A0A5K4FAI8_SCHMA Loading...

Outer kinetochore protein DAD4

AlphaFold DB , UniProt , Accession A0A5K4FAI8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 87 aa.

						>A0A5K4FAI8_SCHMA|A0A5K4FAI8
MSNPEAPGESKNDFYTTMFVQIEEMKSNLRKIEEKLFEISDDLFSMFLKNMERSNPKLLETAIDASSQFEIVRKICSEHHKVVSENK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.6	Very low	60.4	Low	241 Å²	241	126 Å²	126	100%	1.187	72%	0.724	S	S	*	*				0	116.1	0	-68.9	-175.6	176.6	0	0	106.5
2	S	55.6	Low	61.8	Low	122 Å²	122	124.4 Å²	124.4	85%	0.853	71%	0.711	S	S	*	*	P	Polyproline II helix	trans	-74.4	124.4	173.9	-44.6	0	0	0	0	107.4
3	N	59.5	Low	63.5	Low	148 Å²	148	122.9 Å²	122.9	79%	0.791	70%	0.7	S	S	*	*	P	Polyproline II helix	trans	-63.6	131	171.6	-87.8	-8.9	0	0	0	108.1	E5	N3-E5 PolarHBondContact O-N 3.36Å; N3-E5 VanDerWaalsContact O-N 3.15Å
4	P	59.7	Low	65.2	Low	119 Å²	119	122.9 Å²	122.9	77%	0.773	69%	0.688	S	S	*	*	P	Polyproline II helix	trans	-64.1	118.2	169.6	26.7	-29	0	0	0	107	A6	P4-A6 PolarHBondContact O-N 2.83Å
5	E	59.4	Low	66.8	Low	178 Å²	178	124.7 Å²	124.7	83%	0.832	68%	0.682	S	S	*	*	P	Polyproline II helix	trans	-50.8	128.4	172.5	-76.9	171.8	160.4	0	0	108.5	N3 P7	N3-E5 PolarHBondContact O-N 3.36Å; N3-E5 VanDerWaalsContact O-N 3.15Å; E5-P7 WeakPolarHBondContact O-CD 3.34Å
6	A	61	Low	68.5	Low	66 Å²	66	122.2 Å²	122.2	55%	0.545	67%	0.671	S	S	.	*	P	Polyproline II helix	trans	-59.1	124.2	-173	0	0	0	0	0	108.8	P4 G8 E9	P4-A6 PolarHBondContact O-N 2.83Å; A6-G8 PolarHBondContact O-N 3.46Å; A6-E9 PolarHBondContact O-N 3.47Å
7	P	58.5	Low	70	Confident	115 Å²	115	119.4 Å²	119.4	75%	0.747	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.4	12.6	-173.1	24.5	-33.4	0	0	0	115.1	E5	E5-P7 WeakPolarHBondContact O-CD 3.34Å
8	G	60.5	Low	71.4	Confident	40 Å²	40	116.8 Å²	116.8	41%	0.412	64%	0.642	S	S	.	*	T	Hydrogen-bonded Turn	trans	-95.6	-23.3	178.8	0	0	0	0	0	115	A6 N12	A6-G8 PolarHBondContact O-N 3.46Å; G8-N12 PolarHBondContact O-N 3.02Å
9	E	60.6	Low	72.6	Confident	136 Å²	136	117.5 Å²	117.5	64%	0.636	64%	0.638	S	S	*	*	H	α-helix	trans	-72.4	-43.6	-177.7	-72.5	-179.4	171.3	0	0	111.6	A6 K11 N12 D13	A6-E9 PolarHBondContact O-N 3.47Å; E9-K11 VanDerWaalsContact C-N 3.35Å; E9-K11 PolarHBondContact O-N 3.01Å; E9-N12 PolarHBondContact O-N 3.14Å; E9-D13 PolarHBondContact O-N 2.94Å
10	S	68.2	Low	73.8	Confident	85 Å²	85	115.1 Å²	115.1	59%	0.594	63%	0.627	S	S	*	*	H	α-helix	trans	-67.1	-29.5	-177.3	72.5	0	0	0	0	114.7	F14	S10-F14 WeakPolarHBondContact O-CB 2.89Å; S10-F14 PolarHBondContact O-N 3.01Å
