A0A5K4F9K8_SCHMA Loading...

Inhibitor of apoptosis-promoting Bax1 family protein

AlphaFold DB , UniProt , Accession A0A5K4F9K8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 123 aa.

						>A0A5K4F9K8_SCHMA|A0A5K4F9K8
MSVILLFITSVLALLIAFVKKISDTFPLNVIILFTYSAAVVFYVLTDIASFFITIFVSQITVGKSALRIFCTEYTLAALLLYNMFSTSYVITTGMVCNITNTCNNSNVSVSLSDNLPRYIVLI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.6	Low	86.3	Confident	223 Å²	223	111.5 Å²	111.5	100%	1.099	61%	0.61	S	S	*	*				0	-36.4	0	-118.2	165.5	128.8	0	0	113.9
2	S	81.6	Confident	86.8	Confident	83 Å²	83	110.3 Å²	110.3	58%	0.58	60%	0.601	S	S	*	*	H	α-helix	trans	-68.8	-37.8	-173.8	-162.1	0	0	0	0	115.4	I4 L5 L6	S2-I4 PolarHBondContact O-N 3.31Å; S2-L5 PolarHBondContact O-N 2.97Å; S2-L6 WeakPolarHBondContact O-CG 3.41Å; S2-L6 PolarHBondContact O-N 2.99Å
3	V	89.1	Confident	87.1	Confident	119 Å²	119	106.3 Å²	106.3	72%	0.721	59%	0.592	S	S	*	*	H	α-helix	trans	-64.8	-42.1	-175.7	-176.6	0	0	0	0	113	L5 L6 F7	V3-L5 VanDerWaalsContact C-N 3.34Å; V3-L5 PolarHBondContact O-N 3.42Å; V3-L6 PolarHBondContact O-N 3.06Å; V3-F7 WeakPolarHBondContact O-CB 3.47Å; V3-F7 PolarHBondContact O-N 3.49Å
4	I	88	Confident	87.4	Confident	122 Å²	122	107.9 Å²	107.9	63%	0.626	60%	0.598	S	S	*	*	H	α-helix	trans	-64.6	-42.1	178.7	-64.6	166.9	0	0	0	110.1	S2 F7 I8	S2-I4 PolarHBondContact O-N 3.31Å; I4-F7 PolarHBondContact O-N 3.3Å; I4-I8 HydrophobicContact CG2-CD1 3.77Å; I4-I8 HydrophobicContact CG2-CG1 4.43Å; I4-I8 VanDerWaalsContact O-CG1 3.26Å; I4-I8 WeakPolarHBondContact O-CG1 3.27Å; I4-I8 PolarHBondContact O-N 2.69Å
5	L	87.4	Confident	87.5	Confident	112 Å²	112	107.2 Å²	107.2	59%	0.586	59%	0.592	S	S	*	*	H	α-helix	trans	-64.6	-44	178	-171	66	0	0	0	111.6	S2 V3 F7 I8 T9	S2-L5 PolarHBondContact O-N 2.97Å; V3-L5 VanDerWaalsContact C-N 3.34Å; V3-L5 PolarHBondContact O-N 3.42Å; L5-F7 VanDerWaalsContact C-N 3.29Å; L5-F7 PolarHBondContact O-N 3.45Å; L5-I8 PolarHBondContact O-N 3.27Å; L5-T9 WeakPolarHBondContact O-CG2 3.46Å; L5-T9 PolarHBondContact O-N 3.41Å; L5-T9 PolarHBondContact O-OG1 2.97Å; L5-T9 VanDerWaalsContact O-OG1 3.13Å
6	L	88.8	Confident	87.6	Confident	109 Å²	109	107 Å²	107	57%	0.571	59%	0.588	S	S	*	*	H	α-helix	trans	-60.4	-38.9	175.3	-74.1	170.2	0	0	0	112.3	S2 V3 T9 S10	S2-L6 WeakPolarHBondContact O-CG 3.41Å; S2-L6 PolarHBondContact O-N 2.99Å; V3-L6 PolarHBondContact O-N 3.06Å; L6-T9 WeakPolarHBondContact CA-OG1 3.5Å; L6-T9 PolarHBondContact O-OG1 3.38Å; L6-T9 VanDerWaalsContact O-OG1 3.06Å; L6-S10 VanDerWaalsContact O-CB 3.27Å; L6-S10 WeakPolarHBondContact O-CB 3.31Å; L6-S10 PolarHBondContact O-N 2.99Å
7	F	89.4	Confident	87.6	Confident	143 Å²	143	104.3 Å²	104.3	63%	0.627	58%	0.583	S	S	*	*	H	α-helix	trans	-66	-47.3	176	-173.3	-99.4	0	0	0	111.3	V3 I4 L5 T9 S10 V11	V3-F7 WeakPolarHBondContact O-CB 3.47Å; V3-F7 PolarHBondContact O-N 3.49Å; I4-F7 PolarHBondContact O-N 3.3Å; L5-F7 VanDerWaalsContact C-N 3.29Å; L5-F7 PolarHBondContact O-N 3.45Å; F7-T9 PolarHBondContact O-N 3.13Å; F7-S10 PolarHBondContact O-N 2.98Å; F7-V11 HydrophobicContact CD1-CG2 4.21Å; F7-V11 HydrophobicContact CE1-CG2 3.87Å; F7-V11 HydrophobicContact CE2-CG2 4.49Å; F7-V11 HydrophobicContact CZ-CG2 4.02Å; F7-V11 VanDerWaalsContact O-CG2 3.31Å; F7-V11 WeakPolarHBondContact O-CG2 3.46Å; F7-V11 PolarHBondContact O-N 3.36Å
8	I	90	Very high	87.5	Confident	95 Å²	95	105.4 Å²	105.4	49%	0.487	58%	0.581	S	S	.	*	H	α-helix	trans	-60.2	-45.9	178.2	-67.6	165.5	0	0	0	111	I4 L5 V11 L12	I4-I8 HydrophobicContact CG2-CD1 3.77Å; I4-I8 HydrophobicContact CG2-CG1 4.43Å; I4-I8 VanDerWaalsContact O-CG1 3.26Å; I4-I8 WeakPolarHBondContact O-CG1 3.27Å; I4-I8 PolarHBondContact O-N 2.69Å; L5-I8 PolarHBondContact O-N 3.27Å; I8-V11 PolarHBondContact O-N 2.91Å; I8-L12 WeakPolarHBondContact O-CB 3.44Å; I8-L12 PolarHBondContact O-N 3.06Å
9	T	91.4	Very high	87.3	Confident	70 Å²	70	104.4 Å²	104.4	43%	0.429	58%	0.578	S	S	.	*	H	α-helix	trans	-66.7	-37.8	179.3	56	0	0	0	0	112.1	L5 L6 F7 L12 A13	L5-T9 WeakPolarHBondContact O-CG2 3.46Å; L5-T9 PolarHBondContact O-N 3.41Å; L5-T9 PolarHBondContact O-OG1 2.97Å; L5-T9 VanDerWaalsContact O-OG1 3.13Å; L6-T9 WeakPolarHBondContact CA-OG1 3.5Å; L6-T9 PolarHBondContact O-OG1 3.38Å; L6-T9 VanDerWaalsContact O-OG1 3.06Å; F7-T9 PolarHBondContact O-N 3.13Å; T9-L12 PolarHBondContact O-N 2.98Å; T9-A13 WeakPolarHBondContact O-CB 3.48Å; T9-A13 PolarHBondContact O-N 3.31Å
10	S	90.5	Very high	87.2	Confident	74 Å²	74	106 Å²	106	52%	0.517	58%	0.579	S	S	.	*	H	α-helix	trans	-61.8	-45	174.1	-177.9	0	0	0	0	112	L6 F7 A13 L14	L6-S10 VanDerWaalsContact O-CB 3.27Å; L6-S10 WeakPolarHBondContact O-CB 3.31Å; L6-S10 PolarHBondContact O-N 2.99Å; F7-S10 PolarHBondContact O-N 2.98Å; S10-A13 PolarHBondContact O-N 3.24Å; S10-L14 WeakPolarHBondContact O-CB 3.5Å; S10-L14 PolarHBondContact O-N 3.06Å
11	V	92	Very high	87	Confident	76 Å²	76	108 Å²	108	46%	0.461	58%	0.582	S	S	.	*	H	α-helix	trans	-64	-44	177.6	172.6	0	0	0	0	110.5	F7 I8 A13 L14 L15	F7-V11 HydrophobicContact CD1-CG2 4.21Å; F7-V11 HydrophobicContact CE1-CG2 3.87Å; F7-V11 HydrophobicContact CE2-CG2 4.49Å; F7-V11 HydrophobicContact CZ-CG2 4.02Å; F7-V11 VanDerWaalsContact O-CG2 3.31Å; F7-V11 WeakPolarHBondContact O-CG2 3.46Å; F7-V11 PolarHBondContact O-N 3.36Å; I8-V11 PolarHBondContact O-N 2.91Å; V11-A13 PolarHBondContact O-N 3.43Å; V11-L14 PolarHBondContact O-N 3.48Å; V11-L15 PolarHBondContact O-N 3.49Å
12	L	92.2	Very high	87.9	Confident	98 Å²	98	100.2 Å²	100.2	51%	0.513	54%	0.544	S	S	.	.	H	α-helix	trans	-62.7	-42.4	177.8	-172.1	65.7	0	0	0	111.9	I8 T9 L14 L15 I16	I8-L12 WeakPolarHBondContact O-CB 3.44Å; I8-L12 PolarHBondContact O-N 3.06Å; T9-L12 PolarHBondContact O-N 2.98Å; L12-L14 VanDerWaalsContact C-N 3.34Å; L12-L14 PolarHBondContact O-N 3.38Å; L12-L15 PolarHBondContact O-N 3.48Å; L12-I16 HydrophobicContact CG-CD1 4.11Å; L12-I16 VanDerWaalsContact O-CG1 3.28Å; L12-I16 WeakPolarHBondContact O-CG1 3.43Å; L12-I16 PolarHBondContact O-N 2.92Å
13	A	90.3	Very high	87.8	Confident	58 Å²	58	99.3 Å²	99.3	48%	0.479	54%	0.538	S	S	.	.	H	α-helix	trans	-62.3	-41.5	176.8	0	0	0	0	0	112	T9 S10 V11 I16 A17	T9-A13 WeakPolarHBondContact O-CB 3.48Å; T9-A13 PolarHBondContact O-N 3.31Å; S10-A13 PolarHBondContact O-N 3.24Å; V11-A13 PolarHBondContact O-N 3.43Å; A13-I16 PolarHBondContact O-N 3.41Å; A13-A17 WeakPolarHBondContact O-CB 3.39Å; A13-A17 PolarHBondContact O-N 3.31Å
