A0A5K4F9S2_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0A5K4F9S2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 41 aa.

						>A0A5K4F9S2_SCHMA|A0A5K4F9S2
MIEKCHLSRRTAINAGYYRLTIIWKRCHNFFMYRSVFSKLK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.9	Low	69.3	Low	231 Å²	231	134.7 Å²	134.7	100%	1.138	66%	0.658	S	S	*	*				0	-23.4	0	-91.6	173.9	159.4	0	0	114.5
2	I	61.4	Low	70.6	Confident	133 Å²	133	129.1 Å²	129.1	68%	0.682	65%	0.649	S	S	*	*	H	α-helix	trans	-69.5	-35.9	-170.7	-60.9	162.7	0	0	0	113.5	K4 C5 H6	I2-K4 PolarHBondContact O-N 3.28Å; I2-C5 WeakPolarHBondContact O-CB 3.46Å; I2-C5 PolarHBondContact O-N 3.26Å; I2-C5 VanDerWaalsContact O-N 3.16Å; I2-H6 PolarHBondContact O-CD2 3.22Å
3	E	61.2	Low	71.8	Confident	171 Å²	171	127.4 Å²	127.4	80%	0.799	64%	0.641	S	S	*	*	H	α-helix	trans	-60.3	-39.3	-174.8	-68.5	-124.3	88.5	0	0	114.5	C5 H6	E3-C5 PolarHBondContact O-N 3.16Å; E3-H6 PolarHBondContact O-N 3.32Å
4	K	62.9	Low	73	Confident	175 Å²	175	124.7 Å²	124.7	76%	0.761	63%	0.63	S	S	*	*	H	α-helix	trans	-64.6	-28.8	179.8	-71.6	-176	176	179.5	0	112.9	I2 H6 L7 S8	I2-K4 PolarHBondContact O-N 3.28Å; K4-H6 VanDerWaalsContact C-N 3.34Å; K4-L7 PolarHBondContact O-N 3.49Å; K4-S8 PolarHBondContact O-N 3.29Å
5	C	63.1	Low	74.1	Confident	66 Å²	66	120.3 Å²	120.3	45%	0.446	62%	0.62	S	S	.	*	H	α-helix	trans	-71.4	-29.4	-179.9	-172.8	0	0	0	0	112.3	I2 E3 R9	I2-C5 WeakPolarHBondContact O-CB 3.46Å; I2-C5 PolarHBondContact O-N 3.26Å; I2-C5 VanDerWaalsContact O-N 3.16Å; E3-C5 PolarHBondContact O-N 3.16Å; C5-R9 PolarHBondContact O-N 3.29Å; C5-R9 PolarHBondContact O-NE 3.06Å; C5-R9 PolarHBondContact SG-NH2 3.45Å
6	H	68	Low	75.1	Confident	86 Å²	86	115.4 Å²	115.4	40%	0.398	61%	0.608	S	S	.	*	H	α-helix	trans	-72.5	-37.5	175.7	-72.9	-79.7	0	0	0	112.3	I2 E3 K4 R10	I2-H6 PolarHBondContact O-CD2 3.22Å; E3-H6 PolarHBondContact O-N 3.32Å; K4-H6 VanDerWaalsContact C-N 3.34Å; H6-R10 WeakPolarHBondContact O-CG 3.16Å; H6-R10 PolarHBondContact O-N 3.34Å
7	L	71.8	Confident	75.8	Confident	126 Å²	126	117.6 Å²	117.6	66%	0.66	61%	0.608	S	S	*	*	H	α-helix	trans	-65.4	-47.2	178.4	-126.8	110.9	0	0	0	111.3	K4 R9 R10 T11	K4-L7 PolarHBondContact O-N 3.49Å; L7-R9 VanDerWaalsContact C-N 3.34Å; L7-R9 PolarHBondContact O-N 3.34Å; L7-R10 PolarHBondContact O-N 3.47Å; L7-T11 PolarHBondContact O-N 2.96Å; L7-T11 PolarHBondContact O-OG1 2.94Å
