A0A5K4FA32_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4FA32, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 130 aa.

						>A0A5K4FA32_SCHMA|A0A5K4FA32
MCSQIIEQQKRLIIQIKEAQLLRAELETCRHRLLESIPGHIKCDVTHNIIDKLERDFVNDNQLTTITSNNTTDKTTYKQNITQLKLTSSSSTSSYTTNKELEQSFNNQQSIMNTTQFLRQRVTEAMELNF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	74.8	Confident	92.4	Very high	184 Å²	184	111.2 Å²	111.2	91%	0.906	55%	0.553	S	S	*	*				0	-62.6	0	-155	175.5	-139.8	0	0	112.2	S3 Q4 I5	M1-S3 VanDerWaalsContact C-N 3.34Å; M1-S3 PolarHBondContact O-N 3.41Å; M1-Q4 PolarHBondContact O-N 3.08Å; M1-Q4 VanDerWaalsContact O-N 3.09Å; M1-I5 HydrophobicContact CG-CD1 4.35Å; M1-I5 PolarHBondContact O-N 3.09Å
2	C	78.2	Confident	92.9	Very high	99 Å²	99	109.8 Å²	109.8	67%	0.669	55%	0.548	S	S	*	.	H	α-helix	trans	-54.6	-42.4	-177.8	-60.7	0	0	0	0	114.4	Q4 I5 I6	C2-Q4 PolarHBondContact O-N 3.38Å; C2-I5 PolarHBondContact O-N 3.24Å; C2-I6 WeakPolarHBondContact O-CG1 3.36Å; C2-I6 PolarHBondContact O-N 2.98Å
3	S	92.5	Very high	93.2	Very high	88 Å²	88	108.2 Å²	108.2	62%	0.615	54%	0.541	S	S	*	.	H	α-helix	trans	-61.4	-38.8	178	173.2	0	0	0	0	113.3	M1 I6 E7	M1-S3 VanDerWaalsContact C-N 3.34Å; M1-S3 PolarHBondContact O-N 3.41Å; S3-I6 PolarHBondContact O-N 3.28Å; S3-E7 PolarHBondContact O-N 2.79Å; S3-E7 VanDerWaalsContact O-N 3.08Å
4	Q	94.4	Very high	93.5	Very high	137 Å²	137	107.1 Å²	107.1	64%	0.64	54%	0.536	S	S	*	.	H	α-helix	trans	-66.4	-39.9	177.5	-71.6	169.3	-29.3	0	0	111.8	M1 C2 E7 Q8	M1-Q4 PolarHBondContact O-N 3.08Å; M1-Q4 VanDerWaalsContact O-N 3.09Å; C2-Q4 PolarHBondContact O-N 3.38Å; Q4-E7 PolarHBondContact O-N 3.44Å; Q4-Q8 WeakPolarHBondContact O-CG 3.35Å; Q4-Q8 PolarHBondContact O-N 3.28Å
5	I	95.5	Very high	93.7	Very high	78 Å²	78	108 Å²	108	40%	0.4	54%	0.538	S	S	.	.	H	α-helix	trans	-63	-44.7	177	-64.3	170.3	0	0	0	110.1	M1 C2 E7 Q8 Q9	M1-I5 HydrophobicContact CG-CD1 4.35Å; M1-I5 PolarHBondContact O-N 3.09Å; C2-I5 PolarHBondContact O-N 3.24Å; I5-E7 VanDerWaalsContact C-N 3.34Å; I5-E7 PolarHBondContact O-N 3.37Å; I5-Q8 PolarHBondContact O-N 3.05Å; I5-Q9 HydrophobicContact CG2-CG 4.46Å; I5-Q9 WeakPolarHBondContact O-CG 3.37Å; I5-Q9 PolarHBondContact O-N 3.28Å
6	I	96	Very high	93.9	Very high	85 Å²	85	106.3 Å²	106.3	44%	0.436	53%	0.531	S	S	.	.	H	α-helix	trans	-60.1	-45	177.8	-68.4	166	0	0	0	110.8	C2 S3 Q9 K10	C2-I6 WeakPolarHBondContact O-CG1 3.36Å; C2-I6 PolarHBondContact O-N 2.98Å; S3-I6 PolarHBondContact O-N 3.28Å; I6-Q9 PolarHBondContact O-N 2.99Å; I6-K10 HydrophobicContact CG2-CD 4.48Å; I6-K10 WeakPolarHBondContact O-CG 3.43Å; I6-K10 PolarHBondContact O-N 3.31Å
7	E	96.4	Very high	94.2	Very high	71 Å²	71	108.2 Å²	108.2	33%	0.332	54%	0.535	S	S	.	.	H	α-helix	trans	-67.5	-35.8	178.9	-72.1	-54.1	129.8	0	0	113.1	S3 Q4 I5 K10 R11	S3-E7 PolarHBondContact O-N 2.79Å; S3-E7 VanDerWaalsContact O-N 3.08Å; Q4-E7 PolarHBondContact O-N 3.44Å; I5-E7 VanDerWaalsContact C-N 3.34Å; I5-E7 PolarHBondContact O-N 3.37Å; E7-K10 IonicContact OE1-NZ 3.53Å; E7-K10 PolarHBondContact OE1-NZ 2.92Å; E7-R11 PolarHBondContact O-N 3.34Å; E7-R11 VanDerWaalsContact O-N 3.16Å
8	Q	96.3	Very high	94.3	Very high	123 Å²	123	108.5 Å²	108.5	58%	0.575	54%	0.535	S	S	*	.	H	α-helix	trans	-64.5	-43.8	172	-74.4	174.7	-17.6	0	0	111.9	Q4 I5 R11 L12	Q4-Q8 WeakPolarHBondContact O-CG 3.35Å; Q4-Q8 PolarHBondContact O-N 3.28Å; I5-Q8 PolarHBondContact O-N 3.05Å; Q8-R11 PolarHBondContact O-N 3.12Å; Q8-L12 PolarHBondContact O-N 2.97Å
9	Q	97.3	Very high	94.4	Very high	110 Å²	110	105.6 Å²	105.6	51%	0.514	53%	0.53	S	S	.	.	H	α-helix	trans	-62.7	-42.2	177.3	-74.8	176.7	-19.9	0	0	112	I5 I6 R11 L12 I13	I5-Q9 HydrophobicContact CG2-CG 4.46Å; I5-Q9 WeakPolarHBondContact O-CG 3.37Å; I5-Q9 PolarHBondContact O-N 3.28Å; I6-Q9 PolarHBondContact O-N 2.99Å; Q9-R11 PolarHBondContact O-N 3.35Å; Q9-L12 PolarHBondContact O-N 2.91Å; Q9-I13 WeakPolarHBondContact O-CD1 3.42Å; Q9-I13 VanDerWaalsContact O-CG1 3.24Å; Q9-I13 WeakPolarHBondContact O-CG1 3.22Å; Q9-I13 PolarHBondContact O-N 3.45Å
10	K	97.7	Very high	94.5	Very high	108 Å²	108	106.2 Å²	106.2	47%	0.47	53%	0.531	S	S	.	.	H	α-helix	trans	-58.5	-48.5	175	-74.3	176.8	-176.2	170.9	0	111.9	I6 E7 L12 I13 I14	I6-K10 HydrophobicContact CG2-CD 4.48Å; I6-K10 WeakPolarHBondContact O-CG 3.43Å; I6-K10 PolarHBondContact O-N 3.31Å; E7-K10 IonicContact OE1-NZ 3.53Å; E7-K10 PolarHBondContact OE1-NZ 2.92Å; K10-L12 VanDerWaalsContact C-N 3.34Å; K10-L12 PolarHBondContact O-N 3.31Å; K10-I13 PolarHBondContact O-N 3.37Å; K10-I14 WeakPolarHBondContact O-CG1 3.49Å; K10-I14 PolarHBondContact O-N 3.4Å; K10-I14 VanDerWaalsContact O-N 3.08Å
11	R	97.2	Very high	94.7	Very high	140 Å²	140	106 Å²	106	53%	0.528	53%	0.531	S	S	.	.	H	α-helix	trans	-59.1	-44.5	176.9	-78.9	-172	-80.4	-95.7	-0.4	112	E7 Q8 Q9 I14 Q15	E7-R11 PolarHBondContact O-N 3.34Å; E7-R11 VanDerWaalsContact O-N 3.16Å; Q8-R11 PolarHBondContact O-N 3.12Å; Q9-R11 PolarHBondContact O-N 3.35Å; R11-I14 PolarHBondContact O-N 3.16Å; R11-Q15 WeakPolarHBondContact O-CG 3.48Å; R11-Q15 PolarHBondContact O-N 3.5Å; R11-Q15 VanDerWaalsContact O-N 3.12Å
12	L	97.9	Very high	95.8	Very high	94 Å²	94	102.5 Å²	102.5	49%	0.492	52%	0.516	S	S	.	.	H	α-helix	trans	-62.5	-43.5	177.6	179.7	61.4	0	0	0	112.1	Q8 Q9 K10 I14 Q15 I16	Q8-L12 PolarHBondContact O-N 2.97Å; Q9-L12 PolarHBondContact O-N 2.91Å; K10-L12 VanDerWaalsContact C-N 3.34Å; K10-L12 PolarHBondContact O-N 3.31Å; L12-I14 VanDerWaalsContact C-N 3.31Å; L12-I14 PolarHBondContact O-N 3.38Å; L12-Q15 PolarHBondContact O-N 2.82Å; L12-I16 HydrophobicContact CD1-CD1 4.09Å; L12-I16 HydrophobicContact CD1-CG1 4.32Å; L12-I16 HydrophobicContact CG-CD1 3.89Å; L12-I16 VanDerWaalsContact O-CG1 3.32Å; L12-I16 WeakPolarHBondContact O-CG1 3.35Å; L12-I16 PolarHBondContact O-N 2.95Å
13	I	97.8	Very high	96.6	Very high	89 Å²	89	106.4 Å²	106.4	46%	0.456	52%	0.516	S	S	.	.	H	α-helix	trans	-61.1	-41.2	178.3	-71	163.8	0	0	0	111.1	Q9 K10 I16 K17	Q9-I13 WeakPolarHBondContact O-CD1 3.42Å; Q9-I13 VanDerWaalsContact O-CG1 3.24Å; Q9-I13 WeakPolarHBondContact O-CG1 3.22Å; Q9-I13 PolarHBondContact O-N 3.45Å; K10-I13 PolarHBondContact O-N 3.37Å; I13-I16 PolarHBondContact O-N 3.14Å; I13-K17 HydrophobicContact CG2-CD 4.26Å; I13-K17 WeakPolarHBondContact O-CG 3.24Å; I13-K17 PolarHBondContact O-N 3.07Å
14	I	96.6	Very high	96.7	Very high	93 Å²	93	105 Å²	105	48%	0.477	51%	0.509	S	S	.	.	H	α-helix	trans	-60.8	-50.5	176.7	-68.5	165.8	0	0	0	110.1	K10 R11 L12 I16 K17 E18	K10-I14 WeakPolarHBondContact O-CG1 3.49Å; K10-I14 PolarHBondContact O-N 3.4Å; K10-I14 VanDerWaalsContact O-N 3.08Å; R11-I14 PolarHBondContact O-N 3.16Å; L12-I14 VanDerWaalsContact C-N 3.31Å; L12-I14 PolarHBondContact O-N 3.38Å; I14-I16 VanDerWaalsContact C-N 3.3Å; I14-I16 PolarHBondContact O-N 2.94Å; I14-K17 PolarHBondContact O-N 3.06Å; I14-K17 VanDerWaalsContact O-N 3.09Å; I14-E18 HydrophobicContact CG2-CG 4.46Å; I14-E18 WeakPolarHBondContact O-CG 3.36Å; I14-E18 PolarHBondContact O-N 3.01Å