14	L	91.1	Very high	87.4	Confident	128 Å²	128	99.5 Å²	99.5	67%	0.67	54%	0.535	S	S	*	.	H	α-helix	trans	-65.4	-40	177.1	-165.5	125.9	0	0	0	111.7	S10 V11 L12 A17 F18	S10-L14 WeakPolarHBondContact O-CB 3.5Å; S10-L14 PolarHBondContact O-N 3.06Å; V11-L14 PolarHBondContact O-N 3.48Å; L12-L14 VanDerWaalsContact C-N 3.34Å; L12-L14 PolarHBondContact O-N 3.38Å; L14-A17 PolarHBondContact O-N 2.98Å; L14-F18 WeakPolarHBondContact O-CB 3.28Å; L14-F18 PolarHBondContact O-N 3.4Å
15	L	88.9	Confident	87.1	Confident	98 Å²	98	98 Å²	98	51%	0.513	53%	0.532	S	S	.	.	H	α-helix	trans	-61.4	-46.8	174.9	-175.9	65.4	0	0	0	111.4	V11 L12 A17 F18 V19	V11-L15 PolarHBondContact O-N 3.49Å; L12-L15 PolarHBondContact O-N 3.48Å; L15-A17 PolarHBondContact O-N 3.28Å; L15-F18 PolarHBondContact O-N 3.36Å; L15-V19 WeakPolarHBondContact O-CG2 3.26Å; L15-V19 PolarHBondContact O-N 2.89Å
16	I	89.1	Confident	86.7	Confident	104 Å²	104	97.3 Å²	97.3	53%	0.533	52%	0.524	S	S	.	.	H	α-helix	trans	-61.9	-44.7	178.1	-66.3	163.2	0	0	0	110.8	L12 A13 F18 V19 K20	L12-I16 HydrophobicContact CG-CD1 4.11Å; L12-I16 VanDerWaalsContact O-CG1 3.28Å; L12-I16 WeakPolarHBondContact O-CG1 3.43Å; L12-I16 PolarHBondContact O-N 2.92Å; A13-I16 PolarHBondContact O-N 3.41Å; I16-F18 VanDerWaalsContact C-N 3.3Å; I16-F18 PolarHBondContact O-N 2.96Å; I16-V19 PolarHBondContact O-N 2.92Å; I16-K20 WeakPolarHBondContact O-CB 3.36Å; I16-K20 PolarHBondContact O-N 2.96Å
17	A	88.3	Confident	86.3	Confident	61 Å²	61	96.2 Å²	96.2	50%	0.504	52%	0.524	S	S	.	.	H	α-helix	trans	-61.3	-39.7	177.7	0	0	0	0	0	112.1	A13 L14 L15 K21	A13-A17 WeakPolarHBondContact O-CB 3.39Å; A13-A17 PolarHBondContact O-N 3.31Å; L14-A17 PolarHBondContact O-N 2.98Å; L15-A17 PolarHBondContact O-N 3.28Å; A17-K21 WeakPolarHBondContact O-CB 3.44Å; A17-K21 PolarHBondContact O-N 2.94Å
18	F	86.2	Confident	85.7	Confident	124 Å²	124	95.1 Å²	95.1	54%	0.544	52%	0.523	S	S	.	.	H	α-helix	trans	-65.8	-46.7	176.5	-175	-103.6	0	0	0	112.1	L14 L15 I16 K20 K21 I22	L14-F18 WeakPolarHBondContact O-CB 3.28Å; L14-F18 PolarHBondContact O-N 3.4Å; L15-F18 PolarHBondContact O-N 3.36Å; I16-F18 VanDerWaalsContact C-N 3.3Å; I16-F18 PolarHBondContact O-N 2.96Å; F18-K20 VanDerWaalsContact C-N 3.32Å; F18-K20 PolarHBondContact O-N 3.29Å; F18-K21 PolarHBondContact O-N 2.95Å; F18-I22 HydrophobicContact CD1-CD1 3.75Å; F18-I22 HydrophobicContact CE1-CD1 3.28Å; F18-I22 HydrophobicContact CE1-CG1 4.32Å; F18-I22 HydrophobicContact CE2-CD1 4.48Å; F18-I22 HydrophobicContact CZ-CD1 3.7Å; F18-I22 HydrophobicContact CZ-CG1 4.44Å; F18-I22 WeakPolarHBondContact O-CG1 3.41Å; F18-I22 PolarHBondContact O-N 3.45Å
19	V	83	Confident	85.2	Confident	87 Å²	87	96.8 Å²	96.8	53%	0.527	53%	0.533	S	S	.	.	H	α-helix	trans	-60.1	-43.2	176.3	172.5	0	0	0	0	110.9	L15 I16 I22 S23	L15-V19 WeakPolarHBondContact O-CG2 3.26Å; L15-V19 PolarHBondContact O-N 2.89Å; I16-V19 PolarHBondContact O-N 2.92Å; V19-I22 PolarHBondContact O-N 3.34Å; V19-S23 WeakPolarHBondContact O-CB 3.48Å; V19-S23 PolarHBondContact O-N 3.03Å
20	K	84.7	Confident	84.6	Confident	135 Å²	135	96.6 Å²	96.6	59%	0.587	53%	0.532	S	S	*	.	H	α-helix	trans	-60.7	-46.6	176	-174.7	174.4	-179.3	179.3	0	111.8	I16 F18 I22 S23 D24	I16-K20 WeakPolarHBondContact O-CB 3.36Å; I16-K20 PolarHBondContact O-N 2.96Å; F18-K20 VanDerWaalsContact C-N 3.32Å; F18-K20 PolarHBondContact O-N 3.29Å; K20-I22 VanDerWaalsContact C-N 3.31Å; K20-I22 PolarHBondContact O-N 3.06Å; K20-S23 WeakPolarHBondContact O-CA 3.38Å; K20-S23 WeakPolarHBondContact O-CB 3.39Å; K20-S23 PolarHBondContact O-N 3.14Å; K20-D24 PolarHBondContact O-N 3.21Å
21	K	84.3	Confident	84.2	Confident	150 Å²	150	95 Å²	95	65%	0.652	52%	0.517	S	S	*	.	H	α-helix	trans	-58.8	-41.6	177.9	-173.3	177.1	-178.6	180	0	112.3	A17 F18 T25	A17-K21 WeakPolarHBondContact O-CB 3.44Å; A17-K21 PolarHBondContact O-N 2.94Å; F18-K21 PolarHBondContact O-N 2.95Å; K21-T25 WeakPolarHBondContact O-CB 3.46Å; K21-T25 PolarHBondContact O-N 2.91Å; K21-T25 PolarHBondContact O-OG1 3.33Å
22	I	80	Confident	83.6	Confident	59 Å²	59	96 Å²	96	30%	0.303	52%	0.519	S	S	.	.	H	α-helix	trans	-63.5	-46.3	173.9	-68.9	173.4	0	0	0	110	F18 V19 K20 D24 T25 F26	F18-I22 HydrophobicContact CD1-CD1 3.75Å; F18-I22 HydrophobicContact CE1-CD1 3.28Å; F18-I22 HydrophobicContact CE1-CG1 4.32Å; F18-I22 HydrophobicContact CE2-CD1 4.48Å; F18-I22 HydrophobicContact CZ-CD1 3.7Å; F18-I22 HydrophobicContact CZ-CG1 4.44Å; F18-I22 WeakPolarHBondContact O-CG1 3.41Å; F18-I22 PolarHBondContact O-N 3.45Å; V19-I22 PolarHBondContact O-N 3.34Å; K20-I22 VanDerWaalsContact C-N 3.31Å; K20-I22 PolarHBondContact O-N 3.06Å; I22-D24 VanDerWaalsContact C-N 3.28Å; I22-D24 PolarHBondContact O-N 3.43Å; I22-T25 PolarHBondContact O-N 3.34Å; I22-T25 VanDerWaalsContact O-N 3.14Å; I22-F26 HydrophobicContact CG2-CD2 3.91Å; I22-F26 HydrophobicContact CG2-CE2 4.47Å; I22-F26 WeakPolarHBondContact O-CD2 3.33Å; I22-F26 PolarHBondContact O-N 2.99Å
23	S	78.5	Confident	83.1	Confident	63 Å²	63	97.1 Å²	97.1	44%	0.441	53%	0.525	S	S	.	.	H	α-helix	trans	-61.9	-34.2	-178.5	-168.3	0	0	0	0	113.8	V19 K20	V19-S23 WeakPolarHBondContact O-CB 3.48Å; V19-S23 PolarHBondContact O-N 3.03Å; K20-S23 WeakPolarHBondContact O-CA 3.38Å; K20-S23 WeakPolarHBondContact O-CB 3.39Å; K20-S23 PolarHBondContact O-N 3.14Å
24	D	80.7	Confident	82.7	Confident	123 Å²	123	101.3 Å²	101.3	66%	0.658	53%	0.532	S	S	*	.	H	α-helix	trans	-79	-25.2	178	-66.4	-25.2	0	0	0	112.1	K20 I22	K20-D24 PolarHBondContact O-N 3.21Å; I22-D24 VanDerWaalsContact C-N 3.28Å; I22-D24 PolarHBondContact O-N 3.43Å
25	T	81.7	Confident	82.4	Confident	92 Å²	92	99.3 Å²	99.3	56%	0.564	53%	0.526	S	S	*	.	H	α-helix	trans	-84.6	-35	-177.1	-55	0	0	0	0	112.2	K21 I22	K21-T25 WeakPolarHBondContact O-CB 3.46Å; K21-T25 PolarHBondContact O-N 2.91Å; K21-T25 PolarHBondContact O-OG1 3.33Å; I22-T25 PolarHBondContact O-N 3.34Å; I22-T25 VanDerWaalsContact O-N 3.14Å