8	S	75.7	Confident	76.5	Confident	85 Å²	85	119.5 Å²	119.5	59%	0.594	61%	0.607	S	S	*	*	H	α-helix	trans	-61.8	-40.8	179	-70.1	0	0	0	0	112.5	K4 T11 A12	K4-S8 PolarHBondContact O-N 3.29Å; S8-T11 PolarHBondContact O-N 3.48Å; S8-A12 WeakPolarHBondContact O-CB 3.48Å; S8-A12 PolarHBondContact O-N 2.88Å
9	R	77.3	Confident	77.2	Confident	134 Å²	134	123.5 Å²	123.5	51%	0.506	61%	0.614	S	S	.	*	H	α-helix	trans	-63.3	-44.7	174.5	-82.2	-176.7	-77.3	-179.7	-3.2	112	C5 L7 T11 A12 I13	C5-R9 PolarHBondContact O-N 3.29Å; C5-R9 PolarHBondContact O-NE 3.06Å; C5-R9 PolarHBondContact SG-NH2 3.45Å; L7-R9 VanDerWaalsContact C-N 3.34Å; L7-R9 PolarHBondContact O-N 3.34Å; R9-T11 PolarHBondContact O-N 3.46Å; R9-A12 PolarHBondContact O-N 3.4Å; R9-I13 WeakPolarHBondContact O-CB 3.45Å; R9-I13 VanDerWaalsContact O-CG1 3.24Å; R9-I13 WeakPolarHBondContact O-CG1 3.24Å; R9-I13 PolarHBondContact O-N 2.99Å
10	R	82.4	Confident	77.9	Confident	185 Å²	185	123.4 Å²	123.4	70%	0.698	62%	0.615	S	S	*	*	H	α-helix	trans	-61.3	-43.8	175.6	-76.6	-174.4	-149.1	-156	5.7	111.4	H6 L7 A12 I13 N14	H6-R10 WeakPolarHBondContact O-CG 3.16Å; H6-R10 PolarHBondContact O-N 3.34Å; L7-R10 PolarHBondContact O-N 3.47Å; R10-A12 VanDerWaalsContact C-N 3.35Å; R10-A12 PolarHBondContact O-N 3.03Å; R10-I13 PolarHBondContact O-N 3.21Å; R10-N14 WeakPolarHBondContact O-CB 3.48Å; R10-N14 PolarHBondContact O-N 3.46Å
11	T	83.7	Confident	78.5	Confident	90 Å²	90	120.5 Å²	120.5	55%	0.552	60%	0.604	S	S	*	*	H	α-helix	trans	-61.7	-43.1	178	-55.3	0	0	0	0	111.8	L7 S8 R9 N14 A15	L7-T11 PolarHBondContact O-N 2.96Å; L7-T11 PolarHBondContact O-OG1 2.94Å; S8-T11 PolarHBondContact O-N 3.48Å; R9-T11 PolarHBondContact O-N 3.46Å; T11-N14 PolarHBondContact O-N 3.38Å; T11-A15 WeakPolarHBondContact O-CB 3.3Å; T11-A15 PolarHBondContact O-N 3.25Å
12	A	84.7	Confident	80.2	Confident	67 Å²	67	114.8 Å²	114.8	55%	0.554	58%	0.577	S	S	*	*	H	α-helix	trans	-63.4	-45.7	176.8	0	0	0	0	0	112.1	S8 R9 R10 A15 G16	S8-A12 WeakPolarHBondContact O-CB 3.48Å; S8-A12 PolarHBondContact O-N 2.88Å; R9-A12 PolarHBondContact O-N 3.4Å; R10-A12 VanDerWaalsContact C-N 3.35Å; R10-A12 PolarHBondContact O-N 3.03Å; A12-A15 PolarHBondContact O-N 3.2Å; A12-G16 PolarHBondContact O-N 2.78Å