15	Q	96.7	Very high	96.6	Very high	121 Å²	121	102.7 Å²	102.7	57%	0.565	50%	0.499	S	S	*	.	H	α-helix	trans	-59.2	-40.1	178.9	-69.9	176.9	3.5	0	0	112.7	R11 L12 E18 A19	R11-Q15 WeakPolarHBondContact O-CG 3.48Å; R11-Q15 PolarHBondContact O-N 3.5Å; R11-Q15 VanDerWaalsContact O-N 3.12Å; L12-Q15 PolarHBondContact O-N 2.82Å; Q15-E18 PolarHBondContact O-N 3.08Å; Q15-A19 WeakPolarHBondContact O-CB 3.38Å; Q15-A19 PolarHBondContact O-N 3.29Å
16	I	97.6	Very high	96.6	Very high	81 Å²	81	105 Å²	105	42%	0.415	51%	0.511	S	S	.	.	H	α-helix	trans	-63.5	-44.2	176.7	-70.3	168.1	0	0	0	110.6	L12 I13 I14 A19 Q20	L12-I16 HydrophobicContact CD1-CD1 4.09Å; L12-I16 HydrophobicContact CD1-CG1 4.32Å; L12-I16 HydrophobicContact CG-CD1 3.89Å; L12-I16 VanDerWaalsContact O-CG1 3.32Å; L12-I16 WeakPolarHBondContact O-CG1 3.35Å; L12-I16 PolarHBondContact O-N 2.95Å; I13-I16 PolarHBondContact O-N 3.14Å; I14-I16 VanDerWaalsContact C-N 3.3Å; I14-I16 PolarHBondContact O-N 2.94Å; I16-A19 PolarHBondContact O-N 3.4Å; I16-Q20 HydrophobicContact CG2-CG 4.42Å; I16-Q20 WeakPolarHBondContact O-CB 3.48Å; I16-Q20 VanDerWaalsContact O-CG 3.25Å; I16-Q20 WeakPolarHBondContact O-CG 3.38Å; I16-Q20 PolarHBondContact O-N 2.98Å
17	K	98.2	Very high	96.5	Very high	139 Å²	139	104.4 Å²	104.4	60%	0.604	51%	0.507	S	S	*	.	H	α-helix	trans	-63.8	-43.5	178.9	-75.2	179.3	174.4	-173.6	0	112	I13 I14 Q20 L21	I13-K17 HydrophobicContact CG2-CD 4.26Å; I13-K17 WeakPolarHBondContact O-CG 3.24Å; I13-K17 PolarHBondContact O-N 3.07Å; I14-K17 PolarHBondContact O-N 3.06Å; I14-K17 VanDerWaalsContact O-N 3.09Å; K17-Q20 PolarHBondContact O-N 3.09Å; K17-L21 PolarHBondContact O-N 3.31Å
18	E	97	Very high	96.3	Very high	113 Å²	113	104.8 Å²	104.8	53%	0.528	51%	0.514	S	S	.	.	H	α-helix	trans	-61.9	-46.3	176.1	-71.5	173.7	170.3	0	0	111.5	I14 Q15 Q20 L21 L22	I14-E18 HydrophobicContact CG2-CG 4.46Å; I14-E18 WeakPolarHBondContact O-CG 3.36Å; I14-E18 PolarHBondContact O-N 3.01Å; Q15-E18 PolarHBondContact O-N 3.08Å; E18-Q20 VanDerWaalsContact C-N 3.31Å; E18-Q20 PolarHBondContact O-N 2.96Å; E18-L21 PolarHBondContact O-N 3.41Å; E18-L22 WeakPolarHBondContact O-CG 3.4Å; E18-L22 PolarHBondContact O-N 3.03Å
19	A	95.2	Very high	96.1	Very high	54 Å²	54	101.9 Å²	101.9	45%	0.446	51%	0.506	S	S	.	.	H	α-helix	trans	-63.1	-36.5	177.3	0	0	0	0	0	112.7	Q15 I16 R23	Q15-A19 WeakPolarHBondContact O-CB 3.38Å; Q15-A19 PolarHBondContact O-N 3.29Å; I16-A19 PolarHBondContact O-N 3.4Å; A19-R23 WeakPolarHBondContact O-CB 3.32Å; A19-R23 PolarHBondContact O-N 3.28Å
20	Q	97.5	Very high	95.8	Very high	116 Å²	116	102.3 Å²	102.3	54%	0.542	50%	0.503	S	S	.	.	H	α-helix	trans	-66.2	-43.4	174.9	-76.5	173.9	-22	0	0	112	I16 K17 E18 R23 A24	I16-Q20 HydrophobicContact CG2-CG 4.42Å; I16-Q20 WeakPolarHBondContact O-CB 3.48Å; I16-Q20 VanDerWaalsContact O-CG 3.25Å; I16-Q20 WeakPolarHBondContact O-CG 3.38Å; I16-Q20 PolarHBondContact O-N 2.98Å; K17-Q20 PolarHBondContact O-N 3.09Å; E18-Q20 VanDerWaalsContact C-N 3.31Å; E18-Q20 PolarHBondContact O-N 2.96Å; Q20-R23 PolarHBondContact O-N 2.88Å; Q20-A24 PolarHBondContact O-N 3.15Å
21	L	97.8	Very high	95.2	Very high	102 Å²	102	101.3 Å²	101.3	53%	0.534	50%	0.5	S	S	.	.	H	α-helix	trans	-60.6	-50.5	175.8	179.3	64.8	0	0	0	110.9	K17 E18 R23 A24 E25	K17-L21 PolarHBondContact O-N 3.31Å; E18-L21 PolarHBondContact O-N 3.41Å; L21-R23 VanDerWaalsContact C-N 3.28Å; L21-R23 PolarHBondContact O-N 3.12Å; L21-A24 PolarHBondContact O-N 2.98Å; L21-A24 VanDerWaalsContact O-N 3.11Å; L21-E25 PolarHBondContact O-N 3.44Å
22	L	97.9	Very high	94.7	Very high	112 Å²	112	100.3 Å²	100.3	59%	0.586	50%	0.496	S	S	*	.	H	α-helix	trans	-59.3	-38.8	178.3	-71.6	172.2	0	0	0	112.2	E18 E25 L26	E18-L22 WeakPolarHBondContact O-CG 3.4Å; E18-L22 PolarHBondContact O-N 3.03Å; L22-E25 PolarHBondContact O-N 3.46Å; L22-L26 VanDerWaalsContact O-CB 3.31Å; L22-L26 WeakPolarHBondContact O-CB 3.42Å; L22-L26 PolarHBondContact O-N 3.48Å
23	R	95.3	Very high	94.1	Very high	181 Å²	181	101.3 Å²	101.3	68%	0.683	50%	0.501	S	S	*	.	H	α-helix	trans	-65	-42.8	175.9	-174.3	-179.6	-69.3	156.3	-1.2	111.8	A19 Q20 L21 L26 E27	A19-R23 WeakPolarHBondContact O-CB 3.32Å; A19-R23 PolarHBondContact O-N 3.28Å; Q20-R23 PolarHBondContact O-N 2.88Å; L21-R23 VanDerWaalsContact C-N 3.28Å; L21-R23 PolarHBondContact O-N 3.12Å; R23-L26 PolarHBondContact O-N 2.98Å; R23-E27 WeakPolarHBondContact O-CB 3.46Å; R23-E27 PolarHBondContact O-N 3.36Å
24	A	93.4	Very high	93.3	Very high	57 Å²	57	100.4 Å²	100.4	47%	0.471	50%	0.497	S	S	.	.	H	α-helix	trans	-63.5	-44.3	177.6	0	0	0	0	0	111.4	Q20 L21 E27 T28	Q20-A24 PolarHBondContact O-N 3.15Å; L21-A24 PolarHBondContact O-N 2.98Å; L21-A24 VanDerWaalsContact O-N 3.11Å; A24-E27 WeakPolarHBondContact O-CB 3.31Å; A24-E27 PolarHBondContact O-N 3.39Å; A24-T28 PolarHBondContact O-N 3.41Å; A24-T28 PolarHBondContact O-OG1 3.39Å
25	E	93.9	Very high	92.6	Very high	90 Å²	90	103.1 Å²	103.1	42%	0.421	51%	0.508	S	S	.	.	H	α-helix	trans	-64	-41.9	177	-71.1	-178.1	179.1	0	0	112.5	L21 L22 E27 T28 C29	L21-E25 PolarHBondContact O-N 3.44Å; L22-E25 PolarHBondContact O-N 3.46Å; E25-E27 VanDerWaalsContact C-N 3.31Å; E25-E27 PolarHBondContact O-N 3.3Å; E25-T28 PolarHBondContact O-N 2.96Å; E25-C29 WeakPolarHBondContact O-CB 3.47Å; E25-C29 PolarHBondContact O-N 2.96Å
26	L	95.6	Very high	91.8	Very high	125 Å²	125	100.5 Å²	100.5	65%	0.654	50%	0.503	S	S	*	.	H	α-helix	trans	-61.9	-41.2	175.4	-176.9	65	0	0	0	111.3	L22 R23 C29 R30	L22-L26 VanDerWaalsContact O-CB 3.31Å; L22-L26 WeakPolarHBondContact O-CB 3.42Å; L22-L26 PolarHBondContact O-N 3.48Å; R23-L26 PolarHBondContact O-N 2.98Å; L26-C29 WeakPolarHBondContact O-CB 3.35Å; L26-C29 PolarHBondContact O-N 3.44Å; L26-R30 PolarHBondContact O-N 3.48Å
27	E	92.9	Very high	90.8	Very high	74 Å²	74	99.7 Å²	99.7	35%	0.346	50%	0.499	S	S	.	.	H	α-helix	trans	-63.3	-45.1	176.6	-170.6	64.9	-165.5	0	0	111.3	R23 A24 E25 C29 R30 H31	R23-E27 WeakPolarHBondContact O-CB 3.46Å; R23-E27 PolarHBondContact O-N 3.36Å; A24-E27 WeakPolarHBondContact O-CB 3.31Å; A24-E27 PolarHBondContact O-N 3.39Å; E25-E27 VanDerWaalsContact C-N 3.31Å; E25-E27 PolarHBondContact O-N 3.3Å; E27-C29 VanDerWaalsContact C-N 3.34Å; E27-C29 PolarHBondContact O-N 2.95Å; E27-R30 PolarHBondContact O-N 3.41Å; E27-R30 IonicContact OE1-CZ 3.91Å; E27-R30 IonicContact OE1-NH1 2.76Å; E27-R30 PolarHBondContact OE1-NH1 3.33Å; E27-R30 IonicContact OE1-NH2 2.79Å; E27-R30 PolarHBondContact OE1-NH2 3.38Å; E27-R30 IonicContact OE2-CZ 3.06Å; E27-R30 IonicContact OE2-NH1 3.69Å; E27-R30 PolarHBondContact OE2-NH1 3.01Å; E27-R30 IonicContact OE2-NH2 2.69Å; E27-H31 PolarHBondContact O-N 3.49Å; E27-H31 PolarHBondContact O-ND1 2.98Å; E27-H31 IonicContact OE1-CE1 2.68Å; E27-H31 PolarHBondContact OE1-CE1 2.95Å; E27-H31 IonicContact OE1-ND1 3.01Å