26	F	79	Confident	82.2	Confident	97 Å²	97	102.4 Å²	102.4	43%	0.425	53%	0.532	S	S	.	.	S	Bend	trans	-113.7	137.5	-171.4	-65.8	-75.6	0	0	0	111.7	I22 V30 I31	I22-F26 HydrophobicContact CG2-CD2 3.91Å; I22-F26 HydrophobicContact CG2-CE2 4.47Å; I22-F26 WeakPolarHBondContact O-CD2 3.33Å; I22-F26 PolarHBondContact O-N 2.99Å; F26-V30 HydrophobicContact CB-CB 4.16Å; F26-V30 HydrophobicContact CB-CG1 4.12Å; F26-V30 HydrophobicContact CD1-CG1 3.81Å; F26-V30 HydrophobicContact CG-CG1 4.13Å; F26-I31 HydrophobicContact CB-CG1 4.08Å
27	P	80.5	Confident	81.9	Confident	86 Å²	86	100 Å²	100	56%	0.558	53%	0.525	S	S	*	.			trans	-62.1	149.2	172.1	27.1	-33.1	0	0	0	110.2	N29 V30	P27-N29 PolarHBondContact O-N 3.21Å; P27-V30 HydrophobicContact CG-CB 4.5Å; P27-V30 HydrophobicContact CG-CG2 3.87Å; P27-V30 WeakPolarHBondContact O-CB 3.49Å; P27-V30 PolarHBondContact O-N 2.87Å
28	L	77.6	Confident	81.9	Confident	119 Å²	119	99.5 Å²	99.5	62%	0.623	52%	0.52	S	S	*	.	H	α-helix	trans	-46.5	-39.6	-173.3	-164.5	77.7	0	0	0	113.5	V30 I31 I32	L28-V30 VanDerWaalsContact C-N 3.29Å; L28-V30 PolarHBondContact O-N 2.93Å; L28-I31 PolarHBondContact O-N 3.39Å; L28-I32 HydrophobicContact CD2-CD1 4.22Å; L28-I32 HydrophobicContact CG-CD1 4Å; L28-I32 WeakPolarHBondContact O-CG1 3.46Å; L28-I32 PolarHBondContact O-N 3.35Å
29	N	78.9	Confident	81.9	Confident	130 Å²	130	96.3 Å²	96.3	70%	0.695	52%	0.517	S	S	*	.	H	α-helix	trans	-60.3	-35.6	-179.5	-63.8	18.3	0	0	0	113.1	P27 L33	P27-N29 PolarHBondContact O-N 3.21Å; N29-L33 WeakPolarHBondContact O-CB 3.42Å; N29-L33 PolarHBondContact O-N 2.97Å; N29-L33 VanDerWaalsContact O-N 3.1Å
30	V	78.8	Confident	82.1	Confident	66 Å²	66	95.3 Å²	95.3	40%	0.4	51%	0.511	S	S	.	.	H	α-helix	trans	-73.9	-38.3	179.5	174.6	0	0	0	0	110.7	F26 P27 L28 L33 F34	F26-V30 HydrophobicContact CB-CB 4.16Å; F26-V30 HydrophobicContact CB-CG1 4.12Å; F26-V30 HydrophobicContact CD1-CG1 3.81Å; F26-V30 HydrophobicContact CG-CG1 4.13Å; P27-V30 HydrophobicContact CG-CB 4.5Å; P27-V30 HydrophobicContact CG-CG2 3.87Å; P27-V30 WeakPolarHBondContact O-CB 3.49Å; P27-V30 PolarHBondContact O-N 2.87Å; L28-V30 VanDerWaalsContact C-N 3.29Å; L28-V30 PolarHBondContact O-N 2.93Å; V30-L33 PolarHBondContact O-N 3.46Å; V30-F34 WeakPolarHBondContact O-CB 3.39Å; V30-F34 PolarHBondContact O-N 2.91Å
31	I	81.6	Confident	82.2	Confident	40 Å²	40	93 Å²	93	21%	0.205	51%	0.508	C	S	.	.	H	α-helix	trans	-64.4	-43.5	176.9	-57	166.2	0	0	0	110.3	F26 L28 F34 T35	F26-I31 HydrophobicContact CB-CG1 4.08Å; L28-I31 PolarHBondContact O-N 3.39Å; I31-F34 PolarHBondContact O-N 2.89Å; I31-T35 WeakPolarHBondContact O-CB 3.43Å; I31-T35 PolarHBondContact O-N 3.02Å; I31-T35 PolarHBondContact O-OG1 3.41Å
32	I	80.3	Confident	82.5	Confident	99 Å²	99	92.7 Å²	92.7	51%	0.508	51%	0.506	S	S	.	.	H	α-helix	trans	-61.6	-46.4	176.7	-66.4	165.1	0	0	0	110.2	L28 F34 T35 Y36	L28-I32 HydrophobicContact CD2-CD1 4.22Å; L28-I32 HydrophobicContact CG-CD1 4Å; L28-I32 WeakPolarHBondContact O-CG1 3.46Å; L28-I32 PolarHBondContact O-N 3.35Å; I32-F34 PolarHBondContact O-N 3.24Å; I32-T35 PolarHBondContact O-N 2.72Å; I32-Y36 WeakPolarHBondContact O-CB 3.48Å; I32-Y36 PolarHBondContact O-N 3.3Å
33	L	81	Confident	82.9	Confident	120 Å²	120	97.5 Å²	97.5	63%	0.628	52%	0.522	S	S	*	.	H	α-helix	trans	-61	-45	178.8	-176.4	64.6	0	0	0	111.7	N29 V30 Y36 S37	N29-L33 WeakPolarHBondContact O-CB 3.42Å; N29-L33 PolarHBondContact O-N 2.97Å; N29-L33 VanDerWaalsContact O-N 3.1Å; V30-L33 PolarHBondContact O-N 3.46Å; L33-Y36 PolarHBondContact O-N 3.1Å; L33-S37 WeakPolarHBondContact O-CB 3.23Å; L33-S37 PolarHBondContact O-N 3.29Å; L33-S37 PolarHBondContact O-OG 3.39Å
34	F	83.4	Confident	83.4	Confident	146 Å²	146	97.8 Å²	97.8	64%	0.64	52%	0.521	S	S	*	.	H	α-helix	trans	-61.2	-46.7	176.6	-171.8	-97.3	0	0	0	111.4	V30 I31 I32 Y36 S37 A38	V30-F34 WeakPolarHBondContact O-CB 3.39Å; V30-F34 PolarHBondContact O-N 2.91Å; I31-F34 PolarHBondContact O-N 2.89Å; I32-F34 PolarHBondContact O-N 3.24Å; F34-Y36 VanDerWaalsContact C-N 3.35Å; F34-Y36 PolarHBondContact O-N 3.43Å; F34-S37 PolarHBondContact O-N 2.72Å; F34-S37 PolarHBondContact O-OG 2.91Å; F34-A38 WeakPolarHBondContact O-CB 3.32Å; F34-A38 PolarHBondContact O-N 2.87Å
35	T	84.6	Confident	83.7	Confident	86 Å²	86	97.1 Å²	97.1	53%	0.528	52%	0.517	S	S	.	.	H	α-helix	trans	-60.7	-43.9	178.6	-52.9	0	0	0	0	111.5	I31 I32 A38 A39	I31-T35 WeakPolarHBondContact O-CB 3.43Å; I31-T35 PolarHBondContact O-N 3.02Å; I31-T35 PolarHBondContact O-OG1 3.41Å; I32-T35 PolarHBondContact O-N 2.72Å; T35-A38 PolarHBondContact O-N 2.92Å; T35-A39 WeakPolarHBondContact O-CB 3.44Å; T35-A39 PolarHBondContact O-N 3.36Å
36	Y	84.1	Confident	83.9	Confident	163 Å²	163	95.6 Å²	95.6	64%	0.639	51%	0.507	S	S	*	.	H	α-helix	trans	-62.9	-46.4	176.2	-174.9	-97.7	0	0	0	111.4	I32 L33 F34 A38 A39 V40	I32-Y36 WeakPolarHBondContact O-CB 3.48Å; I32-Y36 PolarHBondContact O-N 3.3Å; L33-Y36 PolarHBondContact O-N 3.1Å; F34-Y36 VanDerWaalsContact C-N 3.35Å; F34-Y36 PolarHBondContact O-N 3.43Å; Y36-A38 VanDerWaalsContact C-N 3.34Å; Y36-A38 PolarHBondContact O-N 3.46Å; Y36-A39 PolarHBondContact O-N 3.42Å; Y36-V40 HydrophobicContact CD1-CG2 4.15Å; Y36-V40 HydrophobicContact CE1-CG2 3.8Å; Y36-V40 WeakPolarHBondContact O-CG2 3.32Å; Y36-V40 PolarHBondContact O-N 2.97Å
37	S	83.5	Confident	84.3	Confident	55 Å²	55	95.2 Å²	95.2	39%	0.385	51%	0.51	S	S	.	.	H	α-helix	trans	-60.9	-42.4	177.9	72.9	0	0	0	0	112.4	L33 F34 V40 V41	L33-S37 WeakPolarHBondContact O-CB 3.23Å; L33-S37 PolarHBondContact O-N 3.29Å; L33-S37 PolarHBondContact O-OG 3.39Å; F34-S37 PolarHBondContact O-N 2.72Å; F34-S37 PolarHBondContact O-OG 2.91Å; S37-V40 PolarHBondContact O-N 3.4Å; S37-V41 WeakPolarHBondContact O-CG2 3.4Å; S37-V41 PolarHBondContact O-N 3.06Å
38	A	87	Confident	84.5	Confident	49 Å²	49	95.1 Å²	95.1	41%	0.405	50%	0.504	S	S	.	.	H	α-helix	trans	-65.2	-40.5	177	0	0	0	0	0	111.7	F34 T35 Y36 V41 F42	F34-A38 WeakPolarHBondContact O-CB 3.32Å; F34-A38 PolarHBondContact O-N 2.87Å; T35-A38 PolarHBondContact O-N 2.92Å; Y36-A38 VanDerWaalsContact C-N 3.34Å; Y36-A38 PolarHBondContact O-N 3.46Å; A38-V41 PolarHBondContact O-N 3.24Å; A38-F42 WeakPolarHBondContact O-CB 3.39Å; A38-F42 PolarHBondContact O-N 3.42Å
