A0A5K4F9W7_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F9W7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 100 aa.

						>A0A5K4F9W7_SCHMA|A0A5K4F9W7
MHVLVSLRLGNPHITKDAKCQNVVFTPVIIFYYQKRQVDTTGNSSGNSTQGVQASSDIQLVSPNATELNETEFNNILVTGYNQANSSSEIQLFNVETNAS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.5	Low	87.7	Confident	135 Å²	135	54.1 Å²	54.1	67%	0.665	28%	0.279	S	S	*	.				0	89.7	0	-173.9	-171.5	-120	0	0	108.5	L4 C20 V23	M1-L4 HydrophobicContact SD-CD1 3.64Å; M1-L4 HydrophobicContact SD-CG 4.04Å; M1-C20 HydrophobicContact CE-CB 3.44Å; M1-C20 VanDerWaalsContact CE-CB 3.44Å; M1-C20 WeakPolarHBondContact CE-SG 3.39Å; M1-C20 HydrophobicContact SD-CB 3.93Å; M1-V23 HydrophobicContact CE-CG2 3.73Å
2	H	77.6	Confident	88.2	Confident	72 Å²	72	55.8 Å²	55.8	33%	0.333	30%	0.296	S	S	.	.	H	α-helix	trans	-76.6	-28.3	-171.3	-77.5	-97.5	0	0	0	113.5	L4 V5 S6	H2-L4 PolarHBondContact O-N 3.21Å; H2-V5 PolarHBondContact O-N 2.96Å; H2-V5 VanDerWaalsContact O-N 3.09Å; H2-S6 WeakPolarHBondContact O-CB 3.47Å; H2-S6 PolarHBondContact O-N 3.5Å; H2-S6 PolarHBondContact O-OG 3.22Å; H2-S6 VanDerWaalsContact O-OG 3.08Å
3	V	87.6	Confident	88.5	Confident	39 Å²	39	64.1 Å²	64.1	24%	0.236	33%	0.331	C	S	.	.	H	α-helix	trans	-56.1	-49.3	-176.1	-179.7	0	0	0	0	112.5	V5 S6 L7 I58 L77	V3-V5 VanDerWaalsContact C-N 3.32Å; V3-V5 PolarHBondContact O-N 3.47Å; V3-S6 PolarHBondContact O-N 3.21Å; V3-L7 HydrophobicContact CG1-CD1 3.93Å; V3-L7 HydrophobicContact CG1-CG 4.33Å; V3-L7 WeakPolarHBondContact O-CB 3.44Å; V3-L7 VanDerWaalsContact O-CG 3.25Å; V3-L7 WeakPolarHBondContact O-CG 3.37Å; V3-L7 PolarHBondContact O-N 3.37Å; V3-I58 HydrophobicContact CG1-CD1 3.75Å; V3-I58 HydrophobicContact CG1-CG1 4.28Å; V3-L77 HydrophobicContact CG1-CD1 4.01Å
4	L	91.7	Very high	88.9	Confident	26 Å²	26	61 Å²	61	14%	0.136	32%	0.315	C	S	.	.	H	α-helix	trans	-65.3	-34.5	178.8	-70.8	-178.3	0	0	0	113.1	M1 H2 L7 R8 A18 C20	M1-L4 HydrophobicContact SD-CD1 3.64Å; M1-L4 HydrophobicContact SD-CG 4.04Å; H2-L4 PolarHBondContact O-N 3.21Å; L4-L7 HydrophobicContact CD2-CD1 4.45Å; L4-R8 WeakPolarHBondContact O-CB 3.3Å; L4-R8 WeakPolarHBondContact O-CD 3.43Å; L4-R8 WeakPolarHBondContact O-CG 3.35Å; L4-R8 PolarHBondContact O-N 3.06Å; L4-R8 VanDerWaalsContact O-N 3.07Å; L4-A18 HydrophobicContact CD2-CB 3.95Å; L4-A18 WeakPolarHBondContact CD2-O 3.11Å; L4-C20 HydrophobicContact CD1-CB 3.93Å; L4-C20 HydrophobicContact CD2-CB 3.88Å; L4-C20 HydrophobicContact CG-CB 3.77Å
5	V	90.6	Very high	89.2	Confident	71 Å²	71	57 Å²	57	43%	0.43	30%	0.295	S	S	.	.	H	α-helix	trans	-68.1	-47.3	176.2	175.7	0	0	0	0	109.8	H2 V3 L7 R8 L9	H2-V5 PolarHBondContact O-N 2.96Å; H2-V5 VanDerWaalsContact O-N 3.09Å; V3-V5 VanDerWaalsContact C-N 3.32Å; V3-V5 PolarHBondContact O-N 3.47Å; V5-L7 PolarHBondContact O-N 3.31Å; V5-R8 PolarHBondContact O-N 2.93Å; V5-L9 HydrophobicContact CG1-CD1 3.98Å; V5-L9 HydrophobicContact CG1-CG 4.44Å; V5-L9 WeakPolarHBondContact O-CG 3.33Å; V5-L9 PolarHBondContact O-N 2.92Å
6	S	90.6	Very high	89.3	Confident	1 Å²	1	62.2 Å²	62.2	1%	0.007	31%	0.314	C	S	.	.	H	α-helix	trans	-57.8	-49.3	175.4	-61.8	0	0	0	0	111	H2 V3 R8 L9 G10 G80 Y81	H2-S6 WeakPolarHBondContact O-CB 3.47Å; H2-S6 PolarHBondContact O-N 3.5Å; H2-S6 PolarHBondContact O-OG 3.22Å; H2-S6 VanDerWaalsContact O-OG 3.08Å; V3-S6 PolarHBondContact O-N 3.21Å; S6-R8 VanDerWaalsContact C-N 3.32Å; S6-R8 PolarHBondContact O-N 2.95Å; S6-L9 PolarHBondContact O-N 2.86Å; S6-G10 PolarHBondContact O-N 3Å; S6-G80 VanDerWaalsContact O-CA 3.23Å; S6-G80 WeakPolarHBondContact O-CA 3.36Å; S6-Y81 WeakPolarHBondContact OG-CA 3.43Å
7	L	93.8	Very high	89.5	Confident	0 Å²	0	64.4 Å²	64.4	0%	0	33%	0.327	C	S	.	.	H	α-helix	trans	-56.1	-46	176.9	-72.2	173.1	0	0	0	112.1	V3 L4 V5 L9 G10 N11 T15 I58 F73 I76 L77	V3-L7 HydrophobicContact CG1-CD1 3.93Å; V3-L7 HydrophobicContact CG1-CG 4.33Å; V3-L7 WeakPolarHBondContact O-CB 3.44Å; V3-L7 VanDerWaalsContact O-CG 3.25Å; V3-L7 WeakPolarHBondContact O-CG 3.37Å; V3-L7 PolarHBondContact O-N 3.37Å; L4-L7 HydrophobicContact CD2-CD1 4.45Å; V5-L7 PolarHBondContact O-N 3.31Å; L7-L9 PolarHBondContact O-N 2.95Å; L7-G10 PolarHBondContact O-N 3.49Å; L7-N11 PolarHBondContact O-N 3.19Å; L7-T15 HydrophobicContact CB-CG2 3.88Å; L7-T15 HydrophobicContact CD2-CG2 4.41Å; L7-T15 PolarHBondContact O-OG1 2.93Å; L7-I58 HydrophobicContact CD1-CD1 4.45Å; L7-I58 HydrophobicContact CD1-CG1 4.47Å; L7-I58 HydrophobicContact CD1-CG2 3.68Å; L7-F73 HydrophobicContact CD1-CE2 4.36Å; L7-F73 HydrophobicContact CD1-CZ 4.18Å; L7-F73 HydrophobicContact CD2-CD2 4.45Å; L7-F73 HydrophobicContact CD2-CE1 4.48Å; L7-F73 HydrophobicContact CD2-CE2 3.77Å; L7-F73 HydrophobicContact CD2-CZ 3.78Å; L7-I76 HydrophobicContact CD2-CG2 3.99Å; L7-L77 HydrophobicContact CD2-CB 4.11Å; L7-L77 HydrophobicContact CD2-CD1 4.25Å; L7-L77 HydrophobicContact CG-CD1 4.21Å
8	R	94.3	Very high	89.8	Confident	118 Å²	118	61.1 Å²	61.1	45%	0.445	31%	0.311	S	S	.	.	H	α-helix	trans	-63.6	-38.2	178.6	-74.8	171.7	178.6	170.9	2.2	113.6	L4 V5 S6 P12 T15 K16	L4-R8 WeakPolarHBondContact O-CB 3.3Å; L4-R8 WeakPolarHBondContact O-CD 3.43Å; L4-R8 WeakPolarHBondContact O-CG 3.35Å; L4-R8 PolarHBondContact O-N 3.06Å; L4-R8 VanDerWaalsContact O-N 3.07Å; V5-R8 PolarHBondContact O-N 2.93Å; S6-R8 VanDerWaalsContact C-N 3.32Å; S6-R8 PolarHBondContact O-N 2.95Å; R8-P12 WeakPolarHBondContact O-CA 3.42Å; R8-P12 VanDerWaalsContact O-CB 3.28Å; R8-P12 WeakPolarHBondContact O-CB 3.33Å; R8-P12 WeakPolarHBondContact O-CD 3.42Å; R8-P12 VanDerWaalsContact O-N 3.16Å; R8-T15 VanDerWaalsContact CA-OG1 3.23Å; R8-T15 WeakPolarHBondContact CA-OG1 3.44Å; R8-T15 PolarHBondContact N-OG1 3.39Å; R8-K16 PolarHBondContact NE-O 3Å