28	T	91.9	Very high	89.7	Confident	78 Å²	78	95.4 Å²	95.4	48%	0.479	49%	0.485	S	S	.	.	H	α-helix	trans	-62.8	-40.1	174.2	-59.1	0	0	0	0	111.9	A24 E25 H31 R32	A24-T28 PolarHBondContact O-N 3.41Å; A24-T28 PolarHBondContact O-OG1 3.39Å; E25-T28 PolarHBondContact O-N 2.96Å; T28-H31 PolarHBondContact O-N 3.25Å; T28-R32 WeakPolarHBondContact O-CG 3.32Å; T28-R32 PolarHBondContact O-N 2.99Å
29	C	93.2	Very high	88.3	Confident	62 Å²	62	92.6 Å²	92.6	42%	0.419	49%	0.487	S	S	.	.	H	α-helix	trans	-61.1	-46.8	174.7	-171.9	0	0	0	0	111.3	E25 L26 E27 H31 R32 L33	E25-C29 WeakPolarHBondContact O-CB 3.47Å; E25-C29 PolarHBondContact O-N 2.96Å; L26-C29 WeakPolarHBondContact O-CB 3.35Å; L26-C29 PolarHBondContact O-N 3.44Å; E27-C29 VanDerWaalsContact C-N 3.34Å; E27-C29 PolarHBondContact O-N 2.95Å; C29-H31 VanDerWaalsContact C-N 3.33Å; C29-H31 PolarHBondContact O-N 3.02Å; C29-R32 PolarHBondContact O-N 3.41Å; C29-L33 WeakPolarHBondContact O-CB 3.44Å; C29-L33 PolarHBondContact O-N 3.06Å
30	R	89.7	Confident	86.8	Confident	119 Å²	119	95.2 Å²	95.2	45%	0.449	49%	0.49	S	S	.	.	H	α-helix	trans	-57.1	-46.5	176.2	-165.7	-168.5	84.1	-135.9	-6.5	111.3	L26 E27 L33 L34	L26-R30 PolarHBondContact O-N 3.48Å; E27-R30 PolarHBondContact O-N 3.41Å; E27-R30 IonicContact OE1-CZ 3.91Å; E27-R30 IonicContact OE1-NH1 2.76Å; E27-R30 PolarHBondContact OE1-NH1 3.33Å; E27-R30 IonicContact OE1-NH2 2.79Å; E27-R30 PolarHBondContact OE1-NH2 3.38Å; E27-R30 IonicContact OE2-CZ 3.06Å; E27-R30 IonicContact OE2-NH1 3.69Å; E27-R30 PolarHBondContact OE2-NH1 3.01Å; E27-R30 IonicContact OE2-NH2 2.69Å; R30-L33 PolarHBondContact O-N 3.24Å; R30-L34 HydrophobicContact CG-CD1 4.1Å; R30-L34 WeakPolarHBondContact O-CB 3.39Å; R30-L34 VanDerWaalsContact O-CG 3.29Å; R30-L34 WeakPolarHBondContact O-CG 3.37Å; R30-L34 PolarHBondContact O-N 3.01Å
31	H	86.2	Confident	85.2	Confident	87 Å²	87	93.2 Å²	93.2	40%	0.403	48%	0.482	S	S	.	.	H	α-helix	trans	-60.6	-50	178.5	-77.3	91.9	0	0	0	112	E27 T28 C29 L33 L34 E35	E27-H31 PolarHBondContact O-N 3.49Å; E27-H31 PolarHBondContact O-ND1 2.98Å; E27-H31 IonicContact OE1-CE1 2.68Å; E27-H31 PolarHBondContact OE1-CE1 2.95Å; E27-H31 IonicContact OE1-ND1 3.01Å; T28-H31 PolarHBondContact O-N 3.25Å; C29-H31 VanDerWaalsContact C-N 3.33Å; C29-H31 PolarHBondContact O-N 3.02Å; H31-L33 VanDerWaalsContact C-N 3.3Å; H31-L33 PolarHBondContact O-N 3.49Å; H31-L34 PolarHBondContact O-N 2.94Å; H31-L34 VanDerWaalsContact O-N 3.15Å; H31-E35 WeakPolarHBondContact O-CG 3.43Å; H31-E35 PolarHBondContact O-N 2.98Å
32	R	87.3	Confident	83.2	Confident	119 Å²	119	93.4 Å²	93.4	45%	0.449	48%	0.478	S	S	.	.	H	α-helix	trans	-59.9	-40.1	177.7	-71.9	-172.7	-64.8	170.8	-1.4	112.6	T28 C29 E35 S36	T28-R32 WeakPolarHBondContact O-CG 3.32Å; T28-R32 PolarHBondContact O-N 2.99Å; C29-R32 PolarHBondContact O-N 3.41Å; R32-E35 PolarHBondContact O-N 3.36Å; R32-S36 WeakPolarHBondContact O-CB 3.25Å; R32-S36 PolarHBondContact O-N 3.26Å; R32-S36 PolarHBondContact O-OG 3.42Å
33	L	84.7	Confident	81.1	Confident	115 Å²	115	91 Å²	91	60%	0.602	47%	0.47	S	S	*	.	H	α-helix	trans	-63.1	-45	176.7	-177.5	62.8	0	0	0	111	C29 R30 H31 E35 S36 I37	C29-L33 WeakPolarHBondContact O-CB 3.44Å; C29-L33 PolarHBondContact O-N 3.06Å; R30-L33 PolarHBondContact O-N 3.24Å; H31-L33 VanDerWaalsContact C-N 3.3Å; H31-L33 PolarHBondContact O-N 3.49Å; L33-E35 VanDerWaalsContact C-N 3.33Å; L33-E35 PolarHBondContact O-N 3.28Å; L33-S36 WeakPolarHBondContact O-CB 3.47Å; L33-S36 PolarHBondContact O-N 3.01Å; L33-S36 VanDerWaalsContact O-N 3.17Å; L33-I37 PolarHBondContact O-N 3.05Å
34	L	81.4	Confident	79.5	Confident	70 Å²	70	86.5 Å²	86.5	37%	0.366	46%	0.46	S	S	.	.	H	α-helix	trans	-67.7	-30.1	178.3	-71.3	173.2	0	0	0	113.4	R30 H31 I37	R30-L34 HydrophobicContact CG-CD1 4.1Å; R30-L34 WeakPolarHBondContact O-CB 3.39Å; R30-L34 VanDerWaalsContact O-CG 3.29Å; R30-L34 WeakPolarHBondContact O-CG 3.37Å; R30-L34 PolarHBondContact O-N 3.01Å; H31-L34 PolarHBondContact O-N 2.94Å; H31-L34 VanDerWaalsContact O-N 3.15Å; L34-I37 HydrophobicContact CD2-CD1 4.12Å
35	E	81	Confident	78.1	Confident	150 Å²	150	87.6 Å²	87.6	70%	0.701	46%	0.46	S	S	*	.	H	α-helix	trans	-75.4	-26.6	172.3	-73	177.4	170.4	0	0	112.6	H31 R32 L33 I37	H31-E35 WeakPolarHBondContact O-CG 3.43Å; H31-E35 PolarHBondContact O-N 2.98Å; R32-E35 PolarHBondContact O-N 3.36Å; L33-E35 VanDerWaalsContact C-N 3.33Å; L33-E35 PolarHBondContact O-N 3.28Å; E35-I37 PolarHBondContact O-N 3.45Å
36	S	81.1	Confident	76.7	Confident	67 Å²	67	86.8 Å²	86.8	47%	0.469	46%	0.462	S	S	.	.	H	α-helix	trans	-74.2	-15.5	175.2	-56.9	0	0	0	0	112.7	R32 L33 P38	R32-S36 WeakPolarHBondContact O-CB 3.25Å; R32-S36 PolarHBondContact O-N 3.26Å; R32-S36 PolarHBondContact O-OG 3.42Å; L33-S36 WeakPolarHBondContact O-CB 3.47Å; L33-S36 PolarHBondContact O-N 3.01Å; L33-S36 VanDerWaalsContact O-N 3.17Å; S36-P38 WeakPolarHBondContact O-CD 3.31Å
37	I	75.9	Confident	75.4	Confident	63 Å²	63	85.5 Å²	85.5	32%	0.323	45%	0.452	S	S	.	.	S	Bend	trans	-75.8	118.8	174.6	-60.8	173.6	0	0	0	108.2	L33 L34 E35 G39 I41 K42	L33-I37 PolarHBondContact O-N 3.05Å; L34-I37 HydrophobicContact CD2-CD1 4.12Å; E35-I37 PolarHBondContact O-N 3.45Å; I37-G39 PolarHBondContact O-N 3.11Å; I37-I41 HydrophobicContact CG2-CB 3.88Å; I37-I41 HydrophobicContact CG2-CG2 4.03Å; I37-K42 HydrophobicContact CG2-CB 4.15Å
38	P	75.5	Confident	74.2	Confident	49 Å²	49	86.6 Å²	86.6	32%	0.318	46%	0.461	S	S	.	.			trans	-53	137.9	176.3	-25.4	33.7	0	0	0	111.6	S36 H40 I41 K42	S36-P38 WeakPolarHBondContact O-CD 3.31Å; P38-H40 WeakPolarHBondContact CB-CE1 3.41Å; P38-H40 PolarHBondContact O-N 3.31Å; P38-I41 HydrophobicContact CB-CD1 4.45Å; P38-I41 HydrophobicContact CB-CG1 4.34Å; P38-I41 HydrophobicContact CG-CD1 4.12Å; P38-I41 PolarHBondContact O-N 3.5Å; P38-K42 PolarHBondContact O-N 3.01Å
39	G	66.3	Low	73.4	Confident	54 Å²	54	87.6 Å²	87.6	56%	0.557	46%	0.462	S	S	*	.	H	α-helix	trans	-54.8	-31.6	-174	0	0	0	0	0	114.3	I37 K42 C43	I37-G39 PolarHBondContact O-N 3.11Å; G39-K42 PolarHBondContact O-N 2.98Å; G39-C43 PolarHBondContact O-N 2.81Å
40	H	64.1	Low	72.4	Confident	110 Å²	110	88.9 Å²	88.9	51%	0.509	46%	0.463	S	S	.	.	H	α-helix	trans	-64.9	-43.5	175.4	60.5	-91.3	0	0	0	112.1	P38 C43 D44	P38-H40 WeakPolarHBondContact CB-CE1 3.41Å; P38-H40 PolarHBondContact O-N 3.31Å; H40-C43 PolarHBondContact O-N 3.36Å; H40-D44 PolarHBondContact O-N 3.2Å
41	I	63.5	Low	71.6	Confident	74 Å²	74	86 Å²	86	38%	0.379	46%	0.457	S	S	.	.	H	α-helix	trans	-69	-37.6	176.4	-52.2	-176.3	0	0	0	111.3	I37 P38 C43 D44 V45	I37-I41 HydrophobicContact CG2-CB 3.88Å; I37-I41 HydrophobicContact CG2-CG2 4.03Å; P38-I41 HydrophobicContact CB-CD1 4.45Å; P38-I41 HydrophobicContact CB-CG1 4.34Å; P38-I41 HydrophobicContact CG-CD1 4.12Å; P38-I41 PolarHBondContact O-N 3.5Å; I41-C43 VanDerWaalsContact C-N 3.31Å; I41-C43 PolarHBondContact O-N 2.96Å; I41-D44 PolarHBondContact O-N 3.37Å; I41-D44 VanDerWaalsContact O-N 3.13Å; I41-V45 PolarHBondContact O-N 2.99Å