39	A	87	Confident	84.8	Confident	58 Å²	58	91.6 Å²	91.6	48%	0.479	49%	0.492	S	S	.	.	H	α-helix	trans	-64	-42.5	176.9	0	0	0	0	0	112.2	T35 Y36 F42 Y43	T35-A39 WeakPolarHBondContact O-CB 3.44Å; T35-A39 PolarHBondContact O-N 3.36Å; Y36-A39 PolarHBondContact O-N 3.42Å; A39-F42 PolarHBondContact O-N 2.89Å; A39-Y43 WeakPolarHBondContact O-CB 3.32Å; A39-Y43 PolarHBondContact O-N 3.35Å
40	V	86.8	Confident	84.8	Confident	66 Å²	66	88 Å²	88	40%	0.4	48%	0.476	S	S	.	.	H	α-helix	trans	-62.3	-46.3	176.1	172.8	0	0	0	0	110.8	Y36 S37 F42 Y43 V44	Y36-V40 HydrophobicContact CD1-CG2 4.15Å; Y36-V40 HydrophobicContact CE1-CG2 3.8Å; Y36-V40 WeakPolarHBondContact O-CG2 3.32Å; Y36-V40 PolarHBondContact O-N 2.97Å; S37-V40 PolarHBondContact O-N 3.4Å; V40-F42 VanDerWaalsContact C-N 3.35Å; V40-F42 PolarHBondContact O-N 3.41Å; V40-Y43 PolarHBondContact O-N 2.92Å; V40-V44 WeakPolarHBondContact O-CG2 3.45Å; V40-V44 PolarHBondContact O-N 2.91Å
41	V	87.2	Confident	84.7	Confident	86 Å²	86	90.9 Å²	90.9	52%	0.521	48%	0.484	S	S	.	.	H	α-helix	trans	-60.3	-45.7	176.7	172.3	0	0	0	0	110.9	S37 A38 Y43 V44 L45	S37-V41 WeakPolarHBondContact O-CG2 3.4Å; S37-V41 PolarHBondContact O-N 3.06Å; A38-V41 PolarHBondContact O-N 3.24Å; V41-Y43 PolarHBondContact O-N 2.95Å; V41-V44 PolarHBondContact O-N 3.42Å; V41-L45 HydrophobicContact CG1-CD1 3.84Å; V41-L45 VanDerWaalsContact O-CD1 3.23Å; V41-L45 WeakPolarHBondContact O-CD1 3.43Å; V41-L45 PolarHBondContact O-N 3.28Å
42	F	89.7	Confident	84.4	Confident	143 Å²	143	94.3 Å²	94.3	63%	0.627	50%	0.498	S	S	*	.	H	α-helix	trans	-60.1	-45.2	177.8	-174.2	-95.5	0	0	0	111.9	A38 A39 V40 V44 L45 T46	A38-F42 WeakPolarHBondContact O-CB 3.39Å; A38-F42 PolarHBondContact O-N 3.42Å; A39-F42 PolarHBondContact O-N 2.89Å; V40-F42 VanDerWaalsContact C-N 3.35Å; V40-F42 PolarHBondContact O-N 3.41Å; F42-V44 PolarHBondContact O-N 3.41Å; F42-L45 PolarHBondContact O-N 2.96Å; F42-T46 HydrophobicContact CD1-CG2 4.05Å; F42-T46 HydrophobicContact CE1-CG2 3.63Å; F42-T46 HydrophobicContact CE2-CG2 4.45Å; F42-T46 HydrophobicContact CZ-CG2 3.86Å; F42-T46 WeakPolarHBondContact O-CG2 3.35Å; F42-T46 PolarHBondContact O-N 3.15Å; F42-T46 PolarHBondContact O-OG1 3.5Å
43	Y	88.4	Confident	84.1	Confident	160 Å²	160	94.6 Å²	94.6	63%	0.627	50%	0.499	S	S	*	.	H	α-helix	trans	-58.3	-48.1	177	-178.8	-98	0	0	0	111.9	A39 V40 V41 L45 T46 D47	A39-Y43 WeakPolarHBondContact O-CB 3.32Å; A39-Y43 PolarHBondContact O-N 3.35Å; V40-Y43 PolarHBondContact O-N 2.92Å; V41-Y43 PolarHBondContact O-N 2.95Å; Y43-L45 PolarHBondContact O-N 3Å; Y43-T46 WeakPolarHBondContact CA-OG1 3.34Å; Y43-T46 PolarHBondContact O-N 3.47Å; Y43-T46 PolarHBondContact O-OG1 3.25Å; Y43-D47 WeakPolarHBondContact O-CB 3.45Å; Y43-D47 PolarHBondContact O-N 3.46Å
44	V	89	Confident	83.7	Confident	70 Å²	70	93.2 Å²	93.2	42%	0.424	50%	0.496	S	S	.	.	H	α-helix	trans	-61.1	-43.5	177.7	173.3	0	0	0	0	111.3	V40 V41 F42 D47 I48	V40-V44 WeakPolarHBondContact O-CG2 3.45Å; V40-V44 PolarHBondContact O-N 2.91Å; V41-V44 PolarHBondContact O-N 3.42Å; F42-V44 PolarHBondContact O-N 3.41Å; V44-D47 PolarHBondContact O-N 3.02Å; V44-I48 HydrophobicContact CG1-CD1 3.78Å; V44-I48 HydrophobicContact CG1-CG1 4.47Å; V44-I48 VanDerWaalsContact O-CG1 3.25Å; V44-I48 WeakPolarHBondContact O-CG1 3.21Å; V44-I48 PolarHBondContact O-N 3.44Å
45	L	88	Confident	83	Confident	108 Å²	108	89.2 Å²	89.2	57%	0.565	48%	0.481	S	S	*	.	H	α-helix	trans	-62.5	-43.5	176.5	-96.8	74.2	0	0	0	112	V41 F42 Y43 D47 I48 A49	V41-L45 HydrophobicContact CG1-CD1 3.84Å; V41-L45 VanDerWaalsContact O-CD1 3.23Å; V41-L45 WeakPolarHBondContact O-CD1 3.43Å; V41-L45 PolarHBondContact O-N 3.28Å; F42-L45 PolarHBondContact O-N 2.96Å; Y43-L45 PolarHBondContact O-N 3Å; L45-D47 VanDerWaalsContact C-N 3.33Å; L45-I48 PolarHBondContact O-N 2.74Å; L45-A49 VanDerWaalsContact O-CB 3.32Å; L45-A49 WeakPolarHBondContact O-CB 3.33Å; L45-A49 PolarHBondContact O-N 3.22Å
46	T	85.8	Confident	81.8	Confident	60 Å²	60	91 Å²	91	37%	0.368	48%	0.481	S	S	.	.	H	α-helix	trans	-65.3	-37.5	178.1	50.7	0	0	0	0	112.2	F42 Y43 A49 S50	F42-T46 HydrophobicContact CD1-CG2 4.05Å; F42-T46 HydrophobicContact CE1-CG2 3.63Å; F42-T46 HydrophobicContact CE2-CG2 4.45Å; F42-T46 HydrophobicContact CZ-CG2 3.86Å; F42-T46 WeakPolarHBondContact O-CG2 3.35Å; F42-T46 PolarHBondContact O-N 3.15Å; F42-T46 PolarHBondContact O-OG1 3.5Å; Y43-T46 WeakPolarHBondContact CA-OG1 3.34Å; Y43-T46 PolarHBondContact O-N 3.47Å; Y43-T46 PolarHBondContact O-OG1 3.25Å; T46-A49 PolarHBondContact O-N 3.43Å; T46-S50 WeakPolarHBondContact O-CB 3.39Å; T46-S50 PolarHBondContact O-N 3.33Å
47	D	86.7	Confident	80.7	Confident	90 Å²	90	86.9 Å²	86.9	48%	0.481	47%	0.473	S	S	.	.	H	α-helix	trans	-66	-47.9	177.9	-169.2	45.6	0	0	0	110.8	Y43 V44 L45 A49 S50 F51	Y43-D47 WeakPolarHBondContact O-CB 3.45Å; Y43-D47 PolarHBondContact O-N 3.46Å; V44-D47 PolarHBondContact O-N 3.02Å; L45-D47 VanDerWaalsContact C-N 3.33Å; D47-A49 PolarHBondContact O-N 2.88Å; D47-S50 WeakPolarHBondContact O-CB 3.47Å; D47-S50 PolarHBondContact O-N 3.31Å; D47-S50 VanDerWaalsContact O-N 3.14Å; D47-S50 PolarHBondContact O-OG 2.91Å; D47-F51 PolarHBondContact O-N 2.84Å
48	I	85.7	Confident	79.4	Confident	84 Å²	84	87.2 Å²	87.2	43%	0.431	48%	0.475	S	S	.	.	H	α-helix	trans	-58	-46.7	173.7	-67.4	167.2	0	0	0	111	V44 L45 S50 F51 F52	V44-I48 HydrophobicContact CG1-CD1 3.78Å; V44-I48 HydrophobicContact CG1-CG1 4.47Å; V44-I48 VanDerWaalsContact O-CG1 3.25Å; V44-I48 WeakPolarHBondContact O-CG1 3.21Å; V44-I48 PolarHBondContact O-N 3.44Å; L45-I48 PolarHBondContact O-N 2.74Å; I48-S50 VanDerWaalsContact C-N 3.31Å; I48-S50 PolarHBondContact O-N 3.36Å; I48-F51 WeakPolarHBondContact O-CB 3.15Å; I48-F51 PolarHBondContact O-N 3Å; I48-F52 HydrophobicContact CG2-CD2 3.65Å; I48-F52 HydrophobicContact CG2-CE2 3.4Å; I48-F52 VanDerWaalsContact CG2-CE2 3.4Å; I48-F52 WeakPolarHBondContact O-CD2 3.15Å; I48-F52 PolarHBondContact O-N 2.86Å
49	A	82.9	Confident	77.8	Confident	45 Å²	45	90.9 Å²	90.9	37%	0.372	48%	0.484	S	S	.	.	H	α-helix	trans	-61.3	-41.5	177.5	0	0	0	0	0	111.5	L45 T46 D47 F51 F52 I53	L45-A49 VanDerWaalsContact O-CB 3.32Å; L45-A49 WeakPolarHBondContact O-CB 3.33Å; L45-A49 PolarHBondContact O-N 3.22Å; T46-A49 PolarHBondContact O-N 3.43Å; D47-A49 PolarHBondContact O-N 2.88Å; A49-F51 VanDerWaalsContact C-N 3.32Å; A49-F51 PolarHBondContact O-N 3.14Å; A49-F52 PolarHBondContact O-N 3.46Å; A49-I53 WeakPolarHBondContact O-CB 3.42Å; A49-I53 WeakPolarHBondContact O-CD1 3.21Å; A49-I53 WeakPolarHBondContact O-CG1 3.32Å; A49-I53 PolarHBondContact O-N 2.89Å