9	L	93.2	Very high	90	Very high	70 Å²	70	63.9 Å²	63.9	37%	0.366	32%	0.321	S	S	.	.	H	α-helix	trans	-73	-37.8	176	-69.1	173.9	0	0	0	111.8	V5 S6 L7 Q83 A84	V5-L9 HydrophobicContact CG1-CD1 3.98Å; V5-L9 HydrophobicContact CG1-CG 4.44Å; V5-L9 WeakPolarHBondContact O-CG 3.33Å; V5-L9 PolarHBondContact O-N 2.92Å; S6-L9 PolarHBondContact O-N 2.86Å; L7-L9 PolarHBondContact O-N 2.95Å; L9-Q83 HydrophobicContact CB-CB 4.32Å; L9-Q83 HydrophobicContact CD1-CB 4.39Å; L9-Q83 PolarHBondContact O-OE1 2.92Å; L9-A84 HydrophobicContact CD1-CB 3.88Å
10	G	93.8	Very high	90.2	Very high	22 Å²	22	61.9 Å²	61.9	23%	0.227	31%	0.313	C	S	.	.	H	α-helix	trans	-69.4	-42.5	-179	0	0	0	0	0	113.2	S6 L7 I76	S6-G10 PolarHBondContact O-N 3Å; L7-G10 PolarHBondContact O-N 3.49Å; G10-I76 WeakPolarHBondContact CA-O 3.49Å
11	N	94.8	Very high	90.3	Very high	41 Å²	41	63 Å²	63	22%	0.219	32%	0.317	C	S	.	.			trans	-153.3	89.1	175.1	-171.1	-32.4	0	0	0	110.6	L7 H13 I14 T15 I76	L7-N11 PolarHBondContact O-N 3.19Å; N11-H13 PolarHBondContact O-N 2.83Å; N11-H13 PolarHBondContact OD1-N 3.23Å; N11-I14 WeakPolarHBondContact ND2-CD1 3.32Å; N11-I14 PolarHBondContact O-N 3.17Å; N11-I14 PolarHBondContact OD1-N 3.12Å; N11-I14 VanDerWaalsContact OD1-N 3.12Å; N11-T15 WeakPolarHBondContact O-CB 3.34Å; N11-T15 WeakPolarHBondContact O-CG2 3.29Å; N11-T15 PolarHBondContact O-N 3.43Å; N11-T15 VanDerWaalsContact O-N 3.17Å; N11-T15 PolarHBondContact O-OG1 3.49Å; N11-I76 HydrophobicContact CB-CB 4.46Å; N11-I76 HydrophobicContact CB-CD1 3.91Å; N11-I76 HydrophobicContact CB-CG1 3.86Å; N11-I76 HydrophobicContact CB-CG2 3.79Å
12	P	93.4	Very high	92.1	Very high	74 Å²	74	61.9 Å²	61.9	48%	0.481	31%	0.314	S	S	.	.	H	α-helix	trans	-65.1	-23.8	-176	23.7	-32.7	0	0	0	112.9	R8 K16	R8-P12 WeakPolarHBondContact O-CA 3.42Å; R8-P12 VanDerWaalsContact O-CB 3.28Å; R8-P12 WeakPolarHBondContact O-CB 3.33Å; R8-P12 WeakPolarHBondContact O-CD 3.42Å; R8-P12 VanDerWaalsContact O-N 3.16Å; P12-K16 WeakPolarHBondContact O-CB 3.35Å; P12-K16 PolarHBondContact O-N 2.96Å
13	H	93.1	Very high	92.8	Very high	164 Å²	164	61.1 Å²	61.1	76%	0.759	31%	0.314	S	S	*	.	H	α-helix	trans	-73.4	-42.4	-178.2	-69.2	-66.9	0	0	0	112.5	N11	N11-H13 PolarHBondContact O-N 2.83Å; N11-H13 PolarHBondContact OD1-N 3.23Å
14	I	93.2	Very high	93.1	Very high	21 Å²	21	62.9 Å²	62.9	11%	0.108	32%	0.324	C	S	.	.	H	α-helix	trans	-84.6	-28.7	-178.4	-59.6	176.3	0	0	0	111.7	N11 L60 S62 N64 A65 L68	N11-I14 WeakPolarHBondContact ND2-CD1 3.32Å; N11-I14 PolarHBondContact O-N 3.17Å; N11-I14 PolarHBondContact OD1-N 3.12Å; N11-I14 VanDerWaalsContact OD1-N 3.12Å; I14-L60 HydrophobicContact CG2-CD1 4.38Å; I14-S62 WeakPolarHBondContact O-CB 3.45Å; I14-N64 HydrophobicContact CD1-CB 4.49Å; I14-N64 HydrophobicContact CG1-CB 4.34Å; I14-A65 HydrophobicContact CG2-CB 3.85Å; I14-L68 HydrophobicContact CD1-CD1 4.28Å; I14-L68 HydrophobicContact CD1-CD2 4.17Å; I14-L68 HydrophobicContact CD1-CG 4.38Å; I14-L68 HydrophobicContact CG2-CD1 3.61Å
15	T	93.5	Very high	93.2	Very high	1 Å²	1	68.2 Å²	68.2	1%	0.006	35%	0.347	C	S	.	.	H	α-helix	trans	-108.1	4.3	-168.8	68.6	0	0	0	0	114.4	L7 R8 N11 D17 A18 L60 I76	L7-T15 HydrophobicContact CB-CG2 3.88Å; L7-T15 HydrophobicContact CD2-CG2 4.41Å; L7-T15 PolarHBondContact O-OG1 2.93Å; R8-T15 VanDerWaalsContact CA-OG1 3.23Å; R8-T15 WeakPolarHBondContact CA-OG1 3.44Å; R8-T15 PolarHBondContact N-OG1 3.39Å; N11-T15 WeakPolarHBondContact O-CB 3.34Å; N11-T15 WeakPolarHBondContact O-CG2 3.29Å; N11-T15 PolarHBondContact O-N 3.43Å; N11-T15 VanDerWaalsContact O-N 3.17Å; N11-T15 PolarHBondContact O-OG1 3.49Å; T15-D17 VanDerWaalsContact C-N 3.29Å; T15-D17 PolarHBondContact O-N 3.21Å; T15-A18 WeakPolarHBondContact O-CB 3.44Å; T15-A18 PolarHBondContact O-N 3.23Å; T15-L60 HydrophobicContact CG2-CD2 4.19Å; T15-I76 HydrophobicContact CG2-CG2 4.05Å
16	K	91.4	Very high	93.3	Very high	140 Å²	140	68 Å²	68	61%	0.609	35%	0.346	S	S	*	.	T	Hydrogen-bonded Turn	trans	-45.1	-53	-177.1	-171.2	179.7	175.4	-174.4	0	112.9	R8 P12	R8-K16 PolarHBondContact NE-O 3Å; P12-K16 WeakPolarHBondContact O-CB 3.35Å; P12-K16 PolarHBondContact O-N 2.96Å
17	D	93	Very high	93.4	Very high	100 Å²	100	73.3 Å²	73.3	54%	0.535	38%	0.38	S	S	.	.	T	Hydrogen-bonded Turn	trans	-102.2	18.7	-175.8	-56.3	-49.8	0	0	0	112.5	T15 K19 V61	T15-D17 VanDerWaalsContact C-N 3.29Å; T15-D17 PolarHBondContact O-N 3.21Å; D17-K19 PolarHBondContact O-N 3.25Å; D17-V61 HydrophobicContact CB-CB 4.21Å; D17-V61 HydrophobicContact CB-CG2 4.37Å; D17-V61 WeakPolarHBondContact O-CG2 3.33Å
18	A	93.8	Very high	93.2	Very high	5 Å²	5	75.4 Å²	75.4	4%	0.041	39%	0.393	C	S	.	.			trans	-58.9	138.8	178.6	0	0	0	0	0	111.1	L4 T15 Q59 L60	L4-A18 HydrophobicContact CD2-CB 3.95Å; L4-A18 WeakPolarHBondContact CD2-O 3.11Å; T15-A18 WeakPolarHBondContact O-CB 3.44Å; T15-A18 PolarHBondContact O-N 3.23Å; A18-Q59 WeakPolarHBondContact CA-O 3.22Å; A18-L60 HydrophobicContact CB-CD2 3.7Å
19	K	94.2	Very high	92.8	Very high	115 Å²	115	74.8 Å²	74.8	50%	0.5	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	142.5	176.2	-61.5	179.5	-177.7	175.3	0	109.4	D17 Q21 I58 Q59	D17-K19 PolarHBondContact O-N 3.25Å; K19-Q21 HydrophobicContact CB-CG 4.36Å; K19-I58 WeakPolarHBondContact O-CA 3.28Å; K19-Q59 HydrophobicContact CB-CB 4.37Å; K19-Q59 PolarHBondContact N-O 2.95Å; K19-Q59 PolarHBondContact O-N 2.88Å