42	K	55.9	Low	71.1	Confident	105 Å²	105	86.8 Å²	86.8	46%	0.457	46%	0.459	S	S	.	.	H	α-helix	trans	-63.1	-40.8	179.2	-168.3	175.3	-177.4	174.4	0	111.5	I37 P38 G39 T46	I37-K42 HydrophobicContact CG2-CB 4.15Å; P38-K42 PolarHBondContact O-N 3.01Å; G39-K42 PolarHBondContact O-N 2.98Å; K42-T46 PolarHBondContact O-N 3.03Å; K42-T46 PolarHBondContact O-OG1 3.23Å
43	C	55.4	Low	70.5	Confident	63 Å²	63	85.2 Å²	85.2	43%	0.426	46%	0.459	S	S	.	.	H	α-helix	trans	-63.7	-48.2	168.8	-89.9	0	0	0	0	110.7	G39 H40 I41 V45 T46 H47	G39-C43 PolarHBondContact O-N 2.81Å; H40-C43 PolarHBondContact O-N 3.36Å; I41-C43 VanDerWaalsContact C-N 3.31Å; I41-C43 PolarHBondContact O-N 2.96Å; C43-V45 VanDerWaalsContact C-N 3.34Å; C43-V45 PolarHBondContact O-N 3.01Å; C43-T46 PolarHBondContact O-N 3.43Å; C43-T46 VanDerWaalsContact O-N 3.14Å; C43-H47 VanDerWaalsContact O-CB 3.3Å; C43-H47 WeakPolarHBondContact O-CB 3.33Å; C43-H47 PolarHBondContact O-CD2 3.5Å; C43-H47 PolarHBondContact O-N 3.46Å
44	D	60.9	Low	69.8	Low	85 Å²	85	85.4 Å²	85.4	46%	0.455	46%	0.457	S	S	.	.	H	α-helix	trans	-56.4	-44	-178.2	-66.2	-25.6	0	0	0	112.8	H40 I41 N48	H40-D44 PolarHBondContact O-N 3.2Å; I41-D44 PolarHBondContact O-N 3.37Å; I41-D44 VanDerWaalsContact O-N 3.13Å; D44-N48 WeakPolarHBondContact O-CB 3.44Å; D44-N48 PolarHBondContact O-N 2.99Å; D44-N48 PolarHBondContact O-ND2 2.71Å
45	V	62.8	Low	69.4	Low	80 Å²	80	88.2 Å²	88.2	49%	0.485	46%	0.463	S	S	.	.	H	α-helix	trans	-66.4	-45.3	178.2	176.4	0	0	0	0	111.1	I41 C43 N48 I49	I41-V45 PolarHBondContact O-N 2.99Å; C43-V45 VanDerWaalsContact C-N 3.34Å; C43-V45 PolarHBondContact O-N 3.01Å; V45-N48 PolarHBondContact O-N 3.37Å; V45-I49 HydrophobicContact CG1-CD1 3.92Å; V45-I49 VanDerWaalsContact O-CG1 3.32Å; V45-I49 WeakPolarHBondContact O-CG1 3.48Å; V45-I49 PolarHBondContact O-N 2.83Å
46	T	65.3	Low	69.1	Low	74 Å²	74	84.1 Å²	84.1	45%	0.454	45%	0.446	S	S	.	.	H	α-helix	trans	-65.8	-46	-178.6	-51.8	0	0	0	0	110.8	K42 C43 I49 I50	K42-T46 PolarHBondContact O-N 3.03Å; K42-T46 PolarHBondContact O-OG1 3.23Å; C43-T46 PolarHBondContact O-N 3.43Å; C43-T46 VanDerWaalsContact O-N 3.14Å; T46-I49 PolarHBondContact O-N 3.29Å; T46-I50 HydrophobicContact CG2-CD1 3.83Å; T46-I50 WeakPolarHBondContact O-CB 3.48Å; T46-I50 VanDerWaalsContact O-CG1 3.25Å; T46-I50 WeakPolarHBondContact O-CG1 3.35Å; T46-I50 PolarHBondContact O-N 3.49Å
47	H	67.6	Low	68.5	Low	98 Å²	98	87.6 Å²	87.6	45%	0.454	45%	0.453	S	S	.	.	H	α-helix	trans	-62.4	-44.7	173.4	-71.3	-61.8	0	0	0	111.1	C43 I49 I50 D51	C43-H47 VanDerWaalsContact O-CB 3.3Å; C43-H47 WeakPolarHBondContact O-CB 3.33Å; C43-H47 PolarHBondContact O-CD2 3.5Å; C43-H47 PolarHBondContact O-N 3.46Å; H47-I49 VanDerWaalsContact C-N 3.3Å; H47-I49 PolarHBondContact O-N 3.48Å; H47-I50 CarbonylContact O-C 3.59Å; H47-I50 PolarHBondContact O-N 3.4Å; H47-I50 VanDerWaalsContact O-N 3.17Å; H47-D51 WeakPolarHBondContact O-CB 3.29Å; H47-D51 PolarHBondContact O-N 2.94Å
48	N	68.3	Low	67.9	Low	97 Å²	97	88 Å²	88	52%	0.519	46%	0.458	S	S	.	.	H	α-helix	trans	-59.8	-39.4	177.1	-82.1	-50.1	0	0	0	112.9	D44 V45 K52	D44-N48 WeakPolarHBondContact O-CB 3.44Å; D44-N48 PolarHBondContact O-N 2.99Å; D44-N48 PolarHBondContact O-ND2 2.71Å; V45-N48 PolarHBondContact O-N 3.37Å; N48-K52 WeakPolarHBondContact O-CB 3.45Å; N48-K52 PolarHBondContact O-N 3.04Å
49	I	74.6	Confident	67.1	Low	99 Å²	99	89.9 Å²	89.9	51%	0.508	47%	0.465	S	S	.	.	H	α-helix	trans	-69.5	-45.9	175.8	-66.9	168.7	0	0	0	110.3	V45 T46 H47 K52 L53	V45-I49 HydrophobicContact CG1-CD1 3.92Å; V45-I49 VanDerWaalsContact O-CG1 3.32Å; V45-I49 WeakPolarHBondContact O-CG1 3.48Å; V45-I49 PolarHBondContact O-N 2.83Å; T46-I49 PolarHBondContact O-N 3.29Å; H47-I49 VanDerWaalsContact C-N 3.3Å; H47-I49 PolarHBondContact O-N 3.48Å; I49-K52 PolarHBondContact O-N 3.47Å; I49-L53 HydrophobicContact CG2-CD1 4.09Å; I49-L53 HydrophobicContact CG2-CG 4.47Å; I49-L53 WeakPolarHBondContact O-CG 3.41Å; I49-L53 PolarHBondContact O-N 3.33Å
50	I	72.3	Confident	66.7	Low	88 Å²	88	91.9 Å²	91.9	45%	0.451	46%	0.463	S	S	.	.	H	α-helix	trans	-62.6	-50.7	178.3	-69.9	170	0	0	0	110.5	T46 H47 K52 L53 E54	T46-I50 HydrophobicContact CG2-CD1 3.83Å; T46-I50 WeakPolarHBondContact O-CB 3.48Å; T46-I50 VanDerWaalsContact O-CG1 3.25Å; T46-I50 WeakPolarHBondContact O-CG1 3.35Å; T46-I50 PolarHBondContact O-N 3.49Å; H47-I50 CarbonylContact O-C 3.59Å; H47-I50 PolarHBondContact O-N 3.4Å; H47-I50 VanDerWaalsContact O-N 3.17Å; I50-K52 PolarHBondContact O-N 2.85Å; I50-L53 CarbonylContact O-C 3.58Å; I50-L53 WeakPolarHBondContact O-CB 3.43Å; I50-L53 PolarHBondContact O-N 2.97Å; I50-L53 VanDerWaalsContact O-N 3.09Å; I50-E54 WeakPolarHBondContact O-CB 3.49Å; I50-E54 PolarHBondContact O-N 3.16Å
51	D	73.4	Confident	66.2	Low	58 Å²	58	92.4 Å²	92.4	31%	0.31	47%	0.47	S	S	.	.	H	α-helix	trans	-59	-36.3	177.4	-65.7	-2.1	0	0	0	111.2	H47 R55	H47-D51 WeakPolarHBondContact O-CB 3.29Å; H47-D51 PolarHBondContact O-N 2.94Å; D51-R55 WeakPolarHBondContact O-CB 3.42Å; D51-R55 VanDerWaalsContact O-CG 3.26Å; D51-R55 WeakPolarHBondContact O-CG 3.42Å; D51-R55 PolarHBondContact O-N 3.28Å; D51-R55 PolarHBondContact O-NE 3.33Å
52	K	76.3	Confident	65.7	Low	104 Å²	104	95 Å²	95	45%	0.452	48%	0.481	S	S	.	.	H	α-helix	trans	-69	-46	174.7	-177.1	176.5	-176.8	-60.1	0	111.2	N48 I49 I50 E54 R55 D56	N48-K52 WeakPolarHBondContact O-CB 3.45Å; N48-K52 PolarHBondContact O-N 3.04Å; I49-K52 PolarHBondContact O-N 3.47Å; I50-K52 PolarHBondContact O-N 2.85Å; K52-E54 VanDerWaalsContact C-N 3.32Å; K52-E54 PolarHBondContact O-N 3.3Å; K52-R55 PolarHBondContact O-N 2.69Å; K52-D56 IonicContact NZ-OD1 2.79Å; K52-D56 IonicContact NZ-OD2 3.98Å; K52-D56 PolarHBondContact NZ-OD2 3.06Å; K52-D56 WeakPolarHBondContact O-CB 3.29Å; K52-D56 PolarHBondContact O-N 3.37Å
53	L	74.5	Confident	65.4	Low	86 Å²	86	95.9 Å²	95.9	45%	0.45	49%	0.489	S	S	.	.	H	α-helix	trans	-59.1	-45.7	174.7	-72.6	171.1	0	0	0	110.6	I49 I50 R55 D56 F57	I49-L53 HydrophobicContact CG2-CD1 4.09Å; I49-L53 HydrophobicContact CG2-CG 4.47Å; I49-L53 WeakPolarHBondContact O-CG 3.41Å; I49-L53 PolarHBondContact O-N 3.33Å; I50-L53 CarbonylContact O-C 3.58Å; I50-L53 WeakPolarHBondContact O-CB 3.43Å; I50-L53 PolarHBondContact O-N 2.97Å; I50-L53 VanDerWaalsContact O-N 3.09Å; L53-R55 PolarHBondContact O-N 2.68Å; L53-D56 PolarHBondContact O-N 2.98Å; L53-F57 HydrophobicContact CB-CD2 4.37Å; L53-F57 HydrophobicContact CB-CE2 4.2Å; L53-F57 HydrophobicContact CD2-CE2 4.48Å; L53-F57 WeakPolarHBondContact O-CD2 3.47Å; L53-F57 PolarHBondContact O-N 2.79Å
