBondContact O-N 3.48Å
52	K	43	Very low	49.3	Very low	202 Å²	202	117.5 Å²	117.5	88%	0.878	65%	0.652	S	S	*	*			trans	-47.2	141.5	178.5	-60.6	179	178.8	179.3	0	110.3	G54	K52-G54 PolarHBondContact O-N 3.06Å
53	Y	46.4	Very low	48.3	Very low	241 Å²	241	125.9 Å²	125.9	95%	0.945	68%	0.675	S	S	*	*	S	Bend	trans	-44.4	49.4	179.3	-74.3	-95.8	0	0	0	117.4
54	G	47.5	Very low	47.5	Very low	64 Å²	64	125.8 Å²	125.8	66%	0.66	68%	0.678	S	S	*	*			trans	-156.4	7.7	-166.3	0	0	0	0	0	117.2	K52	K52-G54 PolarHBondContact O-N 3.06Å
55	D	44.7	Very low	46.4	Very low	157 Å²	157	131.4 Å²	131.4	84%	0.84	70%	0.703	S	S	*	*			trans	-110.1	42.9	172.7	-129.5	-3	0	0	0	111.2
56	L	49.1	Very low	45.8	Very low	129 Å²	129	135.8 Å²	135.8	68%	0.675	72%	0.72	S	S	*	*			trans	-87.4	100.5	177.7	-68.7	162	0	0	0	108.2
57	D	48.1	Very low	44.9	Very low	144 Å²	144	142.8 Å²	142.8	77%	0.77	74%	0.742	S	S	*	*			trans	153	58.3	151.4	-76.9	-21	0	0	0	112.3
58	R	46.2	Very low	44.3	Very low	221 Å²	221	148.4 Å²	148.4	83%	0.834	77%	0.765	S	S	*	*			trans	-106	100.8	157.6	-72	-169.9	179.2	176.3	2.5	109.1	L60	R58-L60 PolarHBondContact O-N 3.25Å
59	P	47.8	Very low	43.8	Very low	92 Å²	92	149.9 Å²	149.9	60%	0.597	77%	0.77	S	S	*	*			trans	-58.5	127.7	167.1	24.3	-31.3	0	0	0	107.7	T61	P59-T61 VanDerWaalsContact C-N 3.34Å; P59-T61 PolarHBondContact O-N 3.46Å
60	L	49.9	Very low	43.1	Very low	111 Å²	111	152.5 Å²	152.5	58%	0.581	78%	0.775	S	S	*	*			trans	-57.4	103.2	167.8	-75.6	163.3	0	0	0	106.8	R58 K62	R58-L60 PolarHBondContact O-N 3.25Å; L60-K62 PolarHBondContact O-N 3.12Å
61	T	43.4	Very low	42.6	Very low	135 Å²	135	150 Å²	150	83%	0.828	75%	0.749	S	S	*	*	S	Bend	trans	-71.5	22.4	-179.8	32.1	0	0	0	0	113	P59	P59-T61 VanDerWaalsContact C-N 3.34Å; P59-T61 PolarHBondContact O-N 3.46Å
62	K	39.8	Very low	42.1	Very low	168 Å²	168	153.6 Å²	153.6	73%	0.73	76%	0.764	S	S	*	*	S	Bend	trans	-122.1	114	166.8	-70.6	-170.8	176.4	-174.9	0	107.2	L60 T64	L60-K62 PolarHBondContact O-N 3.12Å; K62-T64 PolarHBondContact O-N 2.92Å; K62-T64 PolarHBondContact O-OG1 2.9Å
63	W	42.7	Very low	41.9	Very low	255 Å²	255	147.1 Å²	147.1	97%	0.966	76%	0.755	S	S	*	*			trans	-61.3	81.8	165.1	-72.6	76.3	0	0	0	107.9	E65	W63-E65 PolarHBondContact O-N 2.9Å
64	T	47.3	Very low	41.3	Very low	76 Å²	76	141.6 Å²	141.6	47%	0.466	75%	0.746	S	S	.	*			trans	-80.7	103.8	172	-43.1	0	0	0	0	106.2	K62 Y66	K62-T64 PolarHBondContact O-N 2.92Å; K62-T64 PolarHBondContact O-OG1 2.9Å; T64-Y66 VanDerWaalsContact C-N 3.32Å; T64-Y66 HydrophobicContact CG2-CD2 4.2Å; T64-Y66 HydrophobicContact CG2-CE1 4.21Å; T64-Y66 HydrophobicContact CG2-CE2 3.68Å; T64-Y66 WeakPolarHBondContact O-CD2 3.48Å; T64-Y66 PolarHBondContact O-N 3.25Å
65	E	36.9	Very low	41	Very low	186 Å²	186	147.3 Å²	147.3	87%	0.869	76%	0.76	S	S	*	*			trans	-65.3	92.5	171.2	-73.3	-173.5	142.4	0	0	109.1	W63 R67	W63-E65 PolarHBondContact O-N 2.9Å; E65-R67 PolarHBondContact O-N 2.94Å
66	Y	43.8	Very low	40.4	Very low	175 Å²	175	145.7 Å²	145.7	69%	0.686	76%	0.756	S	S	*	*			trans	-78.6	103	167.1	-68.9	-80.3	0	0	0	108.6	T64 M68	T64-Y66 VanDerWaalsContact C-N 3.32Å; T64-Y66 HydrophobicContact CG2-CD2 4.2Å; T64-Y66 HydrophobicContact CG2-CE1 4.21Å; T64-Y66 HydrophobicContact CG2-CE2 3.68Å; T64-Y66 WeakPolarHBondContact O-CD2 3.48Å; T64-Y66 PolarHBondContact O-N 3.25Å; Y66-M68 PolarHBondContact O-N 2.94Å; Y66-M68 VanDerWaalsContact O-N 3.17Å