11	K	71.7	Confident	74.9	Confident	136 Å²	136	114.1 Å²	114.1	59%	0.591	62%	0.618	S	S	*	*	H	α-helix	trans	-75.5	-39.3	174.7	-73.4	-173.9	179.1	-180	0	111.6	E9 F14 Y15	E9-K11 VanDerWaalsContact C-N 3.35Å; E9-K11 PolarHBondContact O-N 3.01Å; K11-F14 PolarHBondContact O-N 3.28Å; K11-Y15 HydrophobicContact CB-CE2 4.34Å; K11-Y15 WeakPolarHBondContact O-CD2 3.44Å; K11-Y15 PolarHBondContact O-N 2.96Å
12	N	77.4	Confident	77.2	Confident	107 Å²	107	106.2 Å²	106.2	57%	0.572	58%	0.58	S	S	*	*	H	α-helix	trans	-66.7	-39.1	177.5	-78.9	-12.1	0	0	0	111.4	G8 E9 F14 Y15 T16	G8-N12 PolarHBondContact O-N 3.02Å; E9-N12 PolarHBondContact O-N 3.14Å; N12-F14 VanDerWaalsContact C-N 3.34Å; N12-F14 PolarHBondContact O-N 3.41Å; N12-Y15 PolarHBondContact O-N 3.39Å; N12-T16 VanDerWaalsContact O-CB 3.25Å; N12-T16 WeakPolarHBondContact O-CB 3.46Å; N12-T16 PolarHBondContact O-N 3.27Å; N12-T16 PolarHBondContact O-OG1 2.88Å
13	D	83.7	Confident	79.2	Confident	105 Å²	105	103.7 Å²	103.7	56%	0.561	56%	0.555	S	S	*	*	H	α-helix	trans	-63.9	-40.4	174.4	-70.1	-16.8	0	0	0	111.8	E9 T17	E9-D13 PolarHBondContact O-N 2.94Å; D13-T17 WeakPolarHBondContact O-CB 3.45Å; D13-T17 PolarHBondContact O-N 3.48Å; D13-T17 PolarHBondContact O-OG1 2.75Å
14	F	86.7	Confident	81	Confident	123 Å²	123	102 Å²	102	54%	0.539	54%	0.543	S	S	.	.	H	α-helix	trans	-60.8	-52.7	175.2	177.8	-95.7	0	0	0	112	S10 K11 N12 T16 T17 M18	S10-F14 WeakPolarHBondContact O-CB 2.89Å; S10-F14 PolarHBondContact O-N 3.01Å; K11-F14 PolarHBondContact O-N 3.28Å; N12-F14 VanDerWaalsContact C-N 3.34Å; N12-F14 PolarHBondContact O-N 3.41Å; F14-T16 VanDerWaalsContact C-N 3.35Å; F14-T16 PolarHBondContact O-N 3.48Å; F14-T17 PolarHBondContact O-N 3.48Å; F14-M18 HydrophobicContact CD1-CG 4.3Å; F14-M18 HydrophobicContact CE1-CG 3.86Å; F14-M18 HydrophobicContact CE2-CG 4.25Å; F14-M18 HydrophobicContact CZ-CG 3.84Å; F14-M18 HydrophobicContact CZ-SD 4.26Å; F14-M18 WeakPolarHBondContact O-CG 3.37Å; F14-M18 PolarHBondContact O-N 3.42Å
15	Y	90.4	Very high	82.8	Confident	150 Å²	150	102.3 Å²	102.3	59%	0.588	54%	0.535	S	S	*	.	H	α-helix	trans	-66.3	-36.5	-179.7	-68.5	-58.3	0	0	0	112.7	K11 N12 M18 F19	K11-Y15 HydrophobicContact CB-CE2 4.34Å; K11-Y15 WeakPolarHBondContact O-CD2 3.44Å; K11-Y15 PolarHBondContact O-N 2.96Å; N12-Y15 PolarHBondContact O-N 3.39Å; Y15-M18 PolarHBondContact O-N 3.35Å; Y15-F19 WeakPolarHBondContact O-CB 3.47Å; Y15-F19 PolarHBondContact O-N 2.96Å