54	E	68.8	Low	65	Low	120 Å²	120	98.3 Å²	98.3	56%	0.561	50%	0.502	S	S	*	.	H	α-helix	trans	-58.5	-47.9	177.2	-173.9	177.1	-174.8	0	0	111.2	I50 K52 D56 F57 V58	I50-E54 WeakPolarHBondContact O-CB 3.49Å; I50-E54 PolarHBondContact O-N 3.16Å; K52-E54 VanDerWaalsContact C-N 3.32Å; K52-E54 PolarHBondContact O-N 3.3Å; E54-D56 PolarHBondContact O-N 2.76Å; E54-F57 PolarHBondContact O-N 3.42Å; E54-V58 WeakPolarHBondContact O-CB 3.47Å; E54-V58 VanDerWaalsContact O-CG2 3.23Å; E54-V58 WeakPolarHBondContact O-CG2 3.32Å; E54-V58 PolarHBondContact O-N 2.98Å
55	R	74.2	Confident	64.3	Low	129 Å²	129	99.9 Å²	99.9	49%	0.487	52%	0.515	S	S	.	.	H	α-helix	trans	-62	-42	174.4	-74.9	-174.3	-61.8	-98	-1.4	112.5	D51 K52 L53 V58 N59	D51-R55 WeakPolarHBondContact O-CB 3.42Å; D51-R55 VanDerWaalsContact O-CG 3.26Å; D51-R55 WeakPolarHBondContact O-CG 3.42Å; D51-R55 PolarHBondContact O-N 3.28Å; D51-R55 PolarHBondContact O-NE 3.33Å; K52-R55 PolarHBondContact O-N 2.69Å; L53-R55 PolarHBondContact O-N 2.68Å; R55-V58 PolarHBondContact O-N 2.79Å; R55-N59 VanDerWaalsContact O-CB 3.26Å; R55-N59 WeakPolarHBondContact O-CB 3.15Å; R55-N59 PolarHBondContact O-N 3Å; R55-N59 PolarHBondContact O-ND2 3.44Å
56	D	73.6	Confident	63.3	Low	64 Å²	64	102.6 Å²	102.6	34%	0.342	53%	0.525	S	S	.	.	H	α-helix	trans	-62.5	-44.7	179	-68.2	-16.5	0	0	0	109.8	K52 L53 E54 N59 D60	K52-D56 IonicContact NZ-OD1 2.79Å; K52-D56 IonicContact NZ-OD2 3.98Å; K52-D56 PolarHBondContact NZ-OD2 3.06Å; K52-D56 WeakPolarHBondContact O-CB 3.29Å; K52-D56 PolarHBondContact O-N 3.37Å; L53-D56 PolarHBondContact O-N 2.98Å; E54-D56 PolarHBondContact O-N 2.76Å; D56-N59 PolarHBondContact O-N 3.5Å; D56-D60 PolarHBondContact O-N 3.32Å
57	F	68.3	Low	62	Low	140 Å²	140	104.7 Å²	104.7	61%	0.614	54%	0.538	S	S	*	.	H	α-helix	trans	-66.6	-37.3	175.4	-73.8	-63.8	0	0	0	113.9	L53 E54	L53-F57 HydrophobicContact CB-CD2 4.37Å; L53-F57 HydrophobicContact CB-CE2 4.2Å; L53-F57 HydrophobicContact CD2-CE2 4.48Å; L53-F57 WeakPolarHBondContact O-CD2 3.47Å; L53-F57 PolarHBondContact O-N 2.79Å; E54-F57 PolarHBondContact O-N 3.42Å
58	V	65	Low	60.5	Low	71 Å²	71	105.5 Å²	105.5	43%	0.43	56%	0.555	S	S	.	*	H	α-helix	trans	-70.2	-38.2	177.2	171	0	0	0	0	111.1	E54 R55 N61 Q62	E54-V58 WeakPolarHBondContact O-CB 3.47Å; E54-V58 VanDerWaalsContact O-CG2 3.23Å; E54-V58 WeakPolarHBondContact O-CG2 3.32Å; E54-V58 PolarHBondContact O-N 2.98Å; R55-V58 PolarHBondContact O-N 2.79Å; V58-N61 PolarHBondContact O-N 3.26Å; V58-Q62 PolarHBondContact O-N 3.38Å
59	N	58	Low	58.9	Low	89 Å²	89	107 Å²	107	48%	0.476	56%	0.563	S	S	.	*	H	α-helix	trans	-71.9	-34	179.9	-70	-27.2	0	0	0	112.3	R55 D56 N61 Q62 L63	R55-N59 VanDerWaalsContact O-CB 3.26Å; R55-N59 WeakPolarHBondContact O-CB 3.15Å; R55-N59 PolarHBondContact O-N 3Å; R55-N59 PolarHBondContact O-ND2 3.44Å; D56-N59 PolarHBondContact O-N 3.5Å; N59-N61 PolarHBondContact O-N 3.28Å; N59-Q62 PolarHBondContact O-N 3.3Å; N59-Q62 VanDerWaalsContact O-N 3.09Å; N59-L63 PolarHBondContact O-N 2.86Å; N59-L63 VanDerWaalsContact O-N 3.13Å
60	D	57.2	Low	57	Low	95 Å²	95	109.1 Å²	109.1	51%	0.508	58%	0.575	S	S	.	*	H	α-helix	trans	-62.8	-30.9	174.3	-76.9	-20.6	0	0	0	112.2	D56 T64	D56-D60 PolarHBondContact O-N 3.32Å; D60-T64 PolarHBondContact O-OG1 2.99Å
61	N	54.1	Low	55.2	Low	121 Å²	121	110.8 Å²	110.8	65%	0.647	59%	0.59	S	S	*	*	H	α-helix	trans	-77.9	-19.5	174.5	-75.8	-19.6	0	0	0	113.9	V58 N59 T64	V58-N61 PolarHBondContact O-N 3.26Å; N59-N61 PolarHBondContact O-N 3.28Å; N61-T64 PolarHBondContact O-OG1 2.94Å
62	Q	53.9	Low	53.4	Low	130 Å²	130	113.9 Å²	113.9	61%	0.607	61%	0.611	S	S	*	*	H	α-helix	trans	-87.1	-29.4	175	-75.4	-167.6	57.5	0	0	112.8	V58 N59 T64 T65	V58-Q62 PolarHBondContact O-N 3.38Å; N59-Q62 PolarHBondContact O-N 3.3Å; N59-Q62 VanDerWaalsContact O-N 3.09Å; Q62-T64 PolarHBondContact O-N 3.42Å; Q62-T65 PolarHBondContact O-N 2.98Å; Q62-T65 VanDerWaalsContact O-N 3.11Å
63	L	49.4	Very low	51.5	Low	122 Å²	122	116.2 Å²	116.2	64%	0.639	63%	0.629	S	S	*	*	H	α-helix	trans	-70	-21.4	179	-165.9	60.7	0	0	0	113.1	N59 T65	N59-L63 PolarHBondContact O-N 2.86Å; N59-L63 VanDerWaalsContact O-N 3.13Å; L63-T65 VanDerWaalsContact C-N 3.27Å; L63-T65 PolarHBondContact O-N 3.48Å
64	T	47.4	Very low	49.7	Very low	114 Å²	114	122.1 Å²	122.1	70%	0.699	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.9	-10	172.5	32.2	0	0	0	0	114.1	D60 N61 Q62	D60-T64 PolarHBondContact O-OG1 2.99Å; N61-T64 PolarHBondContact O-OG1 2.94Å; Q62-T64 PolarHBondContact O-N 3.42Å
65	T	44.7	Very low	48.2	Very low	118 Å²	118	122.8 Å²	122.8	72%	0.724	66%	0.663	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.1	-11.1	-179.8	-55.4	0	0	0	0	113.6	Q62 L63	Q62-T65 PolarHBondContact O-N 2.98Å; Q62-T65 VanDerWaalsContact O-N 3.11Å; L63-T65 VanDerWaalsContact C-N 3.27Å; L63-T65 PolarHBondContact O-N 3.48Å
66	I	42.5	Very low	46.4	Very low	137 Å²	137	122.9 Å²	122.9	70%	0.703	68%	0.678	S	S	*	*	S	Bend	trans	-122.1	77	178.1	-44.6	177.7	0	0	0	109.5
67	T	38.3	Very low	44.8	Very low	118 Å²	118	127.5 Å²	127.5	72%	0.724	69%	0.692	S	S	*	*			trans	177.8	75.5	140.5	-64.4	0	0	0	0	107.8
68	S	35.3	Very low	43.4	Very low	115 Å²	115	130.1 Å²	130.1	80%	0.804	70%	0.703	S	S	*	*			trans	-92.9	85.5	152.9	-168	0	0	0	0	105.5
69	N	35.6	Very low	42.3	Very low	128 Å²	128	133.6 Å²	133.6	68%	0.684	72%	0.715	S	S	*	*	S	Bend	trans	-177.3	120.8	153	-83.9	-21.8	0	0	0	109.5
70	N	34.6	Very low	41.3	Very low	144 Å²	144	136.5 Å²	136.5	77%	0.77	73%	0.73	S	S	*	*			trans	90.8	90.6	158.7	-52.3	-12.5	0	0	0	118.1
71	T	35	Very low	40.5	Very low	124 Å²	124	140.4 Å²	140.4	76%	0.761	75%	0.749	S	S	*	*			trans	41.8	111	130.8	52.1	0	0	0	0	119.4
72	T	35.2	Very low	39.8	Very low	122 Å²	122	140 Å²	140	75%	0.748	75%	0.751	S	S	*	*			trans	49.1	98.8	138.4	-38.8	0	0	0	0	116.5
73	D	35.2	Very low	38.9	Very low	154 Å²	154	142.5 Å²	142.5	82%	0.824	76%	0.763	S	S	*	*				-168.5	135.6	122.9	-93.1	-29.2	0	0	0	113.1	T75	D73-T75 PolarHBondContact O-N 2.73Å
74	K	37.1	Very low	38.5	Very low	210 Å²	210	144 Å²	144	91%	0.913	77%	0.771	S	S	*	*			trans	-81.1	105.5	-171.6	-167.1	-176.3	-169.2	179.7	0	109.1
75	T	37.5	Very low	38	Very low	134 Å²	134	147.5 Å²	147.5	82%	0.822	78%	0.776	S	S	*	*			trans	-134	129.2	166.7	61.1	0	0	0	0	112.8	D73	D73-T75 PolarHBondContact O-N 2.73Å
76	T	36	Very low	38	Very low	130 Å²	130	148.6 Å²	148.6	80%	0.798	78%	0.777	S	S	*	*			trans	-59.1	122.4	-176.6	-60.3	0	0	0	0	112.9	K78	T76-K78 PolarHBondContact O-N 2.96Å
77	Y	41.4	Very low	37.9	Very low	162 Å²	162	147.5 Å²	147.5	64%	0.635	78%	0.777	S	S	*	*			trans	-64.5	95	176.1	-159.4	-113.2	0	0	0	111.2	Q79	Y77-Q79 HydrophobicContact CD1-CG 3.93Å; Y77-Q79 HydrophobicContact CE1-CG 3.42Å; Y77-Q79 VanDerWaalsContact CE1-CG 3.42Å; Y77-Q79 VanDerWaalsContact CE1-NE2 3.28Å; Y77-Q79 VanDerWaalsContact CZ-NE2 3.32Å; Y77-Q79 PolarHBondContact OH-NE2 3.4Å
78	K	38.2	Very low	38	Very low	195 Å²	195	147.5 Å²	147.5	85%	0.848	78%	0.782	S	S	*	*			trans	-98	92.2	167	-88.6	-172.5	174.1	-177.2	0	108.8	T76 N80	T76-K78 PolarHBondContact O-N 2.96Å; K78-N80 PolarHBondContact O-N 3.04Å