13	I	86.1	Confident	81.5	Confident	107 Å²	107	113.3 Å²	113.3	55%	0.549	57%	0.569	S	S	.	*	H	α-helix	trans	-63.4	-43.3	176.5	-66.8	166.3	0	0	0	110.5	R9 R10 G16 Y17	R9-I13 WeakPolarHBondContact O-CB 3.45Å; R9-I13 VanDerWaalsContact O-CG1 3.24Å; R9-I13 WeakPolarHBondContact O-CG1 3.24Å; R9-I13 PolarHBondContact O-N 2.99Å; R10-I13 PolarHBondContact O-N 3.21Å; I13-G16 PolarHBondContact O-N 3.4Å; I13-Y17 HydrophobicContact CG2-CD2 4.14Å; I13-Y17 WeakPolarHBondContact O-CB 3.49Å; I13-Y17 PolarHBondContact O-N 3.38Å
14	N	88.7	Confident	82.7	Confident	90 Å²	90	114.1 Å²	114.1	48%	0.481	57%	0.565	S	S	.	*	H	α-helix	trans	-65.1	-43.7	-178.9	-153.5	37.4	0	0	0	110.6	R10 T11 G16 Y17 Y18	R10-N14 WeakPolarHBondContact O-CB 3.48Å; R10-N14 PolarHBondContact O-N 3.46Å; T11-N14 PolarHBondContact O-N 3.38Å; N14-G16 VanDerWaalsContact C-N 3.32Å; N14-G16 PolarHBondContact O-N 3.25Å; N14-Y17 PolarHBondContact O-N 2.68Å; N14-Y18 WeakPolarHBondContact ND2-CE2 3.34Å; N14-Y18 WeakPolarHBondContact O-CB 3.49Å; N14-Y18 WeakPolarHBondContact O-CD2 3.45Å; N14-Y18 PolarHBondContact O-N 2.85Å
15	A	89.4	Confident	83.9	Confident	58 Å²	58	112.9 Å²	112.9	48%	0.479	56%	0.56	S	S	.	*	H	α-helix	trans	-59.5	-41.7	174.5	0	0	0	0	0	112.2	T11 A12 Y18 R19	T11-A15 WeakPolarHBondContact O-CB 3.3Å; T11-A15 PolarHBondContact O-N 3.25Å; A12-A15 PolarHBondContact O-N 3.2Å; A15-Y18 PolarHBondContact O-N 3.45Å; A15-R19 PolarHBondContact O-N 2.88Å; A15-R19 VanDerWaalsContact O-N 3.08Å
16	G	90.4	Very high	85	Confident	42 Å²	42	119.4 Å²	119.4	43%	0.433	58%	0.575	S	S	.	*	H	α-helix	trans	-61.2	-48.5	172.9	0	0	0	0	0	112.3	A12 I13 N14 Y18 R19 L20	A12-G16 PolarHBondContact O-N 2.78Å; I13-G16 PolarHBondContact O-N 3.4Å; N14-G16 VanDerWaalsContact C-N 3.32Å; N14-G16 PolarHBondContact O-N 3.25Å; G16-Y18 PolarHBondContact O-N 3.08Å; G16-R19 PolarHBondContact O-N 3.49Å; G16-L20 WeakPolarHBondContact O-CB 3.25Å; G16-L20 PolarHBondContact O-N 2.88Å
17	Y	87.7	Confident	85.8	Confident	154 Å²	154	119.1 Å²	119.1	60%	0.604	58%	0.582	S	S	*	*	H	α-helix	trans	-59.9	-42.6	177.1	-114.1	-87.6	0	0	0	112.4	I13 N14 L20 T21	I13-Y17 HydrophobicContact CG2-CD2 4.14Å; I13-Y17 WeakPolarHBondContact O-CB 3.49Å; I13-Y17 PolarHBondContact O-N 3.38Å; N14-Y17 PolarHBondContact O-N 2.68Å; Y17-L20 PolarHBondContact O-N 3.36Å; Y17-T21 VanDerWaalsContact O-CB 3.3Å; Y17-T21 WeakPolarHBondContact O-CB 3.22Å; Y17-T21 PolarHBondContact O-N 2.82Å; Y17-T21 PolarHBondContact O-OG1 2.82Å