16	T	92.9	Very high	84.7	Confident	84 Å²	84	98.7 Å²	98.7	52%	0.515	52%	0.516	S	S	.	.	H	α-helix	trans	-62.9	-46.2	175.1	-58.7	0	0	0	0	110.6	N12 F14 M18 F19 V20	N12-T16 VanDerWaalsContact O-CB 3.25Å; N12-T16 WeakPolarHBondContact O-CB 3.46Å; N12-T16 PolarHBondContact O-N 3.27Å; N12-T16 PolarHBondContact O-OG1 2.88Å; F14-T16 VanDerWaalsContact C-N 3.35Å; F14-T16 PolarHBondContact O-N 3.48Å; T16-M18 PolarHBondContact O-N 3.47Å; T16-F19 PolarHBondContact O-N 3.24Å; T16-V20 WeakPolarHBondContact O-CG2 3.37Å; T16-V20 PolarHBondContact O-N 3.29Å
17	T	94.2	Very high	86.4	Confident	75 Å²	75	97.6 Å²	97.6	46%	0.46	51%	0.505	S	S	.	.	H	α-helix	trans	-60.8	-46.7	176.6	-57.6	0	0	0	0	111.2	D13 F14 F19 V20 Q21	D13-T17 WeakPolarHBondContact O-CB 3.45Å; D13-T17 PolarHBondContact O-N 3.48Å; D13-T17 PolarHBondContact O-OG1 2.75Å; F14-T17 PolarHBondContact O-N 3.48Å; T17-F19 VanDerWaalsContact C-N 3.32Å; T17-F19 PolarHBondContact O-N 3.25Å; T17-V20 PolarHBondContact O-N 2.88Å; T17-Q21 WeakPolarHBondContact O-CG 3.42Å; T17-Q21 PolarHBondContact O-N 3.37Å
18	M	95.2	Very high	88.3	Confident	72 Å²	72	96.3 Å²	96.3	36%	0.355	49%	0.492	S	S	.	.	H	α-helix	trans	-60.1	-41.6	176.6	-75	-58.9	-46.1	0	0	112.1	F14 Y15 T16 Q21 I22	F14-M18 HydrophobicContact CD1-CG 4.3Å; F14-M18 HydrophobicContact CE1-CG 3.86Å; F14-M18 HydrophobicContact CE2-CG 4.25Å; F14-M18 HydrophobicContact CZ-CG 3.84Å; F14-M18 HydrophobicContact CZ-SD 4.26Å; F14-M18 WeakPolarHBondContact O-CG 3.37Å; F14-M18 PolarHBondContact O-N 3.42Å; Y15-M18 PolarHBondContact O-N 3.35Å; T16-M18 PolarHBondContact O-N 3.47Å; M18-Q21 PolarHBondContact O-N 2.91Å; M18-I22 WeakPolarHBondContact O-CB 3.36Å; M18-I22 WeakPolarHBondContact O-CD1 3.34Å; M18-I22 VanDerWaalsContact O-CG1 3.24Å; M18-I22 WeakPolarHBondContact O-CG1 3.34Å; M18-I22 PolarHBondContact O-N 2.93Å
19	F	95.4	Very high	90.1	Very high	130 Å²	130	99.8 Å²	99.8	57%	0.57	50%	0.5	S	S	*	.	H	α-helix	trans	-63.8	-47.8	178.4	-179.6	-94.3	0	0	0	111.8	Y15 T16 T17 Q21 I22 E23	Y15-F19 WeakPolarHBondContact O-CB 3.47Å; Y15-F19 PolarHBondContact O-N 2.96Å; T16-F19 PolarHBondContact O-N 3.24Å; T17-F19 VanDerWaalsContact C-N 3.32Å; T17-F19 PolarHBondContact O-N 3.25Å; F19-Q21 VanDerWaalsContact C-N 3.33Å; F19-Q21 PolarHBondContact O-N 3Å; F19-I22 PolarHBondContact O-N 3.22Å; F19-E23 HydrophobicContact CD1-CG 4.34Å; F19-E23 HydrophobicContact CE1-CG 3.84Å; F19-E23 HydrophobicContact CE2-CG 4.34Å; F19-E23 HydrophobicContact CZ-CG 3.83Å; F19-E23 PolarHBondContact O-N 2.87Å
20	V	96	Very high	91.9	Very high	70 Å²	70	100.1 Å²	100.1	42%	0.424	50%	0.496	S	S	.	.	H	α-helix	trans	-58.6	-46.5	177.4	172.8	0	0	0	0	110.7	T16 T17 I22 E23 E24	T16-V20 WeakPolarHBondContact O-CG2 3.37Å; T16-V20 PolarHBondContact O-N 3.29Å; T17-V20 PolarHBondContact O-N 2.88Å; V20-I22 VanDerWaalsContact C-N 3.35Å; V20-I22 PolarHBondContact O-N 3.38Å; V20-E23 PolarHBondContact O-N 3.32Å; V20-E24 WeakPolarHBondContact O-CG 3.5Å; V20-E24 PolarHBondContact O-N 3.47Å