79	Q	41.1	Very low	38.2	Very low	144 Å²	144	147.2 Å²	147.2	67%	0.673	78%	0.779	S	S	*	*			trans	-73.9	117.5	170.4	-89.9	-179.2	-18.9	0	0	110.4	Y77 I81	Y77-Q79 HydrophobicContact CD1-CG 3.93Å; Y77-Q79 HydrophobicContact CE1-CG 3.42Å; Y77-Q79 VanDerWaalsContact CE1-CG 3.42Å; Y77-Q79 VanDerWaalsContact CE1-NE2 3.28Å; Y77-Q79 VanDerWaalsContact CZ-NE2 3.32Å; Y77-Q79 PolarHBondContact OH-NE2 3.4Å; Q79-I81 PolarHBondContact O-N 3.32Å
80	N	37.9	Very low	38.2	Very low	150 Å²	150	146.9 Å²	146.9	80%	0.802	79%	0.787	S	S	*	*			trans	-76.2	112.6	175.6	-116.6	-36.6	0	0	0	109.8	K78 T82	K78-N80 PolarHBondContact O-N 3.04Å; N80-T82 VanDerWaalsContact C-N 3.33Å; N80-T82 PolarHBondContact O-N 3.39Å; N80-T82 PolarHBondContact O-OG1 3.15Å
81	I	41	Very low	38.4	Very low	176 Å²	176	144.6 Å²	144.6	90%	0.903	78%	0.783	S	S	*	*			trans	-71.8	87.6	172.4	-57.9	171.6	0	0	0	107.8	Q79	Q79-I81 PolarHBondContact O-N 3.32Å
82	T	39.5	Very low	38.6	Very low	112 Å²	112	144.7 Å²	144.7	69%	0.687	78%	0.783	S	S	*	*			trans	-111.7	104.7	176.8	-21.9	0	0	0	0	109.8	N80	N80-T82 VanDerWaalsContact C-N 3.33Å; N80-T82 PolarHBondContact O-N 3.39Å; N80-T82 PolarHBondContact O-OG1 3.15Å
83	Q	34.5	Very low	38.7	Very low	184 Å²	184	142.9 Å²	142.9	86%	0.86	78%	0.775	S	S	*	*			trans	41.5	97.6	160	-75.1	-179.2	-6.5	0	0	118.5	K85	Q83-K85 PolarHBondContact O-N 2.97Å
84	L	41.4	Very low	39.1	Very low	154 Å²	154	140.8 Å²	140.8	81%	0.806	77%	0.773	S	S	*	*			trans	-61.4	94.4	164.8	-162.9	83.2	0	0	0	110.6	L86	L84-L86 HydrophobicContact CD2-CD2 4.16Å; L84-L86 PolarHBondContact O-N 3.17Å
85	K	35.2	Very low	39.6	Very low	186 Å²	186	140.4 Å²	140.4	81%	0.809	77%	0.767	S	S	*	*			trans	-83.5	102.2	170.2	-170.9	176	-178	179.7	0	108.9	Q83 T87	Q83-K85 PolarHBondContact O-N 2.97Å; K85-T87 PolarHBondContact O-N 3.37Å
86	L	45.6	Very low	40.4	Very low	142 Å²	142	138.4 Å²	138.4	74%	0.743	76%	0.755	S	S	*	*			trans	-66.1	92.6	175.3	-66.3	162.5	0	0	0	109.6	L84 S88	L84-L86 HydrophobicContact CD2-CD2 4.16Å; L84-L86 PolarHBondContact O-N 3.17Å; L86-S88 PolarHBondContact O-N 3.46Å
87	T	40.6	Very low	41.3	Very low	114 Å²	114	136 Å²	136	70%	0.699	74%	0.74	S	S	*	*			trans	-81.5	100.7	164.5	43	0	0	0	0	108.1	K85 S89	K85-T87 PolarHBondContact O-N 3.37Å; T87-S89 PolarHBondContact O-N 3.34Å
88	S	41.1	Very low	42.6	Very low	118 Å²	118	134.5 Å²	134.5	83%	0.825	74%	0.743	S	S	*	*			trans	-60.6	101.8	175.9	-45	0	0	0	0	110.1	L86 S90	L86-S88 PolarHBondContact O-N 3.46Å; S88-S90 PolarHBondContact O-N 2.92Å
89	S	38.6	Very low	44.1	Very low	108 Å²	108	133 Å²	133	76%	0.755	74%	0.737	S	S	*	*			trans	-64.6	121.6	169.8	-33.2	0	0	0	0	108.6	T87 S91	T87-S89 PolarHBondContact O-N 3.34Å; S89-S91 PolarHBondContact O-N 3.37Å
90	S	36.6	Very low	45.5	Very low	121 Å²	121	130.7 Å²	130.7	85%	0.846	73%	0.726	S	S	*	*			trans	-56.6	108.8	172.6	48.2	0	0	0	0	111.8	S88	S88-S90 PolarHBondContact O-N 2.92Å
91	S	37.7	Very low	46.9	Very low	97 Å²	97	128.8 Å²	128.8	68%	0.678	72%	0.715	S	S	*	*			trans	-146.1	103.5	160	10.5	0	0	0	0	110.5	S89	S89-S91 PolarHBondContact O-N 3.37Å
92	T	39.3	Very low	48.5	Very low	126 Å²	126	126.4 Å²	126.4	77%	0.773	70%	0.7	S	S	*	*			trans	59.9	83.1	137.8	-25.5	0	0	0	0	117.7	S94	T92-S94 PolarHBondContact O-N 2.91Å; T92-S94 VanDerWaalsContact O-N 3.07Å
93	S	36.8	Very low	50.5	Low	83 Å²	83	126.9 Å²	126.9	58%	0.58	70%	0.695	S	S	*	*			trans	12.5	82.2	141.9	-169	0	0	0	0	117.3	Y95	S93-Y95 WeakPolarHBondContact OG-CE2 3.32Å
94	S	44.2	Very low	52.5	Low	110 Å²	110	121 Å²	121	77%	0.769	67%	0.674	S	S	*	*			trans	-90.4	103	160.9	-64.2	0	0	0	0	108.3	T92 T96	T92-S94 PolarHBondContact O-N 2.91Å; T92-S94 VanDerWaalsContact O-N 3.07Å; S94-T96 PolarHBondContact O-N 3.4Å
95	Y	46.5	Very low	54.5	Low	202 Å²	202	120 Å²	120	79%	0.792	66%	0.663	S	S	*	*			trans	-60.9	99.5	170.4	-57.3	-92.9	0	0	0	108	S93 T97	S93-Y95 WeakPolarHBondContact OG-CE2 3.32Å; Y95-T97 PolarHBondContact O-N 3.36Å
96	T	56	Low	56.9	Low	93 Å²	93	116 Å²	116	57%	0.571	65%	0.651	S	S	*	*			trans	-58	112.9	168	39.5	0	0	0	0	107	S94 N98	S94-T96 PolarHBondContact O-N 3.4Å; T96-N98 PolarHBondContact O-N 3.01Å
97	T	54	Low	58.8	Low	80 Å²	80	112.7 Å²	112.7	49%	0.491	63%	0.634	S	S	.	*			trans	-66.6	137.4	-176.9	57.2	0	0	0	0	109	Y95 K99 E100	Y95-T97 PolarHBondContact O-N 3.36Å; T97-K99 PolarHBondContact O-N 2.97Å; T97-E100 PolarHBondContact O-N 3.29Å
98	N	68.6	Low	60.8	Low	129 Å²	129	112.9 Å²	112.9	69%	0.69	63%	0.626	S	S	*	*	H	α-helix	trans	-48.4	-28.7	-178.6	-74.8	-22.4	0	0	0	113.5	T96 L101 E102	T96-N98 PolarHBondContact O-N 3.01Å; N98-L101 WeakPolarHBondContact O-CB 2.97Å; N98-L101 PolarHBondContact O-N 2.86Å; N98-E102 WeakPolarHBondContact O-CG 3.26Å; N98-E102 PolarHBondContact O-N 3.32Å
99	K	70.4	Confident	62.9	Low	165 Å²	165	110.9 Å²	110.9	72%	0.717	60%	0.604	S	S	*	*	H	α-helix	trans	-62.5	-39.6	176.3	-69.1	-172.8	176.5	-177.7	0	114	T97 L101 E102 Q103	T97-K99 PolarHBondContact O-N 2.97Å; K99-L101 VanDerWaalsContact C-N 3.29Å; K99-E102 PolarHBondContact O-N 3.19Å; K99-Q103 WeakPolarHBondContact O-CB 3.35Å; K99-Q103 PolarHBondContact O-N 3.48Å
100	E	69.8	Low	65.3	Low	95 Å²	95	108.9 Å²	108.9	44%	0.444	59%	0.59	S	S	.	*	H	α-helix	trans	-68.1	-34.8	177.6	-70.9	-178.7	157.4	0	0	111.1	T97 Q103 S104	T97-E100 PolarHBondContact O-N 3.29Å; E100-Q103 PolarHBondContact O-N 3.47Å; E100-S104 WeakPolarHBondContact O-CB 3.37Å; E100-S104 PolarHBondContact O-N 2.86Å
101	L	68.5	Low	67.8	Low	110 Å²	110	107.3 Å²	107.3	58%	0.576	57%	0.572	S	S	*	*	H	α-helix	trans	-68.9	-44.3	176.9	-124.8	147.2	0	0	0	111.4	N98 K99 S104 F105	N98-L101 WeakPolarHBondContact O-CB 2.97Å; N98-L101 PolarHBondContact O-N 2.86Å; K99-L101 VanDerWaalsContact C-N 3.29Å; L101-S104 PolarHBondContact O-N 3.33Å; L101-F105 PolarHBondContact O-N 3.05Å
102	E	73.4	Confident	70.4	Confident	126 Å²	126	107.5 Å²	107.5	59%	0.589	56%	0.563	S	S	*	*	H	α-helix	trans	-62.1	-42.2	172.9	-75.4	-179.7	170.8	0	0	112.2	N98 K99 S104 F105 N106	N98-E102 WeakPolarHBondContact O-CG 3.26Å; N98-E102 PolarHBondContact O-N 3.32Å; K99-E102 PolarHBondContact O-N 3.19Å; E102-S104 PolarHBondContact O-N 2.82Å; E102-F105 PolarHBondContact O-N 2.9Å; E102-N106 VanDerWaalsContact O-CG 3.32Å; E102-N106 PolarHBondContact O-N 3.37Å; E102-N106 PolarHBondContact O-ND2 3.13Å
103	Q	81.2	Confident	72.8	Confident	122 Å²	122	105.8 Å²	105.8	57%	0.57	55%	0.549	S	S	*	.	H	α-helix	trans	-65.2	-40.2	178.1	-171.6	168.1	10	0	0	111.9	K99 E100 N106 N107	K99-Q103 WeakPolarHBondContact O-CB 3.35Å; K99-Q103 PolarHBondContact O-N 3.48Å; E100-Q103 PolarHBondContact O-N 3.47Å; Q103-N106 PolarHBondContact O-N 3.06Å; Q103-N107 WeakPolarHBondContact O-CB 3.44Å; Q103-N107 VanDerWaalsContact O-CG 3.31Å; Q103-N107 PolarHBondContact O-N 3.09Å
104	S	76.7	Confident	75.3	Confident	61 Å²	61	104.4 Å²	104.4	43%	0.427	54%	0.537	S	S	.	.	H	α-helix	trans	-59.8	-45.2	173.5	-177	0	0	0	0	111.7	E100 L101 E102 N107 Q108	E100-S104 WeakPolarHBondContact O-CB 3.37Å; E100-S104 PolarHBondContact O-N 2.86Å; L101-S104 PolarHBondContact O-N 3.33Å; E102-S104 PolarHBondContact O-N 2.82Å; S104-N107 PolarHBondContact O-N 3.48Å; S104-Q108 WeakPolarHBondContact O-CG 3.44Å; S104-Q108 PolarHBondContact O-N 3.33Å