18	Y	87.5	Confident	86.4	Confident	151 Å²	151	118.2 Å²	118.2	59%	0.592	57%	0.574	S	S	*	*	H	α-helix	trans	-60.8	-47.2	176.1	-92.9	-74.9	0	0	0	111.2	N14 A15 G16 T21 I22	N14-Y18 WeakPolarHBondContact ND2-CE2 3.34Å; N14-Y18 WeakPolarHBondContact O-CB 3.49Å; N14-Y18 WeakPolarHBondContact O-CD2 3.45Å; N14-Y18 PolarHBondContact O-N 2.85Å; A15-Y18 PolarHBondContact O-N 3.45Å; G16-Y18 PolarHBondContact O-N 3.08Å; Y18-T21 PolarHBondContact O-N 2.81Å; Y18-I22 WeakPolarHBondContact O-CD1 3.49Å; Y18-I22 VanDerWaalsContact O-CG1 3.25Å; Y18-I22 WeakPolarHBondContact O-CG1 3.34Å; Y18-I22 PolarHBondContact O-N 3.12Å
19	R	90.8	Very high	86.7	Confident	195 Å²	195	118 Å²	118	74%	0.736	57%	0.566	S	S	*	*	H	α-helix	trans	-60.1	-47.8	175.4	-105.1	-178.2	172.8	-154.9	-1	111.9	A15 G16 T21 I22 I23	A15-R19 PolarHBondContact O-N 2.88Å; A15-R19 VanDerWaalsContact O-N 3.08Å; G16-R19 PolarHBondContact O-N 3.49Å; R19-T21 VanDerWaalsContact C-N 3.29Å; R19-T21 PolarHBondContact O-N 3.45Å; R19-I22 PolarHBondContact O-N 3.01Å; R19-I23 WeakPolarHBondContact O-CG1 3.24Å; R19-I23 PolarHBondContact O-N 2.97Å
20	L	90.9	Very high	86.8	Confident	121 Å²	121	118.1 Å²	118.1	63%	0.634	57%	0.57	S	S	*	*	H	α-helix	trans	-60.6	-41.5	179.3	-144.2	82.6	0	0	0	111.1	G16 Y17 I23 W24	G16-L20 WeakPolarHBondContact O-CB 3.25Å; G16-L20 PolarHBondContact O-N 2.88Å; Y17-L20 PolarHBondContact O-N 3.36Å; L20-I23 PolarHBondContact O-N 3.33Å; L20-W24 VanDerWaalsContact O-CB 3.24Å; L20-W24 WeakPolarHBondContact O-CB 3.36Å; L20-W24 PolarHBondContact O-N 2.78Å
21	T	90	Very high	86.6	Confident	63 Å²	63	115.5 Å²	115.5	39%	0.387	57%	0.565	S	S	.	*	H	α-helix	trans	-66.8	-38.6	178.9	-54.8	0	0	0	0	111.8	Y17 Y18 R19 W24 K25	Y17-T21 VanDerWaalsContact O-CB 3.3Å; Y17-T21 WeakPolarHBondContact O-CB 3.22Å; Y17-T21 PolarHBondContact O-N 2.82Å; Y17-T21 PolarHBondContact O-OG1 2.82Å; Y18-T21 PolarHBondContact O-N 2.81Å; R19-T21 VanDerWaalsContact C-N 3.29Å; R19-T21 PolarHBondContact O-N 3.45Å; T21-W24 PolarHBondContact O-N 2.84Å; T21-K25 WeakPolarHBondContact O-CB 3.49Å; T21-K25 WeakPolarHBondContact O-CG 3.17Å; T21-K25 PolarHBondContact O-N 3.35Å