20	C	93.1	Very high	92.3	Very high	22 Å²	22	74 Å²	74	15%	0.149	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.1	120.6	173.3	180	0	0	0	0	108.1	M1 L4 S56 D57 I58	M1-C20 HydrophobicContact CE-CB 3.44Å; M1-C20 VanDerWaalsContact CE-CB 3.44Å; M1-C20 WeakPolarHBondContact CE-SG 3.39Å; M1-C20 HydrophobicContact SD-CB 3.93Å; L4-C20 HydrophobicContact CD1-CB 3.93Å; L4-C20 HydrophobicContact CD2-CB 3.88Å; L4-C20 HydrophobicContact CG-CB 3.77Å; C20-S56 WeakPolarHBondContact SG-CB 3.49Å; C20-D57 CarbonylContact C-O 3.6Å; C20-D57 WeakPolarHBondContact CA-O 3.38Å; C20-I58 HydrophobicContact CB-CD1 3.61Å; C20-I58 VanDerWaalsContact SG-CD1 3.52Å
21	Q	93.5	Very high	91.6	Very high	85 Å²	85	78.3 Å²	78.3	40%	0.397	41%	0.406	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.6	167.6	-170.6	-53.8	-173.2	48.7	0	0	109.7	K19 V23 D57 Q59	K19-Q21 HydrophobicContact CB-CG 4.36Å; Q21-V23 PolarHBondContact O-N 3.26Å; Q21-V23 VanDerWaalsContact O-N 3.11Å; Q21-D57 PolarHBondContact N-O 3.2Å; Q21-D57 PolarHBondContact O-N 2.91Å; Q21-Q59 VanDerWaalsContact NE2-OE1 3.11Å
22	N	93	Very high	90.4	Very high	113 Å²	113	80.9 Å²	80.9	60%	0.604	41%	0.413	S	S	*	.	E	Extended strand (participates in β ladder)	trans	50.2	41.4	175.6	-57.3	-30.1	0	0	0	113.6	V24 D57	N22-V24 PolarHBondContact O-N 2.93Å; N22-D57 WeakPolarHBondContact CB-OD2 3.32Å; N22-D57 PolarHBondContact ND2-OD2 3.29Å
23	V	92.9	Very high	89.1	Confident	55 Å²	55	87 Å²	87	33%	0.333	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.4	118.1	-177.8	-171.1	0	0	0	0	109.5	M1 Q21 F25 S55	M1-V23 HydrophobicContact CE-CG2 3.73Å; Q21-V23 PolarHBondContact O-N 3.26Å; Q21-V23 VanDerWaalsContact O-N 3.11Å; V23-F25 HydrophobicContact CG1-CD2 4.21Å; V23-F25 HydrophobicContact CG1-CE1 4.21Å; V23-F25 HydrophobicContact CG1-CE2 3.49Å; V23-F25 VanDerWaalsContact CG1-CE2 3.49Å; V23-F25 HydrophobicContact CG1-CZ 3.49Å; V23-F25 VanDerWaalsContact CG1-CZ 3.49Å; V23-S55 CarbonylContact C-O 3.57Å; V23-S55 VanDerWaalsContact CA-O 3.31Å; V23-S55 WeakPolarHBondContact CA-O 3.17Å
24	V	94.1	Very high	87.4	Confident	76 Å²	76	84.4 Å²	84.4	46%	0.461	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	134.6	174.7	-177.5	0	0	0	0	108.7	N22 A54 S55	N22-V24 PolarHBondContact O-N 2.93Å; V24-A54 WeakPolarHBondContact O-CA 3.08Å; V24-S55 PolarHBondContact N-O 3.26Å; V24-S55 PolarHBondContact O-N 3.44Å
25	F	93.1	Very high	85.6	Confident	138 Å²	138	93 Å²	93	61%	0.605	45%	0.453	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112.5	121.9	173.4	-63.2	-77.7	0	0	0	108.9	V23 V52 Q53 A54	V23-F25 HydrophobicContact CG1-CD2 4.21Å; V23-F25 HydrophobicContact CG1-CE1 4.21Å; V23-F25 HydrophobicContact CG1-CE2 3.49Å; V23-F25 VanDerWaalsContact CG1-CE2 3.49Å; V23-F25 HydrophobicContact CG1-CZ 3.49Å; V23-F25 VanDerWaalsContact CG1-CZ 3.49Å; F25-V52 HydrophobicContact CB-CG1 3.76Å; F25-V52 HydrophobicContact CD1-CG1 3.69Å; F25-V52 HydrophobicContact CG-CG1 4.18Å; F25-Q53 WeakPolarHBondContact CA-O 3.39Å; F25-A54 HydrophobicContact CD1-CB 3.76Å; F25-A54 HydrophobicContact CE1-CB 3.73Å
26	T	93.1	Very high	83.8	Confident	68 Å²	68	103.5 Å²	103.5	42%	0.417	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.8	122.7	177.1	-54.6	0	0	0	0	108.9	V28 Q53	T26-V28 PolarHBondContact O-N 2.71Å; T26-Q53 PolarHBondContact N-O 2.85Å; T26-Q53 PolarHBondContact O-N 3.11Å
27	P	92.2	Very high	81.8	Confident	112 Å²	112	103.6 Å²	103.6	73%	0.727	50%	0.495	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-64.9	134	172.4	28.2	-33.1	0	0	0	109.4
28	V	89.9	Confident	80	Confident	43 Å²	43	103.4 Å²	103.4	26%	0.261	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	153.9	179.5	-64.8	0	0	0	0	110.2	T26 I30 G51 Q53	T26-V28 PolarHBondContact O-N 2.71Å; V28-I30 HydrophobicContact CG2-CG1 4.26Å; V28-G51 PolarHBondContact N-O 2.98Å; V28-G51 PolarHBondContact O-N 2.87Å; V28-Q53 HydrophobicContact CG1-CB 3.8Å; V28-Q53 HydrophobicContact CG2-CB 4.23Å
29	I	87.5	Confident	78.2	Confident	105 Å²	105	106.1 Å²	106.1	54%	0.538	51%	0.511	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.4	118.4	168.8	-59.2	176.4	0	0	0	107.1	F31	I29-F31 HydrophobicContact CB-CE2 4.07Å; I29-F31 HydrophobicContact CB-CZ 4.24Å; I29-F31 HydrophobicContact CG2-CD1 4.46Å; I29-F31 HydrophobicContact CG2-CD2 4.24Å; I29-F31 HydrophobicContact CG2-CE1 3.97Å; I29-F31 HydrophobicContact CG2-CE2 3.72Å; I29-F31 HydrophobicContact CG2-CZ 3.58Å
30	I	81.4	Confident	76.7	Confident	53 Å²	53	108.1 Å²	108.1	27%	0.272	53%	0.533	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.2	120.3	175.4	-57.3	173.2	0	0	0	107.5	V28 Y32 S48 T49	V28-I30 HydrophobicContact CG2-CG1 4.26Å; I30-Y32 HydrophobicContact CG2-CE1 4.36Å; I30-S48 CarbonylContact O-C 3.56Å; I30-S48 VanDerWaalsContact O-CA 3.29Å; I30-S48 WeakPolarHBondContact O-CA 3.47Å; I30-T49 HydrophobicContact CB-CG2 3.93Å; I30-T49 HydrophobicContact CD1-CG2 4.37Å; I30-T49 PolarHBondContact N-O 2.84Å; I30-T49 PolarHBondContact O-N 3.4Å
31	F	78.6	Confident	75.3	Confident	113 Å²	113	112.1 Å²	112.1	50%	0.496	56%	0.557	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-95.4	119.8	176.6	-65.5	-84.3	0	0	0	110.5	I29 Y33	I29-F31 HydrophobicContact CB-CE2 4.07Å; I29-F31 HydrophobicContact CB-CZ 4.24Å; I29-F31 HydrophobicContact CG2-CD1 4.46Å; I29-F31 HydrophobicContact CG2-CD2 4.24Å; I29-F31 HydrophobicContact CG2-CE1 3.97Å; I29-F31 HydrophobicContact CG2-CE2 3.72Å; I29-F31 HydrophobicContact CG2-CZ 3.58Å; F31-Y33 HydrophobicContact CB-CE2 4.26Å
32	Y	71.5	Confident	73.5	Confident	95 Å²	95	110.4 Å²	110.4	37%	0.373	56%	0.562	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-90.1	102.2	167	-56.1	-78.3	0	0	0	108.8	I30 Q34 N47 T49	I30-Y32 HydrophobicContact CG2-CE1 4.36Å; Y32-Q34 PolarHBondContact O-N 2.88Å; Y32-N47 WeakPolarHBondContact CA-O 3.48Å; Y32-N47 WeakPolarHBondContact CB-O 3.23Å; Y32-N47 HydrophobicContact CD2-CB 4.42Å; Y32-N47 WeakPolarHBondContact CD2-O 3.44Å; Y32-N47 PolarHBondContact N-O 3.3Å; Y32-N47 PolarHBondContact O-N 3.33Å; Y32-T49 HydrophobicContact CE2-CG2 3.44Å; Y32-T49 VanDerWaalsContact CE2-CG2 3.44Å; Y32-T49 WeakPolarHBondContact OH-CG2 3.21Å