105	F	83.2	Confident	77.4	Confident	131 Å²	131	101.7 Å²	101.7	58%	0.575	52%	0.516	S	S	*	.	H	α-helix	trans	-62.9	-43.9	177.6	-170.8	-97.4	0	0	0	112.4	L101 E102 N107 Q108 Q109	L101-F105 PolarHBondContact O-N 3.05Å; E102-F105 PolarHBondContact O-N 2.9Å; F105-N107 VanDerWaalsContact C-N 3.34Å; F105-N107 PolarHBondContact O-N 3.37Å; F105-Q108 PolarHBondContact O-N 3.42Å; F105-Q109 PolarHBondContact O-N 2.9Å
106	N	85.3	Confident	79.6	Confident	104 Å²	104	97 Å²	97	56%	0.556	50%	0.501	S	S	*	.	H	α-helix	trans	-62.2	-40.7	176.1	-72.5	-28.8	0	0	0	112.2	E102 Q103 Q109 S110	E102-N106 VanDerWaalsContact O-CG 3.32Å; E102-N106 PolarHBondContact O-N 3.37Å; E102-N106 PolarHBondContact O-ND2 3.13Å; Q103-N106 PolarHBondContact O-N 3.06Å; N106-Q109 PolarHBondContact O-N 3.4Å; N106-S110 WeakPolarHBondContact O-CB 3.1Å; N106-S110 PolarHBondContact O-N 3.11Å
107	N	86.7	Confident	81.3	Confident	72 Å²	72	98.1 Å²	98.1	39%	0.385	50%	0.498	S	S	.	.	H	α-helix	trans	-64.3	-43	175.6	-76.1	-10	0	0	0	111.6	Q103 S104 F105 Q109 S110 I111	Q103-N107 WeakPolarHBondContact O-CB 3.44Å; Q103-N107 VanDerWaalsContact O-CG 3.31Å; Q103-N107 PolarHBondContact O-N 3.09Å; S104-N107 PolarHBondContact O-N 3.48Å; F105-N107 VanDerWaalsContact C-N 3.34Å; F105-N107 PolarHBondContact O-N 3.37Å; N107-Q109 PolarHBondContact O-N 3.36Å; N107-S110 WeakPolarHBondContact O-CB 3.25Å; N107-S110 PolarHBondContact O-N 3.28Å; N107-I111 VanDerWaalsContact O-CG1 3.29Å; N107-I111 WeakPolarHBondContact O-CG1 3.33Å; N107-I111 PolarHBondContact O-N 3.39Å
108	Q	82.3	Confident	83.2	Confident	117 Å²	117	97.9 Å²	97.9	55%	0.547	49%	0.494	S	S	.	.	H	α-helix	trans	-61.1	-43.5	176.4	-74.3	179.3	-21.4	0	0	112	S104 F105 S110 I111 M112	S104-Q108 WeakPolarHBondContact O-CG 3.44Å; S104-Q108 PolarHBondContact O-N 3.33Å; F105-Q108 PolarHBondContact O-N 3.42Å; Q108-S110 PolarHBondContact O-N 2.96Å; Q108-I111 PolarHBondContact O-N 3.29Å; Q108-M112 PolarHBondContact O-N 3.07Å
109	Q	84.9	Confident	84.2	Confident	77 Å²	77	97.8 Å²	97.8	36%	0.36	48%	0.484	S	S	.	.	H	α-helix	trans	-64.1	-40.8	176.4	-169.8	61.6	48.6	0	0	112	F105 N106 N107 M112 N113	F105-Q109 PolarHBondContact O-N 2.9Å; N106-Q109 PolarHBondContact O-N 3.4Å; N107-Q109 PolarHBondContact O-N 3.36Å; Q109-M112 PolarHBondContact O-N 3.49Å; Q109-N113 PolarHBondContact NE2-OD1 3.43Å; Q109-N113 VanDerWaalsContact O-CG 3.27Å; Q109-N113 PolarHBondContact O-N 2.95Å; Q109-N113 PolarHBondContact O-OD1 3.44Å
110	S	90.1	Very high	85.2	Confident	66 Å²	66	95.2 Å²	95.2	46%	0.462	47%	0.474	S	S	.	.	H	α-helix	trans	-61.6	-43.1	176.4	-177.8	0	0	0	0	112.4	N106 N107 Q108 N113 T114	N106-S110 WeakPolarHBondContact O-CB 3.1Å; N106-S110 PolarHBondContact O-N 3.11Å; N107-S110 WeakPolarHBondContact O-CB 3.25Å; N107-S110 PolarHBondContact O-N 3.28Å; Q108-S110 PolarHBondContact O-N 2.96Å; S110-N113 PolarHBondContact O-N 3.39Å; S110-T114 WeakPolarHBondContact O-CB 3.43Å; S110-T114 PolarHBondContact O-N 2.97Å; S110-T114 PolarHBondContact O-OG1 3.13Å
111	I	89.4	Confident	86.1	Confident	88 Å²	88	97.8 Å²	97.8	45%	0.451	48%	0.48	S	S	.	.	H	α-helix	trans	-62.2	-44.9	175.8	-68.7	164.4	0	0	0	110.6	N107 Q108 N113 T114 T115	N107-I111 VanDerWaalsContact O-CG1 3.29Å; N107-I111 WeakPolarHBondContact O-CG1 3.33Å; N107-I111 PolarHBondContact O-N 3.39Å; Q108-I111 PolarHBondContact O-N 3.29Å; I111-N113 PolarHBondContact O-N 2.98Å; I111-T114 PolarHBondContact O-N 3.28Å; I111-T115 WeakPolarHBondContact O-CB 3.2Å; I111-T115 PolarHBondContact O-N 2.94Å; I111-T115 PolarHBondContact O-OG1 2.87Å
112	M	90.5	Very high	87.1	Confident	100 Å²	100	96.7 Å²	96.7	49%	0.493	48%	0.478	S	S	.	.	H	α-helix	trans	-59.2	-48.9	178.6	-171	-175.4	-56.2	0	0	111.5	Q108 Q109 T114 T115 Q116	Q108-M112 PolarHBondContact O-N 3.07Å; Q109-M112 PolarHBondContact O-N 3.49Å; M112-T114 PolarHBondContact O-N 3.29Å; M112-T115 PolarHBondContact O-N 3.5Å; M112-Q116 WeakPolarHBondContact O-CG 3.41Å; M112-Q116 PolarHBondContact O-N 3.32Å
113	N	90.3	Very high	87.8	Confident	91 Å²	91	93.8 Å²	93.8	49%	0.487	47%	0.468	S	S	.	.	H	α-helix	trans	-60.7	-45.5	179.1	-68.3	-10.3	0	0	0	111.7	Q109 S110 I111 T115 Q116 F117	Q109-N113 PolarHBondContact NE2-OD1 3.43Å; Q109-N113 VanDerWaalsContact O-CG 3.27Å; Q109-N113 PolarHBondContact O-N 2.95Å; Q109-N113 PolarHBondContact O-OD1 3.44Å; S110-N113 PolarHBondContact O-N 3.39Å; I111-N113 PolarHBondContact O-N 2.98Å; N113-T115 VanDerWaalsContact C-N 3.3Å; N113-T115 PolarHBondContact O-N 3.43Å; N113-Q116 PolarHBondContact O-N 3.31Å; N113-F117 PolarHBondContact O-N 2.79Å
114	T	89.8	Confident	88.1	Confident	54 Å²	54	92.1 Å²	92.1	33%	0.331	46%	0.461	S	S	.	.	H	α-helix	trans	-60.1	-43	177.4	-56.4	0	0	0	0	111.1	S110 I111 M112 Q116 F117 L118	S110-T114 WeakPolarHBondContact O-CB 3.43Å; S110-T114 PolarHBondContact O-N 2.97Å; S110-T114 PolarHBondContact O-OG1 3.13Å; I111-T114 PolarHBondContact O-N 3.28Å; M112-T114 PolarHBondContact O-N 3.29Å; T114-Q116 PolarHBondContact O-N 3.19Å; T114-F117 PolarHBondContact O-N 3.37Å; T114-L118 HydrophobicContact CG2-CD1 4.11Å; T114-L118 WeakPolarHBondContact O-CG 3.3Å; T114-L118 PolarHBondContact O-N 2.74Å
115	T	89	Confident	88.3	Confident	52 Å²	52	91.5 Å²	91.5	32%	0.319	46%	0.46	S	S	.	.	H	α-helix	trans	-66.8	-38.4	-179.1	-47.5	0	0	0	0	111.6	I111 M112 N113 R119	I111-T115 WeakPolarHBondContact O-CB 3.2Å; I111-T115 PolarHBondContact O-N 2.94Å; I111-T115 PolarHBondContact O-OG1 2.87Å; M112-T115 PolarHBondContact O-N 3.5Å; N113-T115 VanDerWaalsContact C-N 3.3Å; N113-T115 PolarHBondContact O-N 3.43Å; T115-R119 VanDerWaalsContact CG2-CZ 3.48Å; T115-R119 WeakPolarHBondContact O-CG 3.47Å; T115-R119 PolarHBondContact O-N 3.47Å
116	Q	90.9	Very high	88.1	Confident	105 Å²	105	90.3 Å²	90.3	49%	0.491	46%	0.457	S	S	.	.	H	α-helix	trans	-66.1	-44	175	-65.6	-64.5	21.6	0	0	112.2	M112 N113 T114 L118 R119 Q120	M112-Q116 WeakPolarHBondContact O-CG 3.41Å; M112-Q116 PolarHBondContact O-N 3.32Å; N113-Q116 PolarHBondContact O-N 3.31Å; T114-Q116 PolarHBondContact O-N 3.19Å; Q116-L118 VanDerWaalsContact C-N 3.33Å; Q116-L118 PolarHBondContact O-N 3.04Å; Q116-R119 PolarHBondContact O-N 2.76Å; Q116-R119 VanDerWaalsContact OE1-NH2 3.17Å; Q116-Q120 PolarHBondContact O-N 3.14Å
117	F	93.5	Very high	87.8	Confident	116 Å²	116	91.9 Å²	91.9	51%	0.509	46%	0.461	S	S	.	.	H	α-helix	trans	-59.6	-43.5	177	178.4	-104	0	0	0	112.1	N113 T114 Q120 R121	N113-F117 PolarHBondContact O-N 2.79Å; T114-F117 PolarHBondContact O-N 3.37Å; F117-Q120 PolarHBondContact O-N 3.06Å; F117-R121 VanDerWaalsContact CE1-CD 3.42Å; F117-R121 HydrophobicContact CE1-CG 4.25Å; F117-R121 HydrophobicContact CE2-CG 4.49Å; F117-R121 HydrophobicContact CZ-CG 4.19Å; F117-R121 PolarHBondContact O-N 3.17Å