21	Q	96.8	Very high	93.3	Very high	94 Å²	94	101.4 Å²	101.4	44%	0.439	49%	0.491	S	S	.	.	H	α-helix	trans	-61.3	-41.1	177.7	-73.1	178.9	-17.5	0	0	112.5	T17 M18 F19 E23 E24 M25	T17-Q21 WeakPolarHBondContact O-CG 3.42Å; T17-Q21 PolarHBondContact O-N 3.37Å; M18-Q21 PolarHBondContact O-N 2.91Å; F19-Q21 VanDerWaalsContact C-N 3.33Å; F19-Q21 PolarHBondContact O-N 3Å; Q21-E23 PolarHBondContact O-N 3.03Å; Q21-E24 PolarHBondContact O-N 3.38Å; Q21-M25 WeakPolarHBondContact O-CB 3.5Å; Q21-M25 VanDerWaalsContact O-CG 3.27Å; Q21-M25 WeakPolarHBondContact O-CG 3.4Å; Q21-M25 PolarHBondContact O-N 2.96Å
22	I	97	Very high	94.4	Very high	75 Å²	75	99.4 Å²	99.4	39%	0.385	49%	0.485	S	S	.	.	H	α-helix	trans	-62.5	-42.8	176.3	-73.3	166	0	0	0	111.1	M18 F19 V20 M25 K26	M18-I22 WeakPolarHBondContact O-CB 3.36Å; M18-I22 WeakPolarHBondContact O-CD1 3.34Å; M18-I22 VanDerWaalsContact O-CG1 3.24Å; M18-I22 WeakPolarHBondContact O-CG1 3.34Å; M18-I22 PolarHBondContact O-N 2.93Å; F19-I22 PolarHBondContact O-N 3.22Å; V20-I22 VanDerWaalsContact C-N 3.35Å; V20-I22 PolarHBondContact O-N 3.38Å; I22-M25 PolarHBondContact O-N 3.45Å; I22-K26 HydrophobicContact CG2-CD 4.34Å; I22-K26 WeakPolarHBondContact O-CG 3.49Å; I22-K26 PolarHBondContact O-N 3.42Å
23	E	97.9	Very high	95.3	Very high	69 Å²	69	100.8 Å²	100.8	32%	0.322	49%	0.489	S	S	.	.	H	α-helix	trans	-68.4	-36.8	178.3	-69.2	-55	125.9	0	0	112.4	F19 V20 Q21 K26 S27	F19-E23 HydrophobicContact CD1-CG 4.34Å; F19-E23 HydrophobicContact CE1-CG 3.84Å; F19-E23 HydrophobicContact CE2-CG 4.34Å; F19-E23 HydrophobicContact CZ-CG 3.83Å; F19-E23 PolarHBondContact O-N 2.87Å; V20-E23 PolarHBondContact O-N 3.32Å; Q21-E23 PolarHBondContact O-N 3.03Å; E23-K26 PolarHBondContact O-N 3.24Å; E23-K26 WeakPolarHBondContact OE1-CD 3.48Å; E23-K26 IonicContact OE1-NZ 3.49Å; E23-K26 PolarHBondContact OE1-NZ 3.05Å; E23-S27 WeakPolarHBondContact O-CB 3.44Å; E23-S27 PolarHBondContact O-N 3.49Å
24	E	98.1	Very high	95.8	Very high	114 Å²	114	101.6 Å²	101.6	53%	0.533	49%	0.489	S	S	.	.	H	α-helix	trans	-62.9	-44	171.4	-74.3	-179.8	178.9	0	0	111.8	V20 Q21 K26 S27 N28	V20-E24 WeakPolarHBondContact O-CG 3.5Å; V20-E24 PolarHBondContact O-N 3.47Å; Q21-E24 PolarHBondContact O-N 3.38Å; E24-K26 PolarHBondContact O-N 2.94Å; E24-S27 WeakPolarHBondContact O-CB 3.41Å; E24-S27 PolarHBondContact O-N 3.38Å; E24-N28 PolarHBondContact O-N 3.24Å; E24-N28 PolarHBondContact O-ND2 3.15Å