33	Y	65.1	Low	71.9	Confident	204 Å²	204	110.2 Å²	110.2	80%	0.8	56%	0.561	S	S	*	*			trans	-73.3	82.9	166	-58.6	-73.2	0	0	0	108.6	F31 K35	F31-Y33 HydrophobicContact CB-CE2 4.26Å; Y33-K35 PolarHBondContact O-N 2.64Å
34	Q	56.9	Low	70.2	Confident	108 Å²	108	112 Å²	112	51%	0.505	58%	0.576	S	S	.	*			trans	-61.6	133.8	162.4	-65.9	-167.8	-1.1	0	0	107.1	Y32 R36 N47	Y32-Q34 PolarHBondContact O-N 2.88Å; Q34-R36 PolarHBondContact O-N 3.25Å; Q34-N47 PolarHBondContact NE2-ND2 2.86Å
35	K	56.6	Low	68.4	Low	202 Å²	202	111.9 Å²	111.9	88%	0.878	58%	0.579	S	S	*	*	S	Bend	trans	-45.7	111.6	174.6	-72.3	-179	177.9	177.9	0	107.9	Y33 Q37	Y33-K35 PolarHBondContact O-N 2.64Å; K35-Q37 PolarHBondContact O-N 3.07Å
36	R	54.4	Low	67.1	Low	221 Å²	221	107.5 Å²	107.5	83%	0.834	57%	0.572	S	S	*	*			trans	-9.4	84.2	-179	-62.2	177.2	-177	134.3	-0.2	113	Q34 V38	Q34-R36 PolarHBondContact O-N 3.25Å; R36-V38 VanDerWaalsContact C-N 3.31Å; R36-V38 PolarHBondContact O-N 3.3Å
37	Q	50.6	Low	66.3	Low	143 Å²	143	107.6 Å²	107.6	67%	0.668	57%	0.57	S	S	*	*			trans	-77.8	100.7	153.9	-82.6	-168.8	5.7	0	0	104.2	K35 D39	K35-Q37 PolarHBondContact O-N 3.07Å; Q37-D39 PolarHBondContact O-N 2.85Å
38	V	55.3	Low	65.7	Low	96 Å²	96	105.7 Å²	105.7	58%	0.582	56%	0.56	S	S	*	*	B	Isolated β-bridge	trans	-72.1	106.9	162.7	-175.9	0	0	0	0	103.6	R36	R36-V38 VanDerWaalsContact C-N 3.31Å; R36-V38 PolarHBondContact O-N 3.3Å
39	D	55.6	Low	65.5	Low	62 Å²	62	106.5 Å²	106.5	33%	0.332	56%	0.564	S	S	.	*			trans	-62	164	167	73.4	14.6	0	0	0	109.2	Q37 T41 G42 N43	Q37-D39 PolarHBondContact O-N 2.85Å; D39-T41 PolarHBondContact O-N 3.12Å; D39-T41 VanDerWaalsContact OD1-C 3.28Å; D39-T41 VanDerWaalsContact OD1-CA 3.27Å; D39-T41 WeakPolarHBondContact OD1-CA 3.25Å; D39-T41 WeakPolarHBondContact OD1-CB 3.43Å; D39-T41 PolarHBondContact OD1-N 3.44Å; D39-T41 PolarHBondContact OD1-OG1 3.25Å; D39-T41 PolarHBondContact OD2-OG1 2.98Å; D39-T41 VanDerWaalsContact OD2-OG1 3.08Å; D39-G42 PolarHBondContact O-N 3.42Å; D39-G42 PolarHBondContact OD1-N 3.24Å; D39-N43 PolarHBondContact OD1-N 3.04Å; D39-N43 VanDerWaalsContact OD1-N 3.13Å
40	T	61.6	Low	65.3	Low	157 Å²	157	110 Å²	110	96%	0.963	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.6	-11.7	179.9	38.2	0	0	0	0	113.9
41	T	64	Low	65.6	Low	105 Å²	105	108.2 Å²	108.2	64%	0.644	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.8	3.2	175.8	41.7	0	0	0	0	114.3	D39 N43	D39-T41 PolarHBondContact O-N 3.12Å; D39-T41 VanDerWaalsContact OD1-C 3.28Å; D39-T41 VanDerWaalsContact OD1-CA 3.27Å; D39-T41 WeakPolarHBondContact OD1-CA 3.25Å; D39-T41 WeakPolarHBondContact OD1-CB 3.43Å; D39-T41 PolarHBondContact OD1-N 3.44Å; D39-T41 PolarHBondContact OD1-OG1 3.25Å; D39-T41 PolarHBondContact OD2-OG1 2.98Å; D39-T41 VanDerWaalsContact OD2-OG1 3.08Å; T41-N43 PolarHBondContact O-N 2.98Å
42	G	55.5	Low	66	Low	50 Å²	50	107.5 Å²	107.5	52%	0.515	58%	0.578	S	S	.	*			trans	77.2	5	175.8	0	0	0	0	0	114.3	D39	D39-G42 PolarHBondContact O-N 3.42Å; D39-G42 PolarHBondContact OD1-N 3.24Å
43	N	59.3	Low	66.9	Low	109 Å²	109	108.8 Å²	108.8	58%	0.583	59%	0.587	S	S	*	*			trans	-86.5	121.7	179.2	-80.2	6.6	0	0	0	109.3	D39 T41 S45	D39-N43 PolarHBondContact OD1-N 3.04Å; D39-N43 VanDerWaalsContact OD1-N 3.13Å; T41-N43 PolarHBondContact O-N 2.98Å; N43-S45 PolarHBondContact O-N 3.3Å
44	S	57.3	Low	68.1	Low	91 Å²	91	102.1 Å²	102.1	64%	0.636	58%	0.575	S	S	*	*	B	Isolated β-bridge	trans	-72	94.7	164.1	-71.8	0	0	0	0	108	G46	S44-G46 PolarHBondContact O-N 2.87Å; S44-G46 VanDerWaalsContact O-N 3.08Å
45	S	57.9	Low	69.7	Low	75 Å²	75	99.9 Å²	99.9	52%	0.524	57%	0.571	S	S	.	*			trans	-73.7	97.1	166.7	58.2	0	0	0	0	108.1	N43 N47	N43-S45 PolarHBondContact O-N 3.3Å; S45-N47 PolarHBondContact O-N 3.47Å
46	G	64.1	Low	71.4	Confident	45 Å²	45	92.2 Å²	92.2	46%	0.464	54%	0.543	S	S	.	.			trans	-67.3	120.1	160.1	0	0	0	0	0	107.5	S44 S48	S44-G46 PolarHBondContact O-N 2.87Å; S44-G46 VanDerWaalsContact O-N 3.08Å; G46-S48 PolarHBondContact O-N 3.48Å
47	N	77.2	Confident	73.3	Confident	70 Å²	70	85.8 Å²	85.8	37%	0.374	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.5	117.6	172	-74.1	-13.8	0	0	0	107.4	Y32 Q34 S45	Y32-N47 WeakPolarHBondContact CA-O 3.48Å; Y32-N47 WeakPolarHBondContact CB-O 3.23Å; Y32-N47 HydrophobicContact CD2-CB 4.42Å; Y32-N47 WeakPolarHBondContact CD2-O 3.44Å; Y32-N47 PolarHBondContact N-O 3.3Å; Y32-N47 PolarHBondContact O-N 3.33Å; Q34-N47 PolarHBondContact NE2-ND2 2.86Å; S45-N47 PolarHBondContact O-N 3.47Å
48	S	79.9	Confident	75.4	Confident	73 Å²	73	81.1 Å²	81.1	51%	0.51	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	139.9	172.5	63.4	0	0	0	0	110.3	I30 G46	I30-S48 CarbonylContact O-C 3.56Å; I30-S48 VanDerWaalsContact O-CA 3.29Å; I30-S48 WeakPolarHBondContact O-CA 3.47Å; G46-S48 PolarHBondContact O-N 3.48Å
49	T	84.8	Confident	77.2	Confident	59 Å²	59	81.2 Å²	81.2	36%	0.362	50%	0.498	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	155.1	165.9	-165.6	0	0	0	0	110.7	I30 Y32	I30-T49 HydrophobicContact CB-CG2 3.93Å; I30-T49 HydrophobicContact CD1-CG2 4.37Å; I30-T49 PolarHBondContact N-O 2.84Å; I30-T49 PolarHBondContact O-N 3.4Å; Y32-T49 HydrophobicContact CE2-CG2 3.44Å; Y32-T49 VanDerWaalsContact CE2-CG2 3.44Å; Y32-T49 WeakPolarHBondContact OH-CG2 3.21Å
50	Q	84.6	Confident	79	Confident	178 Å²	178	80 Å²	80	83%	0.832	49%	0.492	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.2	134.4	167.3	-67.8	179.8	-20.3	0	0	108.8