22	I	90.6	Very high	86	Confident	112 Å²	112	116.8 Å²	116.8	57%	0.574	57%	0.566	S	S	*	*	H	α-helix	trans	-64.9	-45.6	175.4	-68	162.9	0	0	0	110.3	Y18 R19 K25 R26	Y18-I22 WeakPolarHBondContact O-CD1 3.49Å; Y18-I22 VanDerWaalsContact O-CG1 3.25Å; Y18-I22 WeakPolarHBondContact O-CG1 3.34Å; Y18-I22 PolarHBondContact O-N 3.12Å; R19-I22 PolarHBondContact O-N 3.01Å; I22-K25 PolarHBondContact O-N 3.26Å; I22-R26 WeakPolarHBondContact O-CB 3.4Å; I22-R26 PolarHBondContact O-N 3.4Å
23	I	88.8	Confident	85.1	Confident	102 Å²	102	120.1 Å²	120.1	52%	0.523	57%	0.565	S	S	.	*	H	α-helix	trans	-63.3	-46.7	177.2	-64.8	163.9	0	0	0	110	R19 L20 K25 R26 C27	R19-I23 WeakPolarHBondContact O-CG1 3.24Å; R19-I23 PolarHBondContact O-N 2.97Å; L20-I23 PolarHBondContact O-N 3.33Å; I23-K25 PolarHBondContact O-N 3.41Å; I23-R26 PolarHBondContact O-N 2.77Å; I23-R26 VanDerWaalsContact O-N 3.12Å; I23-C27 PolarHBondContact O-N 3.49Å
24	W	85.9	Confident	84.1	Confident	188 Å²	188	122.2 Å²	122.2	71%	0.712	57%	0.566	S	S	*	*	H	α-helix	trans	-58.5	-47.2	177.3	-174.5	-94.1	0	0	0	111.5	L20 T21 R26 C27 H28	L20-W24 VanDerWaalsContact O-CB 3.24Å; L20-W24 WeakPolarHBondContact O-CB 3.36Å; L20-W24 PolarHBondContact O-N 2.78Å; T21-W24 PolarHBondContact O-N 2.84Å; W24-R26 VanDerWaalsContact C-N 3.31Å; W24-R26 PolarHBondContact O-N 2.88Å; W24-C27 PolarHBondContact O-N 3.42Å; W24-H28 WeakPolarHBondContact O-CB 3.33Å; W24-H28 PolarHBondContact O-N 3.36Å
25	K	88	Confident	82.8	Confident	148 Å²	148	121 Å²	121	64%	0.643	57%	0.565	S	S	*	*	H	α-helix	trans	-59.9	-41.6	174.8	-80.5	-172.9	178	-169.1	0	111.6	T21 I22 I23 N29	T21-K25 WeakPolarHBondContact O-CB 3.49Å; T21-K25 WeakPolarHBondContact O-CG 3.17Å; T21-K25 PolarHBondContact O-N 3.35Å; I22-K25 PolarHBondContact O-N 3.26Å; I23-K25 PolarHBondContact O-N 3.41Å; K25-N29 WeakPolarHBondContact O-CB 3.32Å; K25-N29 PolarHBondContact O-N 2.82Å
26	R	87.3	Confident	81.5	Confident	204 Å²	204	121.8 Å²	121.8	77%	0.77	56%	0.563	S	S	*	*	H	α-helix	trans	-66.5	-44.1	178.3	-165.6	173.7	-174.9	175.1	1	112	I22 I23 W24 F30	I22-R26 WeakPolarHBondContact O-CB 3.4Å; I22-R26 PolarHBondContact O-N 3.4Å; I23-R26 PolarHBondContact O-N 2.77Å; I23-R26 VanDerWaalsContact O-N 3.12Å; W24-R26 VanDerWaalsContact C-N 3.31Å; W24-R26 PolarHBondContact O-N 2.88Å; R26-F30 WeakPolarHBondContact O-CB 3.02Å; R26-F30 PolarHBondContact O-N 2.92Å