25	M	97.8	Very high	96.3	Very high	124 Å²	124	102.2 Å²	102.2	61%	0.611	49%	0.491	S	S	*	.	H	α-helix	trans	-61	-44.2	175.6	-73.5	176.8	69.8	0	0	111.6	Q21 I22 S27 N28 L29	Q21-M25 WeakPolarHBondContact O-CB 3.5Å; Q21-M25 VanDerWaalsContact O-CG 3.27Å; Q21-M25 WeakPolarHBondContact O-CG 3.4Å; Q21-M25 PolarHBondContact O-N 2.96Å; I22-M25 PolarHBondContact O-N 3.45Å; M25-S27 VanDerWaalsContact C-N 3.33Å; M25-S27 PolarHBondContact O-N 3.06Å; M25-N28 PolarHBondContact O-N 2.89Å; M25-L29 WeakPolarHBondContact O-CG 3.34Å; M25-L29 PolarHBondContact O-N 3.23Å
26	K	97.7	Very high	96.3	Very high	102 Å²	102	100.2 Å²	100.2	44%	0.443	49%	0.49	S	S	.	.	H	α-helix	trans	-61.2	-40.8	174.5	-72.9	174	-175	170.4	0	112.1	I22 E23 E24 L29 R30	I22-K26 HydrophobicContact CG2-CD 4.34Å; I22-K26 WeakPolarHBondContact O-CG 3.49Å; I22-K26 PolarHBondContact O-N 3.42Å; E23-K26 PolarHBondContact O-N 3.24Å; E23-K26 WeakPolarHBondContact OE1-CD 3.48Å; E23-K26 IonicContact OE1-NZ 3.49Å; E23-K26 PolarHBondContact OE1-NZ 3.05Å; E24-K26 PolarHBondContact O-N 2.94Å; K26-L29 PolarHBondContact O-N 2.7Å; K26-R30 PolarHBondContact O-N 3.11Å; K26-R30 VanDerWaalsContact O-N 3.12Å
27	S	98	Very high	96.3	Very high	43 Å²	43	102.7 Å²	102.7	30%	0.301	49%	0.494	S	S	.	.	H	α-helix	trans	-61.5	-44.7	175.8	-173	0	0	0	0	111.7	E23 E24 M25 R30 K31	E23-S27 WeakPolarHBondContact O-CB 3.44Å; E23-S27 PolarHBondContact O-N 3.49Å; E24-S27 WeakPolarHBondContact O-CB 3.41Å; E24-S27 PolarHBondContact O-N 3.38Å; M25-S27 VanDerWaalsContact C-N 3.33Å; M25-S27 PolarHBondContact O-N 3.06Å; S27-R30 PolarHBondContact O-N 2.98Å; S27-K31 PolarHBondContact O-N 3.4Å; S27-K31 VanDerWaalsContact O-N 3.17Å
28	N	98.2	Very high	96.2	Very high	89 Å²	89	104.9 Å²	104.9	48%	0.476	50%	0.499	S	S	.	.	H	α-helix	trans	-66.1	-38.5	177.6	-70.1	-26.9	0	0	0	112.5	E24 M25 K31 I32	E24-N28 PolarHBondContact O-N 3.24Å; E24-N28 PolarHBondContact O-ND2 3.15Å; M25-N28 PolarHBondContact O-N 2.89Å; N28-K31 PolarHBondContact O-N 3.45Å; N28-I32 WeakPolarHBondContact O-CG1 3.31Å; N28-I32 PolarHBondContact O-N 2.89Å
29	L	98.1	Very high	96.1	Very high	113 Å²	113	105.9 Å²	105.9	59%	0.592	51%	0.505	S	S	*	.	H	α-helix	trans	-60.8	-43.5	174.6	-75.5	172.3	0	0	0	112	M25 K26 K31 I32 E33	M25-L29 WeakPolarHBondContact O-CG 3.34Å; M25-L29 PolarHBondContact O-N 3.23Å; K26-L29 PolarHBondContact O-N 2.7Å; L29-K31 PolarHBondContact O-N 2.96Å; L29-I32 PolarHBondContact O-N 3.42Å; L29-I32 VanDerWaalsContact O-N 3.17Å; L29-E33 PolarHBondContact O-N 3.38Å