51	G	86	Confident	80.4	Confident	16 Å²	16	76.4 Å²	76.4	17%	0.165	47%	0.469	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.3	175.3	174.8	0	0	0	0	0	111	V28	V28-G51 PolarHBondContact N-O 2.98Å; V28-G51 PolarHBondContact O-N 2.87Å
52	V	88.4	Confident	81.7	Confident	98 Å²	98	72.9 Å²	72.9	59%	0.594	45%	0.449	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-126	120.2	173	179.1	0	0	0	0	107.6	F25	F25-V52 HydrophobicContact CB-CG1 3.76Å; F25-V52 HydrophobicContact CD1-CG1 3.69Å; F25-V52 HydrophobicContact CG-CG1 4.18Å
53	Q	89.6	Confident	83.2	Confident	122 Å²	122	75.5 Å²	75.5	57%	0.57	46%	0.457	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.9	125.5	165.9	-178.5	174.2	-17.1	0	0	107.9	F25 T26 V28	F25-Q53 WeakPolarHBondContact CA-O 3.39Å; T26-Q53 PolarHBondContact N-O 2.85Å; T26-Q53 PolarHBondContact O-N 3.11Å; V28-Q53 HydrophobicContact CG1-CB 3.8Å; V28-Q53 HydrophobicContact CG2-CB 4.23Å
54	A	89.5	Confident	84.5	Confident	64 Å²	64	75 Å²	75	53%	0.529	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	127.8	174.7	0	0	0	0	0	109.2	V24 F25	V24-A54 WeakPolarHBondContact O-CA 3.08Å; F25-A54 HydrophobicContact CD1-CB 3.76Å; F25-A54 HydrophobicContact CE1-CB 3.73Å
55	S	92.2	Very high	85.9	Confident	61 Å²	61	71.5 Å²	71.5	43%	0.427	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	143.4	167.6	63.6	0	0	0	0	109.3	V23 V24	V23-S55 CarbonylContact C-O 3.57Å; V23-S55 VanDerWaalsContact CA-O 3.31Å; V23-S55 WeakPolarHBondContact CA-O 3.17Å; V24-S55 PolarHBondContact N-O 3.26Å; V24-S55 PolarHBondContact O-N 3.44Å
56	S	91.9	Very high	87.3	Confident	41 Å²	41	74 Å²	74	29%	0.287	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.9	149.9	177.9	63.4	0	0	0	0	111.1	C20	C20-S56 WeakPolarHBondContact SG-CB 3.49Å
57	D	94.2	Very high	88.3	Confident	87 Å²	87	79.6 Å²	79.6	47%	0.465	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89	127.2	170.8	-61.2	-29.6	0	0	0	109.7	C20 Q21 N22	C20-D57 CarbonylContact C-O 3.6Å; C20-D57 WeakPolarHBondContact CA-O 3.38Å; Q21-D57 PolarHBondContact N-O 3.2Å; Q21-D57 PolarHBondContact O-N 2.91Å; N22-D57 WeakPolarHBondContact CB-OD2 3.32Å; N22-D57 PolarHBondContact ND2-OD2 3.29Å
58	I	93.7	Very high	88.9	Confident	45 Å²	45	78 Å²	78	23%	0.231	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	116.4	175.9	-56.2	-58.9	0	0	0	108.9	V3 L7 K19 C20 L60 F73	V3-I58 HydrophobicContact CG1-CD1 3.75Å; V3-I58 HydrophobicContact CG1-CG1 4.28Å; L7-I58 HydrophobicContact CD1-CD1 4.45Å; L7-I58 HydrophobicContact CD1-CG1 4.47Å; L7-I58 HydrophobicContact CD1-CG2 3.68Å; K19-I58 WeakPolarHBondContact O-CA 3.28Å; C20-I58 HydrophobicContact CB-CD1 3.61Å; C20-I58 VanDerWaalsContact SG-CD1 3.52Å; I58-L60 HydrophobicContact CG2-CD2 4.06Å; I58-L60 HydrophobicContact CG2-CG 4.47Å; I58-F73 HydrophobicContact CB-CE2 4.47Å; I58-F73 HydrophobicContact CB-CZ 4.06Å; I58-F73 HydrophobicContact CG1-CZ 4.14Å; I58-F73 HydrophobicContact CG2-CE2 4Å; I58-F73 HydrophobicContact CG2-CZ 3.96Å
59	Q	93.3	Very high	89.4	Confident	97 Å²	97	78.1 Å²	78.1	45%	0.453	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.8	118	173.4	-173.5	179	33.1	0	0	109.6	A18 K19 Q21	A18-Q59 WeakPolarHBondContact CA-O 3.22Å; K19-Q59 HydrophobicContact CB-CB 4.37Å; K19-Q59 PolarHBondContact N-O 2.95Å; K19-Q59 PolarHBondContact O-N 2.88Å; Q21-Q59 VanDerWaalsContact NE2-OE1 3.11Å
60	L	93.3	Very high	89.7	Confident	38 Å²	38	79.1 Å²	79.1	20%	0.199	44%	0.444	C	S	.	.			trans	-94.2	134	170.7	-58.5	-178.8	0	0	0	109.7	I14 T15 A18 I58 A65 L68 F73	I14-L60 HydrophobicContact CG2-CD1 4.38Å; T15-L60 HydrophobicContact CG2-CD2 4.19Å; A18-L60 HydrophobicContact CB-CD2 3.7Å; I58-L60 HydrophobicContact CG2-CD2 4.06Å; I58-L60 HydrophobicContact CG2-CG 4.47Å; L60-A65 HydrophobicContact CB-CB 3.42Å; L60-A65 VanDerWaalsContact CB-CB 3.42Å; L60-A65 HydrophobicContact CD1-CB 3.82Å; L60-A65 HydrophobicContact CG-CB 4.28Å; L60-L68 HydrophobicContact CD1-CD1 3.68Å; L60-F73 HydrophobicContact CD1-CD2 4.04Å; L60-F73 HydrophobicContact CD1-CE2 4.12Å; L60-F73 HydrophobicContact CD2-CE2 4.49Å; L60-F73 HydrophobicContact CG-CE2 4.5Å
61	V	91.5	Very high	90	Very high	81 Å²	81	75 Å²	75	49%	0.491	43%	0.431	S	S	.	.			trans	-102	-16.2	-174.8	-175.4	0	0	0	0	112.1	D17	D17-V61 HydrophobicContact CB-CB 4.21Å; D17-V61 HydrophobicContact CB-CG2 4.37Å; D17-V61 WeakPolarHBondContact O-CG2 3.33Å
62	S	91	Very high	90.4	Very high	30 Å²	30	78.2 Å²	78.2	21%	0.21	44%	0.441	C	S	.	.	S	Bend	trans	-68.7	139.1	-176.9	-177.2	0	0	0	0	111.6	I14 N64 A65	I14-S62 WeakPolarHBondContact O-CB 3.45Å; S62-N64 PolarHBondContact O-N 3.32Å; S62-N64 PolarHBondContact OG-N 3.39Å; S62-A65 WeakPolarHBondContact O-CB 3.16Å; S62-A65 PolarHBondContact O-N 3.08Å
63	P	86.6	Confident	90.6	Very high	105 Å²	105	75 Å²	75	68%	0.682	42%	0.419	S	S	*	.	G	3₁₀ helix	trans	-54.8	-35.6	173.1	-25.8	34.5	0	0	0	113.1	A65 T66	P63-A65 PolarHBondContact O-N 3.35Å; P63-T66 PolarHBondContact O-N 2.84Å; P63-T66 PolarHBondContact O-OG1 2.94Å
64	N	86.6	Confident	90.7	Very high	100 Å²	100	71.1 Å²	71.1	54%	0.535	40%	0.403	S	S	.	.	G	3₁₀ helix	trans	-73.6	-8.1	179.5	-59.8	-2.9	0	0	0	112.6	I14 S62 T66	I14-N64 HydrophobicContact CD1-CB 4.49Å; I14-N64 HydrophobicContact CG1-CB 4.34Å; S62-N64 PolarHBondContact O-N 3.32Å; S62-N64 PolarHBondContact OG-N 3.39Å; N64-T66 VanDerWaalsContact C-N 3.29Å