27	C	84.6	Confident	79.8	Confident	79 Å²	79	127.2 Å²	127.2	53%	0.534	58%	0.575	S	S	.	*	H	α-helix	trans	-64.8	-45.9	174.4	-80.8	0	0	0	0	111.8	I23 W24 N29 F30 F31	I23-C27 PolarHBondContact O-N 3.49Å; W24-C27 PolarHBondContact O-N 3.42Å; C27-N29 VanDerWaalsContact C-N 3.34Å; C27-N29 PolarHBondContact O-N 3.32Å; C27-F30 PolarHBondContact O-N 2.79Å; C27-F31 WeakPolarHBondContact O-CB 3.3Å; C27-F31 PolarHBondContact O-N 3.32Å
28	H	84.3	Confident	78.5	Confident	108 Å²	108	123.9 Å²	123.9	50%	0.5	57%	0.574	S	S	.	*	H	α-helix	trans	-61.6	-44.5	178	-176.6	-96	0	0	0	111.1	W24 F31 M32	W24-H28 WeakPolarHBondContact O-CB 3.33Å; W24-H28 PolarHBondContact O-N 3.36Å; H28-F31 PolarHBondContact O-N 3.33Å; H28-M32 VanDerWaalsContact O-CB 3.29Å; H28-M32 WeakPolarHBondContact O-CB 3.48Å; H28-M32 PolarHBondContact O-N 3.48Å
29	N	81.5	Confident	76.9	Confident	80 Å²	80	125.6 Å²	125.6	43%	0.428	59%	0.585	S	S	.	*	H	α-helix	trans	-64.7	-44.3	176.5	-178.9	-98.5	0	0	0	111.4	K25 C27 F31 M32 Y33	K25-N29 WeakPolarHBondContact O-CB 3.32Å; K25-N29 PolarHBondContact O-N 2.82Å; C27-N29 VanDerWaalsContact C-N 3.34Å; C27-N29 PolarHBondContact O-N 3.32Å; N29-F31 PolarHBondContact O-N 2.82Å; N29-M32 PolarHBondContact O-N 2.84Å; N29-Y33 WeakPolarHBondContact ND2-CE2 3.38Å; N29-Y33 WeakPolarHBondContact O-CB 3.41Å; N29-Y33 WeakPolarHBondContact O-CD2 3.39Å; N29-Y33 PolarHBondContact O-N 2.8Å; N29-Y33 WeakPolarHBondContact OD1-CD2 2.97Å; N29-Y33 WeakPolarHBondContact OD1-CE2 3.29Å
30	F	80.3	Confident	75.2	Confident	136 Å²	136	123.2 Å²	123.2	60%	0.596	59%	0.586	S	S	*	*	H	α-helix	trans	-59.5	-43.4	172.7	-178.3	-97.6	0	0	0	112.4	R26 C27 Y33 R34	R26-F30 WeakPolarHBondContact O-CB 3.02Å; R26-F30 PolarHBondContact O-N 2.92Å; C27-F30 PolarHBondContact O-N 2.79Å; F30-Y33 PolarHBondContact O-N 2.86Å; F30-R34 VanDerWaalsContact O-CB 3.24Å; F30-R34 WeakPolarHBondContact O-CB 3.21Å; F30-R34 PolarHBondContact O-N 3.23Å