30	R	97.5	Very high	95.9	Very high	142 Å²	142	103 Å²	103	54%	0.536	50%	0.501	S	S	.	.	H	α-helix	trans	-59.9	-42.9	175.1	-77.1	-174.4	-74.1	-152.2	-3.2	112.6	K26 S27 I32 E33 E34	K26-R30 PolarHBondContact O-N 3.11Å; K26-R30 VanDerWaalsContact O-N 3.12Å; S27-R30 PolarHBondContact O-N 2.98Å; R30-I32 VanDerWaalsContact C-N 3.29Å; R30-I32 PolarHBondContact O-N 2.9Å; R30-E33 WeakPolarHBondContact O-CB 3.37Å; R30-E33 PolarHBondContact O-N 2.95Å; R30-E34 WeakPolarHBondContact O-CG 3.36Å; R30-E34 PolarHBondContact O-N 2.96Å
31	K	97.6	Very high	95.6	Very high	112 Å²	112	103.1 Å²	103.1	49%	0.487	50%	0.499	S	S	.	.	H	α-helix	trans	-63.6	-34.3	176.1	-67.9	174.6	-175.4	173.5	0	112.9	S27 N28 L29 K35	S27-K31 PolarHBondContact O-N 3.4Å; S27-K31 VanDerWaalsContact O-N 3.17Å; N28-K31 PolarHBondContact O-N 3.45Å; L29-K31 PolarHBondContact O-N 2.96Å; K31-K35 WeakPolarHBondContact O-CG 3.4Å; K31-K35 PolarHBondContact O-N 3.15Å
32	I	96.2	Very high	95.4	Very high	94 Å²	94	104.2 Å²	104.2	48%	0.482	51%	0.508	S	S	.	.	H	α-helix	trans	-68.9	-43.6	175.1	-68.9	166.6	0	0	0	109.8	N28 L29 R30 K35 L36	N28-I32 WeakPolarHBondContact O-CG1 3.31Å; N28-I32 PolarHBondContact O-N 2.89Å; L29-I32 PolarHBondContact O-N 3.42Å; L29-I32 VanDerWaalsContact O-N 3.17Å; R30-I32 VanDerWaalsContact C-N 3.29Å; R30-I32 PolarHBondContact O-N 2.9Å; I32-K35 PolarHBondContact O-N 3.45Å; I32-L36 HydrophobicContact CG2-CD1 4Å; I32-L36 HydrophobicContact CG2-CG 4.35Å; I32-L36 WeakPolarHBondContact O-CG 3.44Å; I32-L36 PolarHBondContact O-N 3.32Å
33	E	95.4	Very high	95.2	Very high	137 Å²	137	105.4 Å²	105.4	64%	0.64	52%	0.515	S	S	*	.	H	α-helix	trans	-59.5	-47	176.4	-173.3	177	-169.5	0	0	111.9	L29 R30 K35 L36 F37	L29-E33 PolarHBondContact O-N 3.38Å; R30-E33 WeakPolarHBondContact O-CB 3.37Å; R30-E33 PolarHBondContact O-N 2.95Å; E33-K35 PolarHBondContact O-N 3.16Å; E33-L36 PolarHBondContact O-N 2.74Å; E33-F37 PolarHBondContact O-N 3.49Å
34	E	95.7	Very high	94.9	Very high	121 Å²	121	107.6 Å²	107.6	57%	0.565	52%	0.523	S	S	*	.	H	α-helix	trans	-56.3	-47.8	174.9	-72.9	167.3	-179	0	0	111.5	R30 L36 F37 E38	R30-E34 WeakPolarHBondContact O-CG 3.36Å; R30-E34 PolarHBondContact O-N 2.96Å; E34-L36 PolarHBondContact O-N 2.93Å; E34-F37 WeakPolarHBondContact O-CB 3.43Å; E34-F37 PolarHBondContact O-N 2.92Å; E34-E38 WeakPolarHBondContact O-CG 3.39Å; E34-E38 PolarHBondContact O-N 3.03Å
35	K	95.5	Very high	94.5	Very high	136 Å²	136	104.7 Å²	104.7	59%	0.591	52%	0.516	S	S	*	.	H	α-helix	trans	-65.2	-36.6	177.5	-75.8	-176.3	176.1	-170.8	0	113.5	K31 I32 E33 F37 E38 I39	K31-K35 WeakPolarHBondContact O-CG 3.4Å; K31-K35 PolarHBondContact O-N 3.15Å; I32-K35 PolarHBondContact O-N 3.45Å; E33-K35 PolarHBondContact O-N 3.16Å; K35-F37 VanDerWaalsContact C-N 3.28Å; K35-E38 PolarHBondContact O-N 3.21Å; K35-I39 VanDerWaalsContact O-CG1 3.27Å; K35-I39 WeakPolarHBondContact O-CG1 3.48Å; K35-I39 PolarHBondContact O-N 2.98Å