118	L	92.1	Very high	86.9	Confident	75 Å²	75	95.5 Å²	95.5	39%	0.393	48%	0.479	S	S	.	.	H	α-helix	trans	-65.3	-42.6	177	-69.4	172.9	0	0	0	112	T114 Q116 Q120 R121 V122	T114-L118 HydrophobicContact CG2-CD1 4.11Å; T114-L118 WeakPolarHBondContact O-CG 3.3Å; T114-L118 PolarHBondContact O-N 2.74Å; Q116-L118 VanDerWaalsContact C-N 3.33Å; Q116-L118 PolarHBondContact O-N 3.04Å; L118-Q120 VanDerWaalsContact C-N 3.31Å; L118-Q120 PolarHBondContact O-N 3.27Å; L118-R121 PolarHBondContact O-N 2.76Å; L118-V122 WeakPolarHBondContact O-CG2 3.38Å; L118-V122 PolarHBondContact O-N 3.09Å
119	R	90.7	Very high	85.8	Confident	127 Å²	127	96.6 Å²	96.6	48%	0.479	49%	0.489	S	S	.	.	H	α-helix	trans	-56.3	-46.5	174.1	-82.1	-171.2	-82.2	-98.5	1.5	111.6	T115 Q116 R121 V122 T123	T115-R119 VanDerWaalsContact CG2-CZ 3.48Å; T115-R119 WeakPolarHBondContact O-CG 3.47Å; T115-R119 PolarHBondContact O-N 3.47Å; Q116-R119 PolarHBondContact O-N 2.76Å; Q116-R119 VanDerWaalsContact OE1-NH2 3.17Å; R119-R121 PolarHBondContact O-N 2.89Å; R119-V122 PolarHBondContact O-N 3.5Å; R119-T123 PolarHBondContact O-N 3.48Å; R119-T123 PolarHBondContact O-OG1 2.97Å; R119-T123 VanDerWaalsContact O-OG1 3.12Å
120	Q	90.8	Very high	84.2	Confident	111 Å²	111	104.4 Å²	104.4	52%	0.519	52%	0.522	S	S	.	.	H	α-helix	trans	-59.1	-47.6	177.4	-179.8	173.9	1.2	0	0	111.9	Q116 F117 L118 V122 T123 E124	Q116-Q120 PolarHBondContact O-N 3.14Å; F117-Q120 PolarHBondContact O-N 3.06Å; L118-Q120 VanDerWaalsContact C-N 3.31Å; L118-Q120 PolarHBondContact O-N 3.27Å; Q120-V122 VanDerWaalsContact C-N 3.33Å; Q120-V122 PolarHBondContact O-N 2.94Å; Q120-T123 WeakPolarHBondContact O-CB 3.23Å; Q120-T123 PolarHBondContact O-N 2.95Å; Q120-T123 VanDerWaalsContact O-N 3.15Å; Q120-E124 HydrophobicContact CG-CG 4.45Å; Q120-E124 WeakPolarHBondContact CG-OE1 3.26Å; Q120-E124 PolarHBondContact NE2-OE1 2.7Å; Q120-E124 WeakPolarHBondContact O-CG 3.45Å; Q120-E124 PolarHBondContact O-N 3.3Å
121	R	90	Very high	83.9	Confident	148 Å²	148	106.3 Å²	106.3	56%	0.558	53%	0.525	S	S	*	.	H	α-helix	trans	-63.4	-36.6	178.7	-72.9	-170.3	66.3	178.4	1.4	113.5	F117 L118 R119 A125	F117-R121 VanDerWaalsContact CE1-CD 3.42Å; F117-R121 HydrophobicContact CE1-CG 4.25Å; F117-R121 HydrophobicContact CE2-CG 4.49Å; F117-R121 HydrophobicContact CZ-CG 4.19Å; F117-R121 PolarHBondContact O-N 3.17Å; L118-R121 PolarHBondContact O-N 2.76Å; R119-R121 PolarHBondContact O-N 2.89Å; R121-A125 VanDerWaalsContact O-CB 3.31Å; R121-A125 WeakPolarHBondContact O-CB 3.49Å; R121-A125 PolarHBondContact O-N 2.9Å
122	V	87.9	Confident	83.6	Confident	88 Å²	88	107.3 Å²	107.3	53%	0.533	53%	0.529	S	S	.	.	H	α-helix	trans	-65.1	-43	174.6	171.4	0	0	0	0	110	L118 R119 Q120 A125 M126	L118-V122 WeakPolarHBondContact O-CG2 3.38Å; L118-V122 PolarHBondContact O-N 3.09Å; R119-V122 PolarHBondContact O-N 3.5Å; Q120-V122 VanDerWaalsContact C-N 3.33Å; Q120-V122 PolarHBondContact O-N 2.94Å; V122-A125 PolarHBondContact O-N 3.27Å; V122-M126 HydrophobicContact CG1-CE 4.46Å; V122-M126 WeakPolarHBondContact O-CG 3.39Å; V122-M126 PolarHBondContact O-N 3.07Å
123	T	88.8	Confident	83.2	Confident	64 Å²	64	107.7 Å²	107.7	39%	0.393	53%	0.531	S	S	.	.	H	α-helix	trans	-61.5	-48.6	175.1	-59.3	0	0	0	0	112	R119 Q120 A125 M126 E127	R119-T123 PolarHBondContact O-N 3.48Å; R119-T123 PolarHBondContact O-OG1 2.97Å; R119-T123 VanDerWaalsContact O-OG1 3.12Å; Q120-T123 WeakPolarHBondContact O-CB 3.23Å; Q120-T123 PolarHBondContact O-N 2.95Å; Q120-T123 VanDerWaalsContact O-N 3.15Å; T123-A125 VanDerWaalsContact C-N 3.3Å; T123-A125 PolarHBondContact O-N 3.49Å; T123-M126 WeakPolarHBondContact O-CB 3.49Å; T123-M126 PolarHBondContact O-N 2.94Å; T123-E127 PolarHBondContact O-N 3.06Å
124	E	87.4	Confident	82.8	Confident	87 Å²	87	108.6 Å²	108.6	41%	0.407	53%	0.534	S	S	.	.	H	α-helix	trans	-59.2	-40.8	177.2	-71.6	169.5	-173.5	0	0	111.9	Q120 M126 E127 L128	Q120-E124 HydrophobicContact CG-CG 4.45Å; Q120-E124 WeakPolarHBondContact CG-OE1 3.26Å; Q120-E124 PolarHBondContact NE2-OE1 2.7Å; Q120-E124 WeakPolarHBondContact O-CG 3.45Å; Q120-E124 PolarHBondContact O-N 3.3Å; E124-M126 VanDerWaalsContact C-N 3.31Å; E124-M126 PolarHBondContact O-N 2.88Å; E124-E127 PolarHBondContact O-N 3.06Å; E124-L128 WeakPolarHBondContact O-CG 3.26Å; E124-L128 PolarHBondContact O-N 3.45Å; E124-L128 VanDerWaalsContact O-N 3.07Å
125	A	80.6	Confident	82.4	Confident	49 Å²	49	112.1 Å²	112.1	41%	0.405	55%	0.546	S	S	.	.	H	α-helix	trans	-67.8	-30	176.4	0	0	0	0	0	112.8	R121 V122 T123 N129	R121-A125 VanDerWaalsContact O-CB 3.31Å; R121-A125 WeakPolarHBondContact O-CB 3.49Å; R121-A125 PolarHBondContact O-N 2.9Å; V122-A125 PolarHBondContact O-N 3.27Å; T123-A125 VanDerWaalsContact C-N 3.3Å; T123-A125 PolarHBondContact O-N 3.49Å; A125-N129 PolarHBondContact O-ND2 2.93Å
126	M	79	Confident	81.9	Confident	105 Å²	105	116.1 Å²	116.1	52%	0.517	56%	0.562	S	S	.	*	H	α-helix	trans	-73.5	-42.6	173.1	-71.4	-169.3	-56.9	0	0	111.5	V122 T123 E124 L128 N129 F130	V122-M126 HydrophobicContact CG1-CE 4.46Å; V122-M126 WeakPolarHBondContact O-CG 3.39Å; V122-M126 PolarHBondContact O-N 3.07Å; T123-M126 WeakPolarHBondContact O-CB 3.49Å; T123-M126 PolarHBondContact O-N 2.94Å; E124-M126 VanDerWaalsContact C-N 3.31Å; E124-M126 PolarHBondContact O-N 2.88Å; M126-L128 VanDerWaalsContact C-N 3.3Å; M126-L128 PolarHBondContact O-N 3.04Å; M126-N129 PolarHBondContact O-N 3.47Å; M126-N129 VanDerWaalsContact O-N 3.14Å; M126-F130 WeakPolarHBondContact O-CD2 3.38Å
127	E	80	Confident	81.3	Confident	137 Å²	137	116.9 Å²	116.9	64%	0.64	57%	0.567	S	S	*	*	H	α-helix	trans	-63.5	-33.8	178.3	-71.6	-178.8	179.7	0	0	112.7	T123 E124 N129	T123-E127 PolarHBondContact O-N 3.06Å; E124-E127 PolarHBondContact O-N 3.06Å; E127-N129 VanDerWaalsContact C-N 3.25Å; E127-N129 PolarHBondContact O-N 3.05Å
128	L	67.9	Low	80.3	Confident	148 Å²	148	116.9 Å²	116.9	78%	0.775	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.1	-12	175.9	-75	166.2	0	0	0	114.5	E124 M126	E124-L128 WeakPolarHBondContact O-CG 3.26Å; E124-L128 PolarHBondContact O-N 3.45Å; E124-L128 VanDerWaalsContact O-N 3.07Å; M126-L128 VanDerWaalsContact C-N 3.3Å; M126-L128 PolarHBondContact O-N 3.04Å
129	N	57.6	Low	79.4	Confident	140 Å²	140	120.4 Å²	120.4	75%	0.749	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.8	4.9	-178.8	-78.2	-45.1	0	0	0	113.7	A125 M126 E127	A125-N129 PolarHBondContact O-ND2 2.93Å; M126-N129 PolarHBondContact O-N 3.47Å; M126-N129 VanDerWaalsContact O-N 3.14Å; E127-N129 VanDerWaalsContact C-N 3.25Å; E127-N129 PolarHBondContact O-N 3.05Å
130	F	51.6	Low	78.3	Confident	241 Å²	241	119.8 Å²	119.8	100%	1.057	60%	0.596	S	S	*	*			trans	-111.8	0	171.3	-70.9	-76.9	0	0	0	111.1	M126	M126-F130 WeakPolarHBondContact O-CD2 3.38Å

Retrieved 130 of 130 residues in 39 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).