31	F	78.3	Confident	73.3	Confident	131 Å²	131	129.2 Å²	129.2	58%	0.575	61%	0.607	S	S	*	*	H	α-helix	trans	-68	-39.3	178.6	-142.1	-86	0	0	0	111.7	C27 H28 N29 R34 S35	C27-F31 WeakPolarHBondContact O-CB 3.3Å; C27-F31 PolarHBondContact O-N 3.32Å; H28-F31 PolarHBondContact O-N 3.33Å; N29-F31 PolarHBondContact O-N 2.82Å; F31-R34 PolarHBondContact O-N 3.44Å; F31-S35 WeakPolarHBondContact O-CB 3.24Å; F31-S35 PolarHBondContact O-N 3.31Å
32	M	70.8	Confident	72.4	Confident	117 Å²	117	132.5 Å²	132.5	58%	0.576	62%	0.618	S	S	*	*	H	α-helix	trans	-67.2	-43.7	176	-155.1	-168.2	-178.2	0	0	110.9	H28 N29 R34 S35 V36	H28-M32 VanDerWaalsContact O-CB 3.29Å; H28-M32 WeakPolarHBondContact O-CB 3.48Å; H28-M32 PolarHBondContact O-N 3.48Å; N29-M32 PolarHBondContact O-N 2.84Å; M32-R34 VanDerWaalsContact C-N 3.32Å; M32-R34 PolarHBondContact O-N 2.82Å; M32-S35 PolarHBondContact O-N 3.46Å; M32-V36 VanDerWaalsContact O-CG2 3.29Å; M32-V36 WeakPolarHBondContact O-CG2 3.49Å; M32-V36 PolarHBondContact O-N 3.31Å
33	Y	65.7	Low	71.5	Confident	137 Å²	137	133.6 Å²	133.6	54%	0.537	62%	0.62	S	S	.	*	H	α-helix	trans	-60.5	-41.7	171.8	-82.4	-63.1	0	0	0	111.6	N29 F30 S35 V36 F37	N29-Y33 WeakPolarHBondContact ND2-CE2 3.38Å; N29-Y33 WeakPolarHBondContact O-CB 3.41Å; N29-Y33 WeakPolarHBondContact O-CD2 3.39Å; N29-Y33 PolarHBondContact O-N 2.8Å; N29-Y33 WeakPolarHBondContact OD1-CD2 2.97Å; N29-Y33 WeakPolarHBondContact OD1-CE2 3.29Å; F30-Y33 PolarHBondContact O-N 2.86Å; Y33-S35 VanDerWaalsContact C-N 3.34Å; Y33-S35 PolarHBondContact O-N 2.84Å; Y33-V36 PolarHBondContact O-N 3.3Å; Y33-F37 WeakPolarHBondContact O-CB 3.07Å; Y33-F37 WeakPolarHBondContact O-CD2 3.18Å; Y33-F37 PolarHBondContact O-N 3.48Å
34	R	64	Low	70.5	Confident	150 Å²	150	135.3 Å²	135.3	57%	0.566	63%	0.625	S	S	*	*	H	α-helix	trans	-64.7	-37.4	176.2	-168.5	176.9	178.5	-153.6	-0.2	112.2	F30 F31 M32 S38	F30-R34 VanDerWaalsContact O-CB 3.24Å; F30-R34 WeakPolarHBondContact O-CB 3.21Å; F30-R34 PolarHBondContact O-N 3.23Å; F31-R34 PolarHBondContact O-N 3.44Å; M32-R34 VanDerWaalsContact C-N 3.32Å; M32-R34 PolarHBondContact O-N 2.82Å; R34-S38 VanDerWaalsContact O-CB 3.3Å; R34-S38 WeakPolarHBondContact O-CB 3.31Å; R34-S38 PolarHBondContact O-N 2.95Å; R34-S38 PolarHBondContact O-OG 2.82Å