67	R	35.2	Very low	40	Very low	238 Å²	238	143.3 Å²	143.3	90%	0.898	76%	0.763	S	S	*	*			trans	-79.1	92.8	168.5	-139.9	-179.8	-156.1	-158.6	5.7	108.1	E65 V69	E65-R67 PolarHBondContact O-N 2.94Å; R67-V69 PolarHBondContact O-N 2.63Å
68	M	36.9	Very low	39.2	Very low	167 Å²	167	145.7 Å²	145.7	82%	0.823	77%	0.769	S	S	*	*			trans	-76.8	105.4	173.2	-168.2	177.4	-159.7	0	0	109.2	Y66 I70	Y66-M68 PolarHBondContact O-N 2.94Å; Y66-M68 VanDerWaalsContact O-N 3.17Å; M68-I70 HydrophobicContact CG-CG1 4.25Å; M68-I70 PolarHBondContact O-N 3.06Å; M68-I70 HydrophobicContact SD-CG1 4.48Å
69	V	37.7	Very low	39	Very low	120 Å²	120	140.6 Å²	140.6	73%	0.727	77%	0.767	S	S	*	*			trans	-84.6	106.3	169.5	179.7	0	0	0	0	107.7	R67 G71	R67-V69 PolarHBondContact O-N 2.63Å; V69-G71 VanDerWaalsContact C-N 3.33Å; V69-G71 PolarHBondContact O-N 2.93Å; V69-G71 VanDerWaalsContact O-N 3.12Å
70	I	34.6	Very low	38.3	Very low	160 Å²	160	148.7 Å²	148.7	82%	0.821	80%	0.797	S	S	*	*			trans	-82	86.5	172.9	-56	174.7	0	0	0	106.9	M68	M68-I70 HydrophobicContact CG-CG1 4.25Å; M68-I70 PolarHBondContact O-N 3.06Å; M68-I70 HydrophobicContact SD-CG1 4.48Å
71	G	34.5	Very low	37.8	Very low	48 Å²	48	150.6 Å²	150.6	50%	0.495	81%	0.808	S	S	.	*	S	Bend	trans	-173.3	133.9	179.9	0	0	0	0	0	108	V69 G73	V69-G71 VanDerWaalsContact C-N 3.33Å; V69-G71 PolarHBondContact O-N 2.93Å; V69-G71 VanDerWaalsContact O-N 3.12Å; G71-G73 PolarHBondContact O-N 3.12Å
72	S	29.3	Very low	37.5	Very low	137 Å²	137	151.4 Å²	151.4	96%	0.958	81%	0.807	S	S	*	*	S	Bend	trans	-41.8	100.4	-177.2	51.7	0	0	0	0	113.5
73	G	37	Very low	37.3	Very low	66 Å²	66	150.5 Å²	150.5	68%	0.68	81%	0.811	S	S	*	*			trans	165.2	103.6	178.1	0	0	0	0	0	114.8	G71	G71-G73 PolarHBondContact O-N 3.12Å
74	V	34.4	Very low	37	Very low	124 Å²	124	144.4 Å²	144.4	75%	0.752	80%	0.802	S	S	*	*			trans	29.7	113	151.6	-168.8	0	0	0	0	118.7	T76	V74-T76 HydrophobicContact CG1-CG2 3.8Å; V74-T76 PolarHBondContact O-N 2.83Å
75	L	40.7	Very low	36.4	Very low	184 Å²	184	148.6 Å²	148.6	96%	0.963	82%	0.823	S	S	*	*			trans	-75.8	96.6	159.6	-74.8	164.7	0	0	0	109.6
76	T	32.7	Very low	36.3	Very low	124 Å²	124	146.1 Å²	146.1	76%	0.761	82%	0.82	S	S	*	*			trans	-117.3	114.3	157.4	44.4	0	0	0	0	107.8	V74	V74-T76 HydrophobicContact CG1-CG2 3.8Å; V74-T76 PolarHBondContact O-N 2.83Å
77	G	40	Very low	35.8	Very low	79 Å²	79	144.1 Å²	144.1	81%	0.814	83%	0.83	S	S	*	*			trans	-128.9	98.9	172.8	0	0	0	0	0	108.7
78	E	31.9	Very low	35.8	Very low	194 Å²	194	136.8 Å²	136.8	91%	0.907	83%	0.825	S	S	*	*			trans	-76	134.2	164.6	-64	-179.9	137.7	0	0	107.9
79	S	41.7	Very low	35.8	Very low	113 Å²	113	134.3 Å²	134.3	79%	0.79	83%	0.825	S	S	*	*			trans	-78.8	153.9	161.9	68.2	0	0	0	0	108.6
80	Q	34.6	Very low	35.6	Very low	263 Å²	263	135.6 Å²	135.6	100%	1.229	83%	0.834	S	S	*	*			trans	-53.8	0	165.3	-162.1	176.8	13.9	0	0	111.6

Retrieved 80 of 80 residues in 42.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).