50	S	78.8	Confident	76.3	Confident	53 Å²	53	93.5 Å²	93.5	37%	0.371	49%	0.489	S	S	.	.	H	α-helix	trans	-64.1	-37.9	176.8	84.2	0	0	0	0	111.9	T46 D47 I48 I53 T54	T46-S50 WeakPolarHBondContact O-CB 3.39Å; T46-S50 PolarHBondContact O-N 3.33Å; D47-S50 WeakPolarHBondContact O-CB 3.47Å; D47-S50 PolarHBondContact O-N 3.31Å; D47-S50 VanDerWaalsContact O-N 3.14Å; D47-S50 PolarHBondContact O-OG 2.91Å; I48-S50 VanDerWaalsContact C-N 3.31Å; I48-S50 PolarHBondContact O-N 3.36Å; S50-I53 PolarHBondContact O-N 3.17Å; S50-T54 VanDerWaalsContact O-CB 3.3Å; S50-T54 WeakPolarHBondContact O-CB 3.25Å; S50-T54 PolarHBondContact O-N 2.7Å; S50-T54 PolarHBondContact O-OG1 2.71Å
51	F	76.5	Confident	74.6	Confident	128 Å²	128	93.7 Å²	93.7	56%	0.561	49%	0.49	S	S	*	.	H	α-helix	trans	-63.2	-48	175.3	-179.1	-102.6	0	0	0	111.3	D47 I48 A49 T54 I55	D47-F51 PolarHBondContact O-N 2.84Å; I48-F51 WeakPolarHBondContact O-CB 3.15Å; I48-F51 PolarHBondContact O-N 3Å; A49-F51 VanDerWaalsContact C-N 3.32Å; A49-F51 PolarHBondContact O-N 3.14Å; F51-T54 PolarHBondContact O-N 2.8Å; F51-I55 HydrophobicContact CD1-CD1 3.71Å; F51-I55 HydrophobicContact CE1-CD1 3.25Å; F51-I55 HydrophobicContact CE1-CG1 4.42Å; F51-I55 HydrophobicContact CE2-CD1 4.24Å; F51-I55 HydrophobicContact CG-CD1 4.39Å; F51-I55 HydrophobicContact CZ-CD1 3.56Å; F51-I55 HydrophobicContact CZ-CG1 4.47Å; F51-I55 WeakPolarHBondContact O-CG1 3.45Å; F51-I55 PolarHBondContact O-N 3.36Å
52	F	75.7	Confident	72.7	Confident	112 Å²	112	93.5 Å²	93.5	49%	0.491	49%	0.489	S	S	.	.	H	α-helix	trans	-61.9	-47	175.4	-78	-68.4	0	0	0	112.2	I48 A49 T54 I55 F56	I48-F52 HydrophobicContact CG2-CD2 3.65Å; I48-F52 HydrophobicContact CG2-CE2 3.4Å; I48-F52 VanDerWaalsContact CG2-CE2 3.4Å; I48-F52 WeakPolarHBondContact O-CD2 3.15Å; I48-F52 PolarHBondContact O-N 2.86Å; A49-F52 PolarHBondContact O-N 3.46Å; F52-T54 VanDerWaalsContact C-N 3.27Å; F52-T54 PolarHBondContact O-N 2.96Å; F52-I55 PolarHBondContact O-N 3.29Å; F52-I55 VanDerWaalsContact O-N 3.17Å; F52-F56 HydrophobicContact CB-CD2 4.48Å; F52-F56 WeakPolarHBondContact O-CD2 3.43Å; F52-F56 PolarHBondContact O-N 3.45Å
53	I	75.4	Confident	70.5	Confident	105 Å²	105	89.7 Å²	89.7	54%	0.538	49%	0.49	S	S	.	.	H	α-helix	trans	-57.8	-43.9	177.1	-69.4	164.1	0	0	0	110	A49 S50 I55 F56 V57	A49-I53 WeakPolarHBondContact O-CB 3.42Å; A49-I53 WeakPolarHBondContact O-CD1 3.21Å; A49-I53 WeakPolarHBondContact O-CG1 3.32Å; A49-I53 PolarHBondContact O-N 2.89Å; S50-I53 PolarHBondContact O-N 3.17Å; I53-I55 PolarHBondContact O-N 2.88Å; I53-F56 PolarHBondContact O-N 3.47Å; I53-V57 HydrophobicContact CG2-CG2 4.07Å; I53-V57 VanDerWaalsContact O-CB 3.32Å; I53-V57 WeakPolarHBondContact O-CB 3.49Å; I53-V57 WeakPolarHBondContact O-CG2 3.28Å; I53-V57 PolarHBondContact O-N 3.29Å
54	T	71.7	Confident	68.5	Low	91 Å²	91	90.4 Å²	90.4	56%	0.558	50%	0.497	S	S	*	.	H	α-helix	trans	-62.6	-41.4	178.5	-57.5	0	0	0	0	111.6	S50 F51 F52 S58	S50-T54 VanDerWaalsContact O-CB 3.3Å; S50-T54 WeakPolarHBondContact O-CB 3.25Å; S50-T54 PolarHBondContact O-N 2.7Å; S50-T54 PolarHBondContact O-OG1 2.71Å; F51-T54 PolarHBondContact O-N 2.8Å; F52-T54 VanDerWaalsContact C-N 3.27Å; F52-T54 PolarHBondContact O-N 2.96Å; T54-S58 WeakPolarHBondContact O-CB 3.39Å; T54-S58 PolarHBondContact O-N 3.45Å
55	I	68.4	Low	66.4	Low	62 Å²	62	88.7 Å²	88.7	32%	0.318	49%	0.487	S	S	.	.	H	α-helix	trans	-63.8	-47.8	174.5	-68.9	169.5	0	0	0	111.1	F51 F52 I53 S58 Q59	F51-I55 HydrophobicContact CD1-CD1 3.71Å; F51-I55 HydrophobicContact CE1-CD1 3.25Å; F51-I55 HydrophobicContact CE1-CG1 4.42Å; F51-I55 HydrophobicContact CE2-CD1 4.24Å; F51-I55 HydrophobicContact CG-CD1 4.39Å; F51-I55 HydrophobicContact CZ-CD1 3.56Å; F51-I55 HydrophobicContact CZ-CG1 4.47Å; F51-I55 WeakPolarHBondContact O-CG1 3.45Å; F51-I55 PolarHBondContact O-N 3.36Å; F52-I55 PolarHBondContact O-N 3.29Å; F52-I55 VanDerWaalsContact O-N 3.17Å; I53-I55 PolarHBondContact O-N 2.88Å; I55-S58 WeakPolarHBondContact O-CB 3.09Å; I55-S58 PolarHBondContact O-N 3.49Å; I55-Q59 WeakPolarHBondContact O-CG 3.22Å; I55-Q59 PolarHBondContact O-N 3.26Å
56	F	59.6	Low	64.2	Low	124 Å²	124	87 Å²	87	54%	0.544	49%	0.489	S	S	.	.	H	α-helix	trans	-63.2	-43.9	179.6	-82.6	-69.3	0	0	0	111.9	F52 I53 S58 Q59 I60	F52-F56 HydrophobicContact CB-CD2 4.48Å; F52-F56 WeakPolarHBondContact O-CD2 3.43Å; F52-F56 PolarHBondContact O-N 3.45Å; I53-F56 PolarHBondContact O-N 3.47Å; F56-S58 VanDerWaalsContact C-N 3.31Å; F56-S58 PolarHBondContact O-N 2.89Å; F56-Q59 PolarHBondContact O-N 2.86Å; F56-I60 WeakPolarHBondContact O-CB 3.3Å; F56-I60 VanDerWaalsContact O-CG1 3.28Å; F56-I60 WeakPolarHBondContact O-CG1 3.5Å; F56-I60 PolarHBondContact O-N 3.48Å
57	V	60.5	Low	61.9	Low	76 Å²	76	91.8 Å²	91.8	46%	0.461	51%	0.511	S	S	.	.	H	α-helix	trans	-63	-40.2	174.8	172.1	0	0	0	0	110.2	I53 I60 T61	I53-V57 HydrophobicContact CG2-CG2 4.07Å; I53-V57 VanDerWaalsContact O-CB 3.32Å; I53-V57 WeakPolarHBondContact O-CB 3.49Å; I53-V57 WeakPolarHBondContact O-CG2 3.28Å; I53-V57 PolarHBondContact O-N 3.29Å; V57-I60 PolarHBondContact O-N 3.21Å; V57-T61 WeakPolarHBondContact O-CA 3.48Å; V57-T61 WeakPolarHBondContact O-CB 3.1Å; V57-T61 PolarHBondContact O-N 3.36Å; V57-T61 PolarHBondContact O-OG1 3.2Å
58	S	56	Low	59.7	Low	62 Å²	62	96.7 Å²	96.7	43%	0.434	52%	0.523	S	S	.	.	H	α-helix	trans	-61.2	-45.7	174.1	-174.4	0	0	0	0	111.3	T54 I55 F56 I60 T61 V62	T54-S58 WeakPolarHBondContact O-CB 3.39Å; T54-S58 PolarHBondContact O-N 3.45Å; I55-S58 WeakPolarHBondContact O-CB 3.09Å; I55-S58 PolarHBondContact O-N 3.49Å; F56-S58 VanDerWaalsContact C-N 3.31Å; F56-S58 PolarHBondContact O-N 2.89Å; S58-I60 PolarHBondContact O-N 2.84Å; S58-T61 PolarHBondContact O-N 2.94Å; S58-V62 VanDerWaalsContact O-CB 3.32Å; S58-V62 WeakPolarHBondContact O-CB 3.32Å; S58-V62 WeakPolarHBondContact O-CG2 3.43Å; S58-V62 PolarHBondContact O-N 3.5Å
59	Q	54.2	Low	57.8	Low	126 Å²	126	98.3 Å²	98.3	59%	0.589	53%	0.532	S	S	*	.	H	α-helix	trans	-65	-42	177.4	-69.3	-170.5	38.3	0	0	113.1	I55 F56 V62 G63	I55-Q59 WeakPolarHBondContact O-CG 3.22Å; I55-Q59 PolarHBondContact O-N 3.26Å; F56-Q59 PolarHBondContact O-N 2.86Å; Q59-V62 PolarHBondContact O-N 2.78Å; Q59-G63 PolarHBondContact O-N 3.33Å