65	A	87.6	Confident	90.9	Very high	16 Å²	16	72.5 Å²	72.5	13%	0.132	40%	0.401	C	S	.	.	G	3₁₀ helix	trans	-73.7	-21.9	178.6	0	0	0	0	0	112.7	I14 L60 S62 P63 E67 L68	I14-A65 HydrophobicContact CG2-CB 3.85Å; L60-A65 HydrophobicContact CB-CB 3.42Å; L60-A65 VanDerWaalsContact CB-CB 3.42Å; L60-A65 HydrophobicContact CD1-CB 3.82Å; L60-A65 HydrophobicContact CG-CB 4.28Å; S62-A65 WeakPolarHBondContact O-CB 3.16Å; S62-A65 PolarHBondContact O-N 3.08Å; P63-A65 PolarHBondContact O-N 3.35Å; A65-E67 PolarHBondContact O-N 2.83Å; A65-L68 HydrophobicContact CB-CD1 4.49Å; A65-L68 WeakPolarHBondContact O-CB 3.31Å; A65-L68 PolarHBondContact O-N 3.09Å
66	T	86.2	Confident	90.9	Very high	127 Å²	127	70.3 Å²	70.3	78%	0.779	39%	0.385	S	S	*	.	G	3₁₀ helix	trans	-68.7	-19.7	178.1	54.5	0	0	0	0	113	P63 N64	P63-T66 PolarHBondContact O-N 2.84Å; P63-T66 PolarHBondContact O-OG1 2.94Å; N64-T66 VanDerWaalsContact C-N 3.29Å
67	E	86.5	Confident	91	Very high	163 Å²	163	68.9 Å²	68.9	76%	0.762	37%	0.374	S	S	*	.	G	3₁₀ helix	trans	-90.4	-10.3	177.7	-61.4	-177.7	169.9	0	0	112.5	A65 N69	A65-E67 PolarHBondContact O-N 2.83Å; E67-N69 PolarHBondContact O-N 3.5Å
68	L	90.1	Very high	90.8	Very high	36 Å²	36	68 Å²	68	19%	0.188	37%	0.371	C	S	.	.			trans	-71.1	125	-179.8	-74.4	176.3	0	0	0	110.7	I14 L60 A65 E72 I76	I14-L68 HydrophobicContact CD1-CD1 4.28Å; I14-L68 HydrophobicContact CD1-CD2 4.17Å; I14-L68 HydrophobicContact CD1-CG 4.38Å; I14-L68 HydrophobicContact CG2-CD1 3.61Å; L60-L68 HydrophobicContact CD1-CD1 3.68Å; A65-L68 HydrophobicContact CB-CD1 4.49Å; A65-L68 WeakPolarHBondContact O-CB 3.31Å; A65-L68 PolarHBondContact O-N 3.09Å; L68-E72 WeakPolarHBondContact CA-OE2 3.48Å; L68-E72 HydrophobicContact CD2-CB 3.71Å; L68-I76 HydrophobicContact CD1-CD1 4.03Å; L68-I76 HydrophobicContact CD2-CD1 3.92Å
69	N	90.6	Very high	90.6	Very high	77 Å²	77	69 Å²	69	41%	0.412	38%	0.379	S	S	.	.			trans	-87.8	169.5	165	67	58.6	0	0	0	111.6	E67 T71 E72 F73	E67-N69 PolarHBondContact O-N 3.5Å; N69-T71 PolarHBondContact O-N 3.22Å; N69-T71 WeakPolarHBondContact OD1-CA 3.32Å; N69-T71 VanDerWaalsContact OD1-CB 3.3Å; N69-T71 WeakPolarHBondContact OD1-CB 3.47Å; N69-T71 PolarHBondContact OD1-N 3.29Å; N69-E72 PolarHBondContact N-OE2 3.2Å; N69-E72 VanDerWaalsContact ND2-CD 3.3Å; N69-E72 PolarHBondContact ND2-OE2 3.38Å; N69-E72 PolarHBondContact O-N 2.84Å; N69-E72 PolarHBondContact OD1-N 3.44Å; N69-F73 PolarHBondContact O-N 3.42Å
70	E	90.4	Very high	90.6	Very high	80 Å²	80	64.3 Å²	64.3	37%	0.374	36%	0.358	S	S	.	.	H	α-helix	trans	-58.7	-34.2	-179.1	-66.4	175.4	176.5	0	0	113.2	N74 N98 A99	E70-N74 WeakPolarHBondContact O-CB 3.39Å; E70-N74 PolarHBondContact O-N 2.83Å; E70-N74 PolarHBondContact O-ND2 2.87Å; E70-N98 WeakPolarHBondContact OE1-CA 3.27Å; E70-A99 HydrophobicContact CG-CB 3.99Å; E70-A99 PolarHBondContact OE1-N 2.92Å
71	T	91.7	Very high	90.4	Very high	92 Å²	92	64.9 Å²	64.9	56%	0.564	36%	0.357	S	S	*	.	H	α-helix	trans	-69.6	-43.4	179.6	-58.6	0	0	0	0	110.7	N69 N74 N75	N69-T71 PolarHBondContact O-N 3.22Å; N69-T71 WeakPolarHBondContact OD1-CA 3.32Å; N69-T71 VanDerWaalsContact OD1-CB 3.3Å; N69-T71 WeakPolarHBondContact OD1-CB 3.47Å; N69-T71 PolarHBondContact OD1-N 3.29Å; T71-N74 PolarHBondContact O-N 3.34Å; T71-N75 WeakPolarHBondContact O-CB 3.27Å; T71-N75 PolarHBondContact O-N 3.41Å; T71-N75 PolarHBondContact O-ND2 2.92Å
72	E	92.5	Very high	90.2	Very high	83 Å²	83	66.8 Å²	66.8	39%	0.388	37%	0.365	S	S	.	.	H	α-helix	trans	-65.4	-42.6	176.6	-67.5	170.1	142.1	0	0	111.5	L68 N69 N74 N75 I76	L68-E72 WeakPolarHBondContact CA-OE2 3.48Å; L68-E72 HydrophobicContact CD2-CB 3.71Å; N69-E72 PolarHBondContact N-OE2 3.2Å; N69-E72 VanDerWaalsContact ND2-CD 3.3Å; N69-E72 PolarHBondContact ND2-OE2 3.38Å; N69-E72 PolarHBondContact O-N 2.84Å; N69-E72 PolarHBondContact OD1-N 3.44Å; E72-N74 PolarHBondContact O-N 2.93Å; E72-N75 PolarHBondContact O-N 3.19Å; E72-I76 VanDerWaalsContact O-CG1 3.29Å; E72-I76 WeakPolarHBondContact O-CG1 3.34Å; E72-I76 PolarHBondContact O-N 2.92Å
73	F	93.1	Very high	90	Very high	30 Å²	30	70.5 Å²	70.5	13%	0.132	38%	0.379	C	S	.	.	H	α-helix	trans	-59.5	-46.9	174.7	-178.2	-90.7	0	0	0	111.7	L7 I58 L60 N69 N75 I76 L77 T97	L7-F73 HydrophobicContact CD1-CE2 4.36Å; L7-F73 HydrophobicContact CD1-CZ 4.18Å; L7-F73 HydrophobicContact CD2-CD2 4.45Å; L7-F73 HydrophobicContact CD2-CE1 4.48Å; L7-F73 HydrophobicContact CD2-CE2 3.77Å; L7-F73 HydrophobicContact CD2-CZ 3.78Å; I58-F73 HydrophobicContact CB-CE2 4.47Å; I58-F73 HydrophobicContact CB-CZ 4.06Å; I58-F73 HydrophobicContact CG1-CZ 4.14Å; I58-F73 HydrophobicContact CG2-CE2 4Å; I58-F73 HydrophobicContact CG2-CZ 3.96Å; L60-F73 HydrophobicContact CD1-CD2 4.04Å; L60-F73 HydrophobicContact CD1-CE2 4.12Å; L60-F73 HydrophobicContact CD2-CE2 4.49Å; L60-F73 HydrophobicContact CG-CE2 4.5Å; N69-F73 PolarHBondContact O-N 3.42Å; F73-N75 VanDerWaalsContact C-N 3.33Å; F73-N75 PolarHBondContact O-N 3.34Å; F73-I76 WeakPolarHBondContact O-CB 3.37Å; F73-I76 PolarHBondContact O-N 3.07Å; F73-L77 PolarHBondContact O-N 3.41Å; F73-T97 HydrophobicContact CD1-CG2 3.74Å; F73-T97 HydrophobicContact CE1-CG2 3.69Å
74	N	92.1	Very high	89.8	Confident	40 Å²	40	66.3 Å²	66.3	21%	0.214	35%	0.353	C	S	.	.	H	α-helix	trans	-60.4	-42.5	175.8	-82	-42.1	0	0	0	112.3	E70 T71 E72 I76 L77 V78 T97	E70-N74 WeakPolarHBondContact O-CB 3.39Å; E70-N74 PolarHBondContact O-N 2.83Å; E70-N74 PolarHBondContact O-ND2 2.87Å; T71-N74 PolarHBondContact O-N 3.34Å; E72-N74 PolarHBondContact O-N 2.93Å; N74-I76 PolarHBondContact O-N 2.86Å; N74-L77 PolarHBondContact O-N 2.85Å; N74-V78 WeakPolarHBondContact O-CB 3.42Å; N74-V78 WeakPolarHBondContact O-CG2 3.23Å; N74-V78 PolarHBondContact O-N 3.23Å; N74-T97 VanDerWaalsContact CG-OG1 3.26Å; N74-T97 PolarHBondContact ND2-OG1 3.08Å; N74-T97 WeakPolarHBondContact OD1-CG2 3.43Å; N74-T97 PolarHBondContact OD1-OG1 2.91Å; N74-T97 VanDerWaalsContact OD1-OG1 3.12Å