36	L	91.5	Very high	94.3	Very high	109 Å²	109	103.7 Å²	103.7	57%	0.571	51%	0.511	S	S	*	.	H	α-helix	trans	-65.1	-37.7	175.8	-75.8	172.6	0	0	0	110.9	I32 E33 E34 S40	I32-L36 HydrophobicContact CG2-CD1 4Å; I32-L36 HydrophobicContact CG2-CG 4.35Å; I32-L36 WeakPolarHBondContact O-CG 3.44Å; I32-L36 PolarHBondContact O-N 3.32Å; E33-L36 PolarHBondContact O-N 2.74Å; E34-L36 PolarHBondContact O-N 2.93Å; L36-S40 WeakPolarHBondContact O-CB 3.36Å; L36-S40 PolarHBondContact O-N 3.33Å
37	F	92.2	Very high	93.9	Very high	135 Å²	135	104 Å²	104	59%	0.592	51%	0.512	S	S	*	.	H	α-helix	trans	-63.7	-48.3	174.2	-166.6	-93.2	0	0	0	111.3	E33 E34 K35 I39 S40 D41	E33-F37 PolarHBondContact O-N 3.49Å; E34-F37 WeakPolarHBondContact O-CB 3.43Å; E34-F37 PolarHBondContact O-N 2.92Å; K35-F37 VanDerWaalsContact C-N 3.28Å; F37-I39 PolarHBondContact O-N 3.23Å; F37-S40 WeakPolarHBondContact O-CB 3.49Å; F37-S40 PolarHBondContact O-N 3.25Å; F37-S40 VanDerWaalsContact O-N 3.14Å; F37-D41 WeakPolarHBondContact CE1-OD2 3.44Å; F37-D41 PolarHBondContact O-N 3.38Å
38	E	92.2	Very high	93.5	Very high	121 Å²	121	104.5 Å²	104.5	57%	0.565	51%	0.511	S	S	*	.	H	α-helix	trans	-56.4	-47.1	175.7	-70.6	174.4	177	0	0	112.4	E34 K35 S40 D41 D42	E34-E38 WeakPolarHBondContact O-CG 3.39Å; E34-E38 PolarHBondContact O-N 3.03Å; K35-E38 PolarHBondContact O-N 3.21Å; E38-S40 VanDerWaalsContact C-N 3.32Å; E38-S40 PolarHBondContact O-N 2.84Å; E38-D41 PolarHBondContact O-N 2.84Å; E38-D42 PolarHBondContact O-N 2.88Å
39	I	92.3	Very high	93.1	Very high	93 Å²	93	106 Å²	106	48%	0.477	51%	0.514	S	S	.	.	H	α-helix	trans	-63.6	-39.9	178	-68.3	165.5	0	0	0	111.1	K35 F37 D42 L43	K35-I39 VanDerWaalsContact O-CG1 3.27Å; K35-I39 WeakPolarHBondContact O-CG1 3.48Å; K35-I39 PolarHBondContact O-N 2.98Å; F37-I39 PolarHBondContact O-N 3.23Å; I39-D42 PolarHBondContact O-N 3.11Å; I39-L43 HydrophobicContact CG2-CD1 3.96Å; I39-L43 HydrophobicContact CG2-CG 4.28Å; I39-L43 WeakPolarHBondContact O-CB 3.3Å; I39-L43 VanDerWaalsContact O-CG 3.29Å; I39-L43 WeakPolarHBondContact O-CG 3.41Å; I39-L43 PolarHBondContact O-N 2.86Å