60	I	55.2	Low	55.8	Low	113 Å²	113	105.5 Å²	105.5	58%	0.579	56%	0.555	S	S	*	*	H	α-helix	trans	-67.3	-40.3	176.3	-66.6	167.1	0	0	0	110.7	F56 V57 S58 G63 K64	F56-I60 WeakPolarHBondContact O-CB 3.3Å; F56-I60 VanDerWaalsContact O-CG1 3.28Å; F56-I60 WeakPolarHBondContact O-CG1 3.5Å; F56-I60 PolarHBondContact O-N 3.48Å; V57-I60 PolarHBondContact O-N 3.21Å; S58-I60 PolarHBondContact O-N 2.84Å; I60-G63 PolarHBondContact O-N 3.14Å; I60-K64 PolarHBondContact O-N 2.77Å; I60-K64 VanDerWaalsContact O-N 3.14Å
61	T	52.1	Low	53.7	Low	70 Å²	70	107.1 Å²	107.1	43%	0.429	57%	0.565	S	S	.	*	H	α-helix	trans	-68.5	-41.3	178.7	-57.7	0	0	0	0	110.2	V57 S58 G63 K64 S65	V57-T61 WeakPolarHBondContact O-CA 3.48Å; V57-T61 WeakPolarHBondContact O-CB 3.1Å; V57-T61 PolarHBondContact O-N 3.36Å; V57-T61 PolarHBondContact O-OG1 3.2Å; S58-T61 PolarHBondContact O-N 2.94Å; T61-G63 VanDerWaalsContact C-N 3.34Å; T61-K64 CarbonylContact O-C 3.52Å; T61-K64 PolarHBondContact O-N 2.65Å; T61-S65 WeakPolarHBondContact O-CA 3.47Å; T61-S65 WeakPolarHBondContact O-CB 3.13Å; T61-S65 PolarHBondContact O-N 2.75Å
62	V	45.9	Very low	52	Low	81 Å²	81	106.5 Å²	106.5	49%	0.491	57%	0.572	S	S	.	*	H	α-helix	trans	-66.9	-35.4	175.2	176.3	0	0	0	0	111.2	S58 Q59 K64 S65 A66	S58-V62 VanDerWaalsContact O-CB 3.32Å; S58-V62 WeakPolarHBondContact O-CB 3.32Å; S58-V62 WeakPolarHBondContact O-CG2 3.43Å; S58-V62 PolarHBondContact O-N 3.5Å; Q59-V62 PolarHBondContact O-N 2.78Å; V62-K64 VanDerWaalsContact C-N 3.29Å; V62-K64 PolarHBondContact O-N 3.45Å; V62-S65 PolarHBondContact O-N 3.39Å; V62-A66 PolarHBondContact O-N 2.67Å
63	G	44.7	Very low	50.4	Low	64 Å²	64	110 Å²	110	66%	0.66	59%	0.59	S	S	*	*	H	α-helix	trans	-63.5	-28.7	172.3	0	0	0	0	0	114.3	Q59 I60 T61	Q59-G63 PolarHBondContact O-N 3.33Å; I60-G63 PolarHBondContact O-N 3.14Å; T61-G63 VanDerWaalsContact C-N 3.34Å
64	K	45.6	Very low	48.9	Very low	175 Å²	175	114.5 Å²	114.5	76%	0.761	60%	0.602	S	S	*	*	H	α-helix	trans	-95.1	-24.4	172.1	-79.2	-175.6	170.2	179	0	113.9	I60 T61 V62	I60-K64 PolarHBondContact O-N 2.77Å; I60-K64 VanDerWaalsContact O-N 3.14Å; T61-K64 CarbonylContact O-C 3.52Å; T61-K64 PolarHBondContact O-N 2.65Å; V62-K64 VanDerWaalsContact C-N 3.29Å; V62-K64 PolarHBondContact O-N 3.45Å
65	S	44.7	Very low	48.1	Very low	33 Å²	33	114.7 Å²	114.7	23%	0.231	60%	0.603	C	S	.	*	H	α-helix	trans	-91.3	-9	-178.1	-91.3	0	0	0	0	114.2	T61 V62 L67 R68 I69	T61-S65 WeakPolarHBondContact O-CA 3.47Å; T61-S65 WeakPolarHBondContact O-CB 3.13Å; T61-S65 PolarHBondContact O-N 2.75Å; V62-S65 PolarHBondContact O-N 3.39Å; S65-L67 PolarHBondContact O-N 2.97Å; S65-R68 PolarHBondContact O-N 2.93Å; S65-I69 VanDerWaalsContact O-CD1 3.32Å; S65-I69 WeakPolarHBondContact O-CD1 3.41Å; S65-I69 WeakPolarHBondContact O-CG1 3.42Å; S65-I69 PolarHBondContact O-N 3.32Å
66	A	41.5	Very low	47.4	Very low	73 Å²	73	118.1 Å²	118.1	60%	0.603	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.8	-23.7	162.4	0	0	0	0	0	111.9	V62	V62-A66 PolarHBondContact O-N 2.67Å
67	L	38.7	Very low	47.2	Very low	160 Å²	160	115.2 Å²	115.2	84%	0.838	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.5	-12.9	172.8	-151.2	79.7	0	0	0	114.7	S65	S65-L67 PolarHBondContact O-N 2.97Å
68	R	40.9	Very low	46.9	Very low	194 Å²	194	114.3 Å²	114.3	73%	0.732	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-112.2	-13.7	-173.1	-123.2	-175.5	-171.3	-147.1	2.1	114.9	S65 F70 C71	S65-R68 PolarHBondContact O-N 2.93Å; R68-F70 PolarHBondContact O-N 2.69Å; R68-C71 PolarHBondContact O-N 2.96Å
69	I	45.6	Very low	47.1	Very low	118 Å²	118	116.7 Å²	116.7	61%	0.605	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.2	-10.2	179.4	-66.6	157.4	0	0	0	113.1	S65 C71	S65-I69 VanDerWaalsContact O-CD1 3.32Å; S65-I69 WeakPolarHBondContact O-CD1 3.41Å; S65-I69 WeakPolarHBondContact O-CG1 3.42Å; S65-I69 PolarHBondContact O-N 3.32Å; I69-C71 PolarHBondContact O-N 3.42Å
70	F	40	Very low	47.4	Very low	195 Å²	195	116 Å²	116	86%	0.855	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.4	-9.4	167.8	-80.8	-77.9	0	0	0	114.1	R68	R68-F70 PolarHBondContact O-N 2.69Å
71	C	35.6	Very low	47.7	Very low	88 Å²	88	115.3 Å²	115.3	60%	0.595	62%	0.624	S	S	*	*	S	Bend	trans	-124.9	112.6	178.9	-71.8	0	0	0	0	110.8	R68 I69	R68-C71 PolarHBondContact O-N 2.96Å; I69-C71 PolarHBondContact O-N 3.42Å
72	T	39.5	Very low	48.1	Very low	115 Å²	115	119.1 Å²	119.1	71%	0.706	63%	0.632	S	S	*	*	S	Bend	trans	78.1	105.1	151.9	60.3	0	0	0	0	119	Y74	T72-Y74 PolarHBondContact O-N 3.19Å; T72-Y74 VanDerWaalsContact O-N 3.12Å
73	E	43	Very low	48.9	Very low	186 Å²	186	120 Å²	120	87%	0.869	63%	0.634	S	S	*	*				59	28.6	129.8	-63.6	-83.3	150	0	0	119.7
74	Y	43.4	Very low	49.4	Very low	198 Å²	198	123 Å²	123	78%	0.776	63%	0.633	S	S	*	*			trans	-113.8	93.6	170.7	-80.4	-85.4	0	0	0	113.7	T72	T72-Y74 PolarHBondContact O-N 3.19Å; T72-Y74 VanDerWaalsContact O-N 3.12Å
75	T	55.1	Low	49.9	Very low	96 Å²	96	121.6 Å²	121.6	59%	0.589	63%	0.627	S	S	*	*			trans	49.8	111.9	135.3	56	0	0	0	0	118.2	A77 A78	T75-A77 PolarHBondContact O-N 3.47Å; T75-A78 PolarHBondContact O-N 3.49Å
76	L	53.9	Low	50.2	Low	133 Å²	133	122.2 Å²	122.2	70%	0.696	63%	0.631	S	S	*	*	H	α-helix	trans	-27.6	-31.7	171.1	-155	73.1	0	0	0	117.1	L79 L80	L76-L79 PolarHBondContact O-N 2.73Å; L76-L80 PolarHBondContact O-N 3.13Å
77	A	55.7	Low	50.6	Low	63 Å²	63	122.5 Å²	122.5	52%	0.521	63%	0.625	S	S	.	*	H	α-helix	trans	-61.9	-38.5	174.7	0	0	0	0	0	113.3	T75 L79 L80 L81	T75-A77 PolarHBondContact O-N 3.47Å; A77-L79 VanDerWaalsContact C-N 3.33Å; A77-L80 PolarHBondContact O-N 3.38Å; A77-L81 WeakPolarHBondContact O-CB 3.41Å; A77-L81 PolarHBondContact O-N 3.22Å
78	A	54.7	Low	51.1	Low	57 Å²	57	117.7 Å²	117.7	47%	0.471	61%	0.605	S	S	.	*	H	α-helix	trans	-67.6	-35	175.8	0	0	0	0	0	111.7	T75 Y82	T75-A78 PolarHBondContact O-N 3.49Å; A78-Y82 WeakPolarHBondContact O-CB 3.5Å; A78-Y82 PolarHBondContact O-N 3.32Å
79	L	59.1	Low	51.2	Low	113 Å²	113	115.8 Å²	115.8	59%	0.592	60%	0.599	S	S	*	*	H	α-helix	trans	-70.5	-40.3	175.8	-166.6	70	0	0	0	111.9	L76 A77 Y82 N83	L76-L79 PolarHBondContact O-N 2.73Å; A77-L79 VanDerWaalsContact C-N 3.33Å; L79-Y82 PolarHBondContact O-N 3.36Å; L79-N83 PolarHBondContact O-N 3.41Å