35	S	62.2	Low	69.6	Low	66 Å²	66	132.2 Å²	132.2	46%	0.462	62%	0.62	S	S	.	*	H	α-helix	trans	-68.4	-42.6	172.5	-86.4	0	0	0	0	112.3	F31 M32 Y33 S38 K39	F31-S35 WeakPolarHBondContact O-CB 3.24Å; F31-S35 PolarHBondContact O-N 3.31Å; M32-S35 PolarHBondContact O-N 3.46Å; Y33-S35 VanDerWaalsContact C-N 3.34Å; Y33-S35 PolarHBondContact O-N 2.84Å; S35-S38 PolarHBondContact O-N 3.24Å; S35-K39 VanDerWaalsContact O-CB 3.31Å; S35-K39 WeakPolarHBondContact O-CB 3.29Å; S35-K39 PolarHBondContact O-N 3.4Å
36	V	61.7	Low	68.4	Low	73 Å²	73	131.3 Å²	131.3	44%	0.442	62%	0.619	S	S	.	*	H	α-helix	trans	-63.4	-44.6	176.3	173.7	0	0	0	0	110.2	M32 Y33 K39 L40	M32-V36 VanDerWaalsContact O-CG2 3.29Å; M32-V36 WeakPolarHBondContact O-CG2 3.49Å; M32-V36 PolarHBondContact O-N 3.31Å; Y33-V36 PolarHBondContact O-N 3.3Å; V36-K39 PolarHBondContact O-N 3.4Å; V36-L40 HydrophobicContact CG1-CD1 4.14Å; V36-L40 PolarHBondContact O-N 3.12Å; V36-L40 VanDerWaalsContact O-N 3.12Å
37	F	55.3	Low	67.2	Low	157 Å²	157	126.4 Å²	126.4	69%	0.689	61%	0.609	S	S	*	*	H	α-helix	trans	-65.6	-37.6	174.5	-96	-86.5	0	0	0	113	Y33 K39 L40	Y33-F37 WeakPolarHBondContact O-CB 3.07Å; Y33-F37 WeakPolarHBondContact O-CD2 3.18Å; Y33-F37 PolarHBondContact O-N 3.48Å; F37-K39 PolarHBondContact O-N 3.47Å; F37-L40 PolarHBondContact O-N 2.81Å
38	S	59.1	Low	65.9	Low	83 Å²	83	129.8 Å²	129.8	58%	0.58	61%	0.614	S	S	*	*	H	α-helix	trans	-68.7	-24.4	175.3	-62.3	0	0	0	0	112.8	R34 S35	R34-S38 VanDerWaalsContact O-CB 3.3Å; R34-S38 WeakPolarHBondContact O-CB 3.31Å; R34-S38 PolarHBondContact O-N 2.95Å; R34-S38 PolarHBondContact O-OG 2.82Å; S35-S38 PolarHBondContact O-N 3.24Å
39	K	54.3	Low	64.5	Low	188 Å²	188	131.5 Å²	131.5	82%	0.817	62%	0.623	S	S	*	*	H	α-helix	trans	-91.6	-9.5	179.6	-157.7	155.2	-175.4	171.9	0	113.4	S35 V36 F37	S35-K39 VanDerWaalsContact O-CB 3.31Å; S35-K39 WeakPolarHBondContact O-CB 3.29Å; S35-K39 PolarHBondContact O-N 3.4Å; V36-K39 PolarHBondContact O-N 3.4Å; F37-K39 PolarHBondContact O-N 3.47Å
40	L	56	Low	63.1	Low	144 Å²	144	135.8 Å²	135.8	75%	0.754	64%	0.639	S	S	*	*			trans	-89.6	-6.2	175.6	-120.2	128.5	0	0	0	113.2	V36 F37	V36-L40 HydrophobicContact CG1-CD1 4.14Å; V36-L40 PolarHBondContact O-N 3.12Å; V36-L40 VanDerWaalsContact O-N 3.12Å; F37-L40 PolarHBondContact O-N 2.81Å
41	K	49.7	Very low	61.5	Low	247 Å²	247	135.7 Å²	135.7	100%	1.074	64%	0.643	S	S	*	*			trans	-103.6	0	172.7	-163.8	177.4	-174.2	177.6	0	109.6

Retrieved 41 of 41 residues in 23.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).