75	N	93	Very high	88.8	Confident	94 Å²	94	69.4 Å²	69.4	50%	0.503	37%	0.369	S	S	.	.	H	α-helix	trans	-61.3	-44.7	176.5	-73.8	-25.8	0	0	0	111.3	T71 E72 F73 L77 V78 T79	T71-N75 WeakPolarHBondContact O-CB 3.27Å; T71-N75 PolarHBondContact O-N 3.41Å; T71-N75 PolarHBondContact O-ND2 2.92Å; E72-N75 PolarHBondContact O-N 3.19Å; F73-N75 VanDerWaalsContact C-N 3.33Å; F73-N75 PolarHBondContact O-N 3.34Å; N75-L77 VanDerWaalsContact C-N 3.33Å; N75-L77 PolarHBondContact O-N 3.25Å; N75-V78 PolarHBondContact O-N 3.44Å; N75-T79 WeakPolarHBondContact O-CB 3.46Å; N75-T79 PolarHBondContact O-N 2.84Å; N75-T79 PolarHBondContact O-OG1 2.6Å
76	I	93.9	Very high	87.5	Confident	15 Å²	15	70.4 Å²	70.4	8%	0.077	38%	0.375	C	S	.	.	H	α-helix	trans	-56.8	-49	174.8	-68.6	167.8	0	0	0	110.3	L7 G10 N11 T15 L68 E72 F73 N74 G80	L7-I76 HydrophobicContact CD2-CG2 3.99Å; G10-I76 WeakPolarHBondContact CA-O 3.49Å; N11-I76 HydrophobicContact CB-CB 4.46Å; N11-I76 HydrophobicContact CB-CD1 3.91Å; N11-I76 HydrophobicContact CB-CG1 3.86Å; N11-I76 HydrophobicContact CB-CG2 3.79Å; T15-I76 HydrophobicContact CG2-CG2 4.05Å; L68-I76 HydrophobicContact CD1-CD1 4.03Å; L68-I76 HydrophobicContact CD2-CD1 3.92Å; E72-I76 VanDerWaalsContact O-CG1 3.29Å; E72-I76 WeakPolarHBondContact O-CG1 3.34Å; E72-I76 PolarHBondContact O-N 2.92Å; F73-I76 WeakPolarHBondContact O-CB 3.37Å; F73-I76 PolarHBondContact O-N 3.07Å; N74-I76 PolarHBondContact O-N 2.86Å; I76-G80 PolarHBondContact O-N 2.84Å
77	L	92.4	Very high	86.3	Confident	11 Å²	11	70.3 Å²	70.3	6%	0.058	38%	0.38	C	S	.	.	H	α-helix	trans	-61.9	-50	-179	179.8	60.3	0	0	0	112.1	V3 L7 F73 N74 N75 G80 Y81 V95	V3-L77 HydrophobicContact CG1-CD1 4.01Å; L7-L77 HydrophobicContact CD2-CB 4.11Å; L7-L77 HydrophobicContact CD2-CD1 4.25Å; L7-L77 HydrophobicContact CG-CD1 4.21Å; F73-L77 PolarHBondContact O-N 3.41Å; N74-L77 PolarHBondContact O-N 2.85Å; N75-L77 VanDerWaalsContact C-N 3.33Å; N75-L77 PolarHBondContact O-N 3.25Å; L77-G80 PolarHBondContact O-N 3.46Å; L77-Y81 VanDerWaalsContact O-CB 3.27Å; L77-Y81 WeakPolarHBondContact O-CB 3.43Å; L77-Y81 PolarHBondContact O-N 3.28Å; L77-V95 HydrophobicContact CD2-CG1 3.74Å
78	V	89.8	Confident	85.2	Confident	68 Å²	68	64.3 Å²	64.3	41%	0.412	36%	0.356	S	S	.	.	H	α-helix	trans	-66.2	-44.7	-178.6	172.1	0	0	0	0	111.2	N74 N75 G80 Y81 N82	N74-V78 WeakPolarHBondContact O-CB 3.42Å; N74-V78 WeakPolarHBondContact O-CG2 3.23Å; N74-V78 PolarHBondContact O-N 3.23Å; N75-V78 PolarHBondContact O-N 3.44Å; V78-G80 VanDerWaalsContact C-N 3.33Å; V78-G80 PolarHBondContact O-N 3.44Å; V78-Y81 PolarHBondContact O-N 2.66Å; V78-N82 WeakPolarHBondContact O-CB 3.14Å; V78-N82 VanDerWaalsContact O-CG 3.29Å; V78-N82 PolarHBondContact O-N 3.25Å; V78-N82 PolarHBondContact O-ND2 3.04Å
79	T	91.4	Very high	84.1	Confident	65 Å²	65	71.9 Å²	71.9	40%	0.399	39%	0.39	S	S	.	.	H	α-helix	trans	-57.6	-48	176.9	-69.7	0	0	0	0	110.7	N75 N82 Q83	N75-T79 WeakPolarHBondContact O-CB 3.46Å; N75-T79 PolarHBondContact O-N 2.84Å; N75-T79 PolarHBondContact O-OG1 2.6Å; T79-N82 PolarHBondContact O-N 2.9Å; T79-Q83 VanDerWaalsContact CG2-NE2 3.34Å; T79-Q83 WeakPolarHBondContact O-CG 3.42Å; T79-Q83 PolarHBondContact O-N 3.08Å
80	G	92	Very high	83.3	Confident	0 Å²	0	72.8 Å²	72.8	0%	0	39%	0.394	C	S	.	.	H	α-helix	trans	-75.8	-26.7	-179.9	0	0	0	0	0	114.5	S6 I76 L77 V78 Q83 A84	S6-G80 VanDerWaalsContact O-CA 3.23Å; S6-G80 WeakPolarHBondContact O-CA 3.36Å; I76-G80 PolarHBondContact O-N 2.84Å; L77-G80 PolarHBondContact O-N 3.46Å; V78-G80 VanDerWaalsContact C-N 3.33Å; V78-G80 PolarHBondContact O-N 3.44Å; G80-Q83 PolarHBondContact O-N 3.01Å; G80-A84 WeakPolarHBondContact O-CB 3.45Å; G80-A84 PolarHBondContact O-N 3.08Å
81	Y	89	Confident	82.6	Confident	50 Å²	50	75.3 Å²	75.3	20%	0.196	41%	0.406	C	S	.	.	H	α-helix	trans	-63.5	-43.7	168.2	174.9	-96	0	0	0	111.6	S6 L77 V78 Q83 A84 I90 Q91 L92	S6-Y81 WeakPolarHBondContact OG-CA 3.43Å; L77-Y81 VanDerWaalsContact O-CB 3.27Å; L77-Y81 WeakPolarHBondContact O-CB 3.43Å; L77-Y81 PolarHBondContact O-N 3.28Å; V78-Y81 PolarHBondContact O-N 2.66Å; Y81-Q83 VanDerWaalsContact C-N 3.29Å; Y81-Q83 PolarHBondContact O-N 3.47Å; Y81-A84 WeakPolarHBondContact O-CB 3.48Å; Y81-A84 PolarHBondContact O-N 2.77Å; Y81-I90 PolarHBondContact OH-O 3.41Å; Y81-Q91 WeakPolarHBondContact OH-CA 3.44Å; Y81-L92 HydrophobicContact CD1-CD1 4.37Å; Y81-L92 HydrophobicContact CD2-CD1 3.37Å; Y81-L92 HydrophobicContact CD2-CG 3.9Å; Y81-L92 HydrophobicContact CE2-CB 4.36Å; Y81-L92 HydrophobicContact CE2-CD1 3.61Å; Y81-L92 HydrophobicContact CE2-CG 3.56Å; Y81-L92 HydrophobicContact CG-CD1 3.78Å; Y81-L92 PolarHBondContact OH-N 3.05Å
82	N	87.5	Confident	82	Confident	120 Å²	120	74.4 Å²	74.4	64%	0.642	40%	0.397	S	S	*	.	H	α-helix	trans	-67.8	-28.2	176.3	-69.4	-24.1	0	0	0	113	V78 T79	V78-N82 WeakPolarHBondContact O-CB 3.14Å; V78-N82 VanDerWaalsContact O-CG 3.29Å; V78-N82 PolarHBondContact O-N 3.25Å; V78-N82 PolarHBondContact O-ND2 3.04Å; T79-N82 PolarHBondContact O-N 2.9Å
83	Q	87.6	Confident	81.3	Confident	108 Å²	108	75.6 Å²	75.6	51%	0.505	40%	0.402	S	S	.	.	H	α-helix	trans	-80.3	-27.5	173.2	-71.8	179.4	36.6	0	0	113.3	L9 T79 G80 Y81 N85	L9-Q83 HydrophobicContact CB-CB 4.32Å; L9-Q83 HydrophobicContact CD1-CB 4.39Å; L9-Q83 PolarHBondContact O-OE1 2.92Å; T79-Q83 VanDerWaalsContact CG2-NE2 3.34Å; T79-Q83 WeakPolarHBondContact O-CG 3.42Å; T79-Q83 PolarHBondContact O-N 3.08Å; G80-Q83 PolarHBondContact O-N 3.01Å; Y81-Q83 VanDerWaalsContact C-N 3.29Å; Y81-Q83 PolarHBondContact O-N 3.47Å; Q83-N85 VanDerWaalsContact C-N 3.35Å; Q83-N85 PolarHBondContact O-N 3.35Å