80	L	60.9	Low	51.1	Low	110 Å²	110	115 Å²	115	58%	0.576	60%	0.6	S	S	*	*	H	α-helix	trans	-64.5	-43.5	175.2	-102.6	153.1	0	0	0	112.2	L76 A77 N83 M84	L76-L80 PolarHBondContact O-N 3.13Å; A77-L80 PolarHBondContact O-N 3.38Å; L80-N83 PolarHBondContact O-N 3.02Å; L80-M84 VanDerWaalsContact O-CG 3.31Å; L80-M84 WeakPolarHBondContact O-CG 3.46Å; L80-M84 PolarHBondContact O-N 2.85Å; L80-M84 VanDerWaalsContact O-N 3.09Å
81	L	62	Low	51.3	Low	99 Å²	99	112.4 Å²	112.4	52%	0.518	59%	0.593	S	S	.	*	H	α-helix	trans	-64.6	-39.9	174.1	-91.7	149.6	0	0	0	112	A77 N83 M84 F85	A77-L81 WeakPolarHBondContact O-CB 3.41Å; A77-L81 PolarHBondContact O-N 3.22Å; L81-N83 VanDerWaalsContact C-N 3.34Å; L81-N83 PolarHBondContact O-N 2.91Å; L81-M84 PolarHBondContact O-N 2.75Å; L81-F85 HydrophobicContact CD2-CD2 4.19Å; L81-F85 HydrophobicContact CD2-CE2 3.86Å; L81-F85 WeakPolarHBondContact O-CD2 3.35Å; L81-F85 PolarHBondContact O-N 3.01Å
82	Y	60.5	Low	51.7	Low	150 Å²	150	113.5 Å²	113.5	59%	0.588	60%	0.597	S	S	*	*	H	α-helix	trans	-60.7	-42.1	174.1	-176.9	-96.8	0	0	0	112	A78 L79 F85 S86	A78-Y82 WeakPolarHBondContact O-CB 3.5Å; A78-Y82 PolarHBondContact O-N 3.32Å; L79-Y82 PolarHBondContact O-N 3.36Å; Y82-F85 PolarHBondContact O-N 3.35Å; Y82-S86 WeakPolarHBondContact O-CB 3.32Å; Y82-S86 PolarHBondContact O-N 3.47Å
83	N	61.3	Low	51.8	Low	100 Å²	100	110.1 Å²	110.1	54%	0.535	58%	0.576	S	S	.	*	H	α-helix	trans	-65.3	-40.2	177.7	-112.2	-10.4	0	0	0	112.8	L79 L80 L81 T87	L79-N83 PolarHBondContact O-N 3.41Å; L80-N83 PolarHBondContact O-N 3.02Å; L81-N83 VanDerWaalsContact C-N 3.34Å; L81-N83 PolarHBondContact O-N 2.91Å; N83-T87 WeakPolarHBondContact O-CB 3.18Å; N83-T87 VanDerWaalsContact O-CG2 3.3Å; N83-T87 WeakPolarHBondContact O-CG2 3.2Å; N83-T87 PolarHBondContact O-N 3Å; N83-T87 VanDerWaalsContact O-N 3.15Å; N83-T87 PolarHBondContact O-OG1 2.98Å
84	M	56.9	Low	51.4	Low	128 Å²	128	104.7 Å²	104.7	63%	0.631	57%	0.571	S	S	*	*	H	α-helix	trans	-67.7	-39.2	177.5	-68.5	-91.4	-74	0	0	112.5	L80 L81 T87 S88	L80-M84 VanDerWaalsContact O-CG 3.31Å; L80-M84 WeakPolarHBondContact O-CG 3.46Å; L80-M84 PolarHBondContact O-N 2.85Å; L80-M84 VanDerWaalsContact O-N 3.09Å; L81-M84 PolarHBondContact O-N 2.75Å; M84-T87 PolarHBondContact O-OG1 3.45Å; M84-S88 WeakPolarHBondContact O-CB 3.17Å; M84-S88 PolarHBondContact O-N 3.38Å; M84-S88 PolarHBondContact O-OG 3.02Å
85	F	55.3	Low	51.2	Low	145 Å²	145	102.3 Å²	102.3	64%	0.636	57%	0.568	S	S	*	*	H	α-helix	trans	-79.5	-34.3	178.5	-85.4	-76.6	0	0	0	113.1	L81 Y82 S88 Y89	L81-F85 HydrophobicContact CD2-CD2 4.19Å; L81-F85 HydrophobicContact CD2-CE2 3.86Å; L81-F85 WeakPolarHBondContact O-CD2 3.35Å; L81-F85 PolarHBondContact O-N 3.01Å; Y82-F85 PolarHBondContact O-N 3.35Å; F85-S88 PolarHBondContact O-N 2.85Å; F85-Y89 WeakPolarHBondContact O-CB 3.43Å; F85-Y89 PolarHBondContact O-N 2.98Å
86	S	50.9	Low	50.4	Low	46 Å²	46	104.1 Å²	104.1	32%	0.322	58%	0.579	S	S	.	*	H	α-helix	trans	-67.3	-42.3	177.3	-174.1	0	0	0	0	111.8	Y82 S88 Y89 V90	Y82-S86 WeakPolarHBondContact O-CB 3.32Å; Y82-S86 PolarHBondContact O-N 3.47Å; S86-S88 VanDerWaalsContact C-N 3.3Å; S86-S88 PolarHBondContact O-N 3.44Å; S86-Y89 PolarHBondContact O-N 2.82Å; S86-V90 WeakPolarHBondContact O-CG2 3.3Å; S86-V90 PolarHBondContact O-N 3.03Å; S86-V90 VanDerWaalsContact O-N 3.13Å
87	T	50.1	Low	49.5	Very low	78 Å²	78	102.7 Å²	102.7	48%	0.479	58%	0.579	S	S	.	*	H	α-helix	trans	-62.1	-38.7	173.1	48.2	0	0	0	0	111.8	N83 M84 I91	N83-T87 WeakPolarHBondContact O-CB 3.18Å; N83-T87 VanDerWaalsContact O-CG2 3.3Å; N83-T87 WeakPolarHBondContact O-CG2 3.2Å; N83-T87 PolarHBondContact O-N 3Å; N83-T87 VanDerWaalsContact O-N 3.15Å; N83-T87 PolarHBondContact O-OG1 2.98Å; M84-T87 PolarHBondContact O-OG1 3.45Å; T87-I91 WeakPolarHBondContact O-CD1 3.31Å; T87-I91 WeakPolarHBondContact O-CG1 3.46Å; T87-I91 PolarHBondContact O-N 3.19Å
88	S	48.9	Very low	48.3	Very low	60 Å²	60	106.1 Å²	106.1	42%	0.42	59%	0.589	S	S	.	*	H	α-helix	trans	-70.1	-31.8	176.5	-55.2	0	0	0	0	113.1	M84 F85 S86 I91 T92	M84-S88 WeakPolarHBondContact O-CB 3.17Å; M84-S88 PolarHBondContact O-N 3.38Å; M84-S88 PolarHBondContact O-OG 3.02Å; F85-S88 PolarHBondContact O-N 2.85Å; S86-S88 VanDerWaalsContact C-N 3.3Å; S86-S88 PolarHBondContact O-N 3.44Å; S88-I91 PolarHBondContact O-N 3.09Å; S88-T92 WeakPolarHBondContact O-CG2 3.12Å; S88-T92 PolarHBondContact O-N 2.77Å; S88-T92 PolarHBondContact O-OG1 3.09Å
89	Y	42.4	Very low	47.8	Very low	153 Å²	153	110.2 Å²	110.2	60%	0.6	60%	0.601	S	S	*	*	H	α-helix	trans	-74.3	-35.9	179.9	-159.3	-95	0	0	0	112.5	F85 S86 I91 T92 T93	F85-Y89 WeakPolarHBondContact O-CB 3.43Å; F85-Y89 PolarHBondContact O-N 2.98Å; S86-Y89 PolarHBondContact O-N 2.82Å; Y89-I91 VanDerWaalsContact C-N 3.3Å; Y89-I91 PolarHBondContact O-N 3.09Å; Y89-T92 PolarHBondContact O-N 3.15Å; Y89-T92 PolarHBondContact O-OG1 3.33Å; Y89-T93 HydrophobicContact CD1-CG2 4.31Å; Y89-T93 HydrophobicContact CE1-CG2 3.89Å; Y89-T93 HydrophobicContact CE2-CG2 4.44Å; Y89-T93 PolarHBondContact O-N 3Å; Y89-T93 PolarHBondContact O-OG1 2.96Å
90	V	43.4	Very low	46.6	Very low	102 Å²	102	109.7 Å²	109.7	62%	0.618	60%	0.603	S	S	*	*	H	α-helix	trans	-70.6	-26.1	174.9	176.8	0	0	0	0	112.1	S86	S86-V90 WeakPolarHBondContact O-CG2 3.3Å; S86-V90 PolarHBondContact O-N 3.03Å; S86-V90 VanDerWaalsContact O-N 3.13Å
91	I	45.7	Very low	45.3	Very low	140 Å²	140	112.2 Å²	112.2	72%	0.718	62%	0.617	S	S	*	*	H	α-helix	trans	-82.3	-28.1	177.1	-61	163.4	0	0	0	111.6	T87 S88 Y89	T87-I91 WeakPolarHBondContact O-CD1 3.31Å; T87-I91 WeakPolarHBondContact O-CG1 3.46Å; T87-I91 PolarHBondContact O-N 3.19Å; S88-I91 PolarHBondContact O-N 3.09Å; Y89-I91 VanDerWaalsContact C-N 3.3Å; Y89-I91 PolarHBondContact O-N 3.09Å
92	T	44.5	Very low	43.9	Very low	111 Å²	111	113.8 Å²	113.8	68%	0.681	63%	0.631	S	S	*	*	H	α-helix	trans	-97.6	-20.6	-176.5	48.9	0	0	0	0	114.2	S88 Y89	S88-T92 WeakPolarHBondContact O-CG2 3.12Å; S88-T92 PolarHBondContact O-N 2.77Å; S88-T92 PolarHBondContact O-OG1 3.09Å; Y89-T92 PolarHBondContact O-N 3.15Å; Y89-T92 PolarHBondContact O-OG1 3.33Å