40	S	92.2	Very high	92.7	Very high	69 Å²	69	104.3 Å²	104.3	48%	0.483	51%	0.505	S	S	.	.	H	α-helix	trans	-62	-44	177.2	-178.6	0	0	0	0	111.3	L36 F37 E38 L43 F44	L36-S40 WeakPolarHBondContact O-CB 3.36Å; L36-S40 PolarHBondContact O-N 3.33Å; F37-S40 WeakPolarHBondContact O-CB 3.49Å; F37-S40 PolarHBondContact O-N 3.25Å; F37-S40 VanDerWaalsContact O-N 3.14Å; E38-S40 VanDerWaalsContact C-N 3.32Å; E38-S40 PolarHBondContact O-N 2.84Å; S40-L43 PolarHBondContact O-N 2.82Å; S40-F44 VanDerWaalsContact O-CB 3.3Å; S40-F44 WeakPolarHBondContact O-CB 3.39Å; S40-F44 PolarHBondContact O-N 3.46Å
41	D	90.7	Very high	92.3	Very high	73 Å²	73	99.3 Å²	99.3	39%	0.39	49%	0.488	S	S	.	.	H	α-helix	trans	-64.1	-40.4	177.2	-78.3	-7.8	0	0	0	112.1	F37 E38 F44 S45	F37-D41 WeakPolarHBondContact CE1-OD2 3.44Å; F37-D41 PolarHBondContact O-N 3.38Å; E38-D41 PolarHBondContact O-N 2.84Å; D41-F44 PolarHBondContact O-N 3.17Å; D41-S45 VanDerWaalsContact O-CB 3.29Å; D41-S45 WeakPolarHBondContact O-CB 3.45Å; D41-S45 PolarHBondContact O-N 3.43Å; D41-S45 PolarHBondContact O-OG 3.39Å
42	D	92.6	Very high	92	Very high	118 Å²	118	99.4 Å²	99.4	63%	0.631	49%	0.491	S	S	*	.	H	α-helix	trans	-64.8	-45.5	175.7	-82.2	-16.3	0	0	0	112	E38 I39 S45 M46	E38-D42 PolarHBondContact O-N 2.88Å; I39-D42 PolarHBondContact O-N 3.11Å; D42-S45 PolarHBondContact O-N 3.46Å; D42-M46 WeakPolarHBondContact O-CB 3.47Å; D42-M46 PolarHBondContact O-N 3.06Å
43	L	92.2	Very high	91.7	Very high	99 Å²	99	104.3 Å²	104.3	52%	0.518	50%	0.503	S	S	.	.	H	α-helix	trans	-64	-42.1	177.1	-74.5	176.2	0	0	0	111.4	I39 S40 M46 F47	I39-L43 HydrophobicContact CG2-CD1 3.96Å; I39-L43 HydrophobicContact CG2-CG 4.28Å; I39-L43 WeakPolarHBondContact O-CB 3.3Å; I39-L43 VanDerWaalsContact O-CG 3.29Å; I39-L43 WeakPolarHBondContact O-CG 3.41Å; I39-L43 PolarHBondContact O-N 2.86Å; S40-L43 PolarHBondContact O-N 2.82Å; L43-M46 HydrophobicContact CD2-CE 3.9Å; L43-M46 PolarHBondContact O-N 3.48Å; L43-F47 WeakPolarHBondContact O-CB 3.44Å; L43-F47 PolarHBondContact O-N 3.23Å
44	F	90.8	Very high	91.6	Very high	115 Å²	115	101.9 Å²	101.9	50%	0.504	50%	0.501	S	S	.	.	H	α-helix	trans	-64.3	-42.8	176.3	-174.8	-109.8	0	0	0	111.4	S40 D41 M46 F47 L48	S40-F44 VanDerWaalsContact O-CB 3.3Å; S40-F44 WeakPolarHBondContact O-CB 3.39Å; S40-F44 PolarHBondContact O-N 3.46Å; D41-F44 PolarHBondContact O-N 3.17Å; F44-M46 VanDerWaalsContact C-N 3.33Å; F44-M46 PolarHBondContact O-N 3.3Å; F44-F47 HydrophobicContact CD2-CD1 4.42Å; F44-F47 HydrophobicContact CE2-CD1 4.37Å; F44-F47 WeakPolarHBondContact O-CB 3.31Å; F44-F47 PolarHBondContact O-N 3.15Å; F44-F47 VanDerWaalsContact O-N 3.17Å; F44-L48 HydrophobicContact CD1-CD1 4Å; F44-L48 HydrophobicContact CD1-CG 4.36Å; F44-L48 HydrophobicContact CE1-CD1 3.52Å; F44-L48 HydrophobicContact CE1-CD2 4.43Å; F44-L48 HydrophobicContact CE1-CG 4Å; F44-L48 HydrophobicContact CZ-CD1 4.01Å; F44-