84	A	82.8	Confident	80.8	Confident	17 Å²	17	81.3 Å²	81.3	14%	0.14	43%	0.433	C	S	.	.	S	Bend	trans	-63.1	102.9	173.7	0	0	0	0	0	106.6	L9 G80 Y81 S86	L9-A84 HydrophobicContact CD1-CB 3.88Å; G80-A84 WeakPolarHBondContact O-CB 3.45Å; G80-A84 PolarHBondContact O-N 3.08Å; Y81-A84 WeakPolarHBondContact O-CB 3.48Å; Y81-A84 PolarHBondContact O-N 2.77Å; A84-S86 PolarHBondContact O-N 2.9Å
85	N	65.3	Low	80.4	Confident	165 Å²	165	82.2 Å²	82.2	88%	0.882	44%	0.44	S	S	*	.			trans	-68.6	68.4	172	-170	10.2	0	0	0	108.4	Q83 S87	Q83-N85 VanDerWaalsContact C-N 3.35Å; Q83-N85 PolarHBondContact O-N 3.35Å; N85-S87 PolarHBondContact O-N 2.87Å
86	S	59.2	Low	80.2	Confident	37 Å²	37	85.5 Å²	85.5	26%	0.259	45%	0.453	S	S	.	.			trans	-84.3	103.9	-175.8	156.8	0	0	0	0	105.8	A84 S88	A84-S86 PolarHBondContact O-N 2.9Å; S86-S88 PolarHBondContact O-N 3.21Å; S86-S88 VanDerWaalsContact O-N 3.08Å; S86-S88 WeakPolarHBondContact OG-CA 3.29Å; S86-S88 WeakPolarHBondContact OG-CB 3.39Å; S86-S88 PolarHBondContact OG-N 2.82Å; S86-S88 PolarHBondContact OG-O 3.2Å; S86-S88 PolarHBondContact OG-OG 3.04Å
87	S	61.3	Low	79.9	Confident	125 Å²	125	86 Å²	86	87%	0.874	46%	0.456	S	S	*	.			trans	-60.1	-1.7	156.5	55.4	0	0	0	0	112.9	N85	N85-S87 PolarHBondContact O-N 2.87Å
88	S	63	Low	79.7	Confident	37 Å²	37	92 Å²	92	26%	0.259	49%	0.489	S	S	.	.	S	Bend	trans	-70.9	135.3	176.4	90.5	0	0	0	0	110.5	S86 I90	S86-S88 PolarHBondContact O-N 3.21Å; S86-S88 VanDerWaalsContact O-N 3.08Å; S86-S88 WeakPolarHBondContact OG-CA 3.29Å; S86-S88 WeakPolarHBondContact OG-CB 3.39Å; S86-S88 PolarHBondContact OG-N 2.82Å; S86-S88 PolarHBondContact OG-O 3.2Å; S86-S88 PolarHBondContact OG-OG 3.04Å; S88-I90 PolarHBondContact O-N 3.35Å; S88-I90 WeakPolarHBondContact OG-CB 3.44Å; S88-I90 PolarHBondContact OG-N 3.13Å
89	E	68.3	Low	79.4	Confident	195 Å²	195	92.4 Å²	92.4	91%	0.911	50%	0.499	S	S	*	.			trans	-66.8	2.7	172.1	-60.4	178.5	164.6	0	0	112.6	Q91	E89-Q91 PolarHBondContact O-N 3.25Å
90	I	72.9	Confident	78.6	Confident	96 Å²	96	98.2 Å²	98.2	49%	0.492	54%	0.543	S	S	.	.			trans	-79.7	109.3	-175.7	-54.6	174.1	0	0	0	108.4	Y81 S88	Y81-I90 PolarHBondContact OH-O 3.41Å; S88-I90 PolarHBondContact O-N 3.35Å; S88-I90 WeakPolarHBondContact OG-CB 3.44Å; S88-I90 PolarHBondContact OG-N 3.13Å
91	Q	76.7	Confident	78	Confident	133 Å²	133	103.2 Å²	103.2	62%	0.621	57%	0.57	S	S	*	*			trans	-96.6	128.6	170.7	-66.5	176.8	1.2	0	0	109.5	Y81 E89 F93	Y81-Q91 WeakPolarHBondContact OH-CA 3.44Å; E89-Q91 PolarHBondContact O-N 3.25Å; Q91-F93 HydrophobicContact CB-CD2 4.2Å; Q91-F93 HydrophobicContact CB-CE2 3.46Å; Q91-F93 VanDerWaalsContact CB-CE2 3.46Å; Q91-F93 HydrophobicContact CB-CZ 3.84Å; Q91-F93 WeakPolarHBondContact O-CD2 3.43Å
92	L	77.8	Confident	77.4	Confident	73 Å²	73	105.9 Å²	105.9	38%	0.382	59%	0.589	S	S	.	*			trans	-78.7	130.2	171.1	-65.5	179.7	0	0	0	110.2	Y81 V95	Y81-L92 HydrophobicContact CD1-CD1 4.37Å; Y81-L92 HydrophobicContact CD2-CD1 3.37Å; Y81-L92 HydrophobicContact CD2-CG 3.9Å; Y81-L92 HydrophobicContact CE2-CB 4.36Å; Y81-L92 HydrophobicContact CE2-CD1 3.61Å; Y81-L92 HydrophobicContact CE2-CG 3.56Å; Y81-L92 HydrophobicContact CG-CD1 3.78Å; Y81-L92 PolarHBondContact OH-N 3.05Å; L92-V95 HydrophobicContact CB-CG2 3.86Å; L92-V95 HydrophobicContact CD1-CG2 4.23Å; L92-V95 HydrophobicContact CG-CG2 4.5Å
93	F	78.1	Confident	76.8	Confident	109 Å²	109	105.2 Å²	105.2	48%	0.478	59%	0.586	S	S	.	*			trans	-128.3	146.9	174	-64.9	-80.6	0	0	0	109.6	Q91 V95	Q91-F93 HydrophobicContact CB-CD2 4.2Å; Q91-F93 HydrophobicContact CB-CE2 3.46Å; Q91-F93 VanDerWaalsContact CB-CE2 3.46Å; Q91-F93 HydrophobicContact CB-CZ 3.84Å; Q91-F93 WeakPolarHBondContact O-CD2 3.43Å; F93-V95 VanDerWaalsContact C-N 3.28Å; F93-V95 PolarHBondContact O-N 2.65Å
94	N	82.3	Confident	76.2	Confident	149 Å²	149	105 Å²	105	80%	0.797	59%	0.591	S	S	*	*	S	Bend	trans	46.6	49.5	174.9	-59.9	-8.6	0	0	0	113	E96	N94-E96 PolarHBondContact O-N 2.93Å
95	V	84.7	Confident	75.8	Confident	59 Å²	59	110.5 Å²	110.5	36%	0.358	62%	0.619	S	S	.	*			trans	-67.9	116.9	175.6	179.8	0	0	0	0	108.1	L77 L92 F93 T97	L77-V95 HydrophobicContact CD2-CG1 3.74Å; L92-V95 HydrophobicContact CB-CG2 3.86Å; L92-V95 HydrophobicContact CD1-CG2 4.23Å; L92-V95 HydrophobicContact CG-CG2 4.5Å; F93-V95 VanDerWaalsContact C-N 3.28Å; F93-V95 PolarHBondContact O-N 2.65Å; V95-T97 HydrophobicContact CG1-CG2 4.46Å
96	E	88.3	Confident	76.5	Confident	163 Å²	163	106.9 Å²	106.9	76%	0.762	60%	0.602	S	S	*	*			trans	-117.5	139.9	175.8	-68.6	177.1	-170.2	0	0	109.1	N94	N94-E96 PolarHBondContact O-N 2.93Å
97	T	88.1	Confident	77.7	Confident	26 Å²	26	111.9 Å²	111.9	16%	0.16	63%	0.626	C	S	.	*			trans	-136.8	134.1	178.6	62.7	0	0	0	0	108.1	F73 N74 V95	F73-T97 HydrophobicContact CD1-CG2 3.74Å; F73-T97 HydrophobicContact CE1-CG2 3.69Å; N74-T97 VanDerWaalsContact CG-OG1 3.26Å; N74-T97 PolarHBondContact ND2-OG1 3.08Å; N74-T97 WeakPolarHBondContact OD1-CG2 3.43Å; N74-T97 PolarHBondContact OD1-OG1 2.91Å; N74-T97 VanDerWaalsContact OD1-OG1 3.12Å; V95-T97 HydrophobicContact CG1-CG2 4.46Å
98	N	86.5	Confident	79	Confident	137 Å²	137	110.8 Å²	110.8	73%	0.733	61%	0.607	S	S	*	*			trans	-120.6	138.9	172.4	-60	-70	0	0	0	107.9	E70	E70-N98 WeakPolarHBondContact OE1-CA 3.27Å
99	A	84.1	Confident	80.3	Confident	77 Å²	77	117 Å²	117	64%	0.636	64%	0.636	S	S	*	*			trans	-80.5	135.5	169	0	0	0	0	0	109.6	E70	E70-A99 HydrophobicContact CG-CB 3.99Å; E70-A99 PolarHBondContact OE1-N 2.92Å
100	S	75.9	Confident	81.4	Confident	187 Å²	187	109.9 Å²	109.9	100%	1.308	61%	0.611	S	S	*	*			trans	-136.7	0	175.1	67.3	0	0	0	0	111

Retrieved 100 of 100 residues in 42.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).