93	T	39.7	Very low	42.6	Very low	44 Å²	44	113.1 Å²	113.1	27%	0.27	65%	0.647	S	S	.	*	S	Bend	trans	-106.7	97.8	168.2	60.3	0	0	0	0	108.1	Y89 M95	Y89-T93 HydrophobicContact CD1-CG2 4.31Å; Y89-T93 HydrophobicContact CE1-CG2 3.89Å; Y89-T93 HydrophobicContact CE2-CG2 4.44Å; Y89-T93 PolarHBondContact O-N 3Å; Y89-T93 PolarHBondContact O-OG1 2.96Å; T93-M95 PolarHBondContact O-N 2.75Å
94	G	36	Very low	41.1	Very low	73 Å²	73	116.2 Å²	116.2	75%	0.753	66%	0.663	S	S	*	*			trans	-65	55	-174.8	0	0	0	0	0	115.5	V96	G94-V96 VanDerWaalsContact C-N 3.26Å; G94-V96 PolarHBondContact O-N 3.28Å
95	M	39	Very low	40.2	Very low	147 Å²	147	117.1 Å²	117.1	72%	0.724	67%	0.67	S	S	*	*			trans	-79.1	77.5	173.9	-76.6	-172.7	-83	0	0	110	T93 C97	T93-M95 PolarHBondContact O-N 2.75Å; M95-C97 VanDerWaalsContact C-N 3.31Å; M95-C97 PolarHBondContact O-N 3.12Å; M95-C97 VanDerWaalsContact O-N 3.09Å
96	V	37.5	Very low	39.2	Very low	134 Å²	134	115 Å²	115	81%	0.812	67%	0.674	S	S	*	*			trans	-69.2	89	158.1	179.8	0	0	0	0	107.2	G94 N98	G94-V96 VanDerWaalsContact C-N 3.26Å; G94-V96 PolarHBondContact O-N 3.28Å; V96-N98 PolarHBondContact O-N 3.41Å; V96-N98 VanDerWaalsContact O-N 3.09Å
97	C	35.7	Very low	38.4	Very low	104 Å²	104	120.4 Å²	120.4	70%	0.703	70%	0.699	S	S	*	*			trans	-76.1	94.7	170.5	-97.5	0	0	0	0	109.9	M95 I99	M95-C97 VanDerWaalsContact C-N 3.31Å; M95-C97 PolarHBondContact O-N 3.12Å; M95-C97 VanDerWaalsContact O-N 3.09Å; C97-I99 HydrophobicContact CB-CD1 4.41Å; C97-I99 HydrophobicContact CB-CG1 4.33Å; C97-I99 PolarHBondContact O-N 3.34Å
98	N	30.7	Very low	37.7	Very low	134 Å²	134	122.3 Å²	122.3	72%	0.717	71%	0.711	S	S	*	*			trans	-76.4	93.2	164	-177.1	27.3	0	0	0	108.9	V96	V96-N98 PolarHBondContact O-N 3.41Å; V96-N98 VanDerWaalsContact O-N 3.09Å
99	I	42.7	Very low	36.8	Very low	143 Å²	143	125.4 Å²	125.4	73%	0.733	73%	0.732	S	S	*	*			trans	-110.2	90.1	175.1	-54.6	178.1	0	0	0	108.6	C97	C97-I99 HydrophobicContact CB-CD1 4.41Å; C97-I99 HydrophobicContact CB-CG1 4.33Å; C97-I99 PolarHBondContact O-N 3.34Å
100	T	35.1	Very low	36.5	Very low	103 Å²	103	124 Å²	124	63%	0.632	74%	0.739	S	S	*	*			trans	-66.9	137.6	167.5	43.1	0	0	0	0	111.3	T102	T100-T102 PolarHBondContact O-N 3.11Å; T100-T102 VanDerWaalsContact O-N 3.15Å
101	N	33.3	Very low	36	Very low	163 Å²	163	124.2 Å²	124.2	87%	0.872	75%	0.745	S	S	*	*	S	Bend	trans	-40.8	106.3	174.5	-82.3	-12.6	0	0	0	114.5
102	T	31.9	Very low	35.7	Very low	132 Å²	132	125.8 Å²	125.8	81%	0.81	75%	0.754	S	S	*	*			trans	-176	84.8	146.4	41.1	0	0	0	0	110.2	T100	T100-T102 PolarHBondContact O-N 3.11Å; T100-T102 VanDerWaalsContact O-N 3.15Å
103	C	33.8	Very low	35.5	Very low	136 Å²	136	125.4 Å²	125.4	92%	0.919	76%	0.756	S	S	*	*			trans	-125.2	73.5	164	-77.1	0	0	0	0	108.9
104	N	30.9	Very low	35.6	Very low	164 Å²	164	129.8 Å²	129.8	88%	0.877	78%	0.778	S	S	*	*			trans	-109.4	69.7	172.9	-155.9	22.3	0	0	0	107.7
105	N	36.3	Very low	35.4	Very low	147 Å²	147	133.3 Å²	133.3	79%	0.786	78%	0.779	S	S	*	*	S	Bend	trans	-165.6	121.8	157.4	-135.7	9.1	0	0	0	110.5
106	S	34.8	Very low	35.6	Very low	102 Å²	102	134.2 Å²	134.2	71%	0.713	79%	0.786	S	S	*	*	S	Bend	trans	-46.3	131.1	170.2	-38.6	0	0	0	0	110.7
107	N	33.4	Very low	35.5	Very low	159 Å²	159	132.3 Å²	132.3	85%	0.85	78%	0.777	S	S	*	*			trans	121.3	34	173.1	-58.7	-11.4	0	0	0	116.9
108	V	37	Very low	35.7	Very low	118 Å²	118	139.4 Å²	139.4	72%	0.715	79%	0.789	S	S	*	*			trans	-136.9	102.4	167.7	179.1	0	0	0	0	110.4	V110	V108-V110 VanDerWaalsContact C-N 3.3Å; V108-V110 HydrophobicContact CG1-CB 3.94Å; V108-V110 HydrophobicContact CG1-CG2 3.51Å; V108-V110 PolarHBondContact O-N 3.15Å; V108-V110 VanDerWaalsContact O-N 3.11Å
109	S	29.8	Very low	35.9	Very low	125 Å²	125	143 Å²	143	87%	0.874	79%	0.794	S	S	*	*			trans	-77.8	82.7	164.6	56.5	0	0	0	0	109
110	V	36.2	Very low	35.7	Very low	123 Å²	123	143.7 Å²	143.7	75%	0.745	80%	0.797	S	S	*	*			trans	-125.9	103	163.9	174.9	0	0	0	0	106.1	V108	V108-V110 VanDerWaalsContact C-N 3.3Å; V108-V110 HydrophobicContact CG1-CB 3.94Å; V108-V110 HydrophobicContact CG1-CG2 3.51Å; V108-V110 PolarHBondContact O-N 3.15Å; V108-V110 VanDerWaalsContact O-N 3.11Å
111	S	31.5	Very low	35.6	Very low	107 Å²	107	145.2 Å²	145.2	75%	0.748	81%	0.806	S	S	*	*			trans	-148.5	88.3	174.9	65.8	0	0	0	0	110.6
112	L	40.4	Very low	35.5	Very low	173 Å²	173	144.1 Å²	144.1	91%	0.906	80%	0.8	S	S	*	*			trans	-137.6	15.5	161.2	-118	107.6	0	0	0	112.4
113	S	39.4	Very low	35.7	Very low	102 Å²	102	149 Å²	149	71%	0.713	82%	0.818	S	S	*	*	S	Bend	trans	-100.4	-8.5	-176.3	69.7	0	0	0	0	116.1
114	D	41.5	Very low	35.8	Very low	137 Å²	137	149.7 Å²	149.7	73%	0.733	81%	0.813	S	S	*	*	S	Bend	trans	-115.9	-4.5	-169.7	-67.7	-2.6	0	0	0	115.1
115	N	33.4	Very low	36.1	Very low	147 Å²	147	148.9 Å²	148.9	79%	0.786	81%	0.81	S	S	*	*			trans	-155.2	40.5	-160.2	-92.8	-39.4	0	0	0	119.5
116	L	42.6	Very low	36.1	Very low	166 Å²	166	149.1 Å²	149.1	87%	0.869	81%	0.811	S	S	*	*			trans	-144.9	135.3	164.1	-109.1	90.5	0	0	0	114.3
117	P	35.6	Very low	36.2	Very low	94 Å²	94	151.8 Å²	151.8	61%	0.61	82%	0.817	S	S	*	*			cis	-126.5	143.5	-23.8	32.7	-15	0	0	0	112.8	Y119	P117-Y119 VanDerWaalsContact C-N 3.29Å; P117-Y119 HydrophobicContact CB-CD2 4.3Å; P117-Y119 PolarHBondContact O-N 2.79Å
118	R	38.6	Very low	36.3	Very low	253 Å²	253	151.4 Å²	151.4	96%	0.955	82%	0.815	S	S	*	*			trans	-48.7	89.9	155.8	-75.5	174.7	164.8	-172.5	-4.1	110.6
119	Y	36.8	Very low	36.3	Very low	210 Å²	210	153.6 Å²	153.6	82%	0.824	82%	0.822	S	S	*	*			trans	-142.8	48.9	167.6	-99.8	-80.9	0	0	0	110.3	P117	P117-Y119 VanDerWaalsContact C-N 3.29Å; P117-Y119 HydrophobicContact CB-CD2 4.3Å; P117-Y119 PolarHBondContact O-N 2.79Å
120	I	36.7	Very low	36.8	Very low	156 Å²	156	155.6 Å²	155.6	80%	0.8	82%	0.818	S	S	*	*			trans	-140.3	80.5	161.7	-56.6	179.5	0	0	0	107.5
121	V	33.3	Very low	36.8	Very low	135 Å²	135	158.2 Å²	158.2	82%	0.818	82%	0.823	S	S	*	*			trans	-132.8	93.7	150.7	177.7	0	0	0	0	102.5
122	L	31.7	Very low	37.2	Very low	141 Å²	141	162.4 Å²	162.4	74%	0.738	83%	0.83	S	S	*	*				49.3	101.8	101.2	-97.8	121.7	0	0	0	112.9
123	I	36.9	Very low	37	Very low	235 Å²	235	161.5 Å²	161.5	100%	1.205	82%	0.823	S	S	*	*			trans	78.6	0	164.9	-49.4	169.9	0	0	0	115.7

Retrieved 123 of 123 residues in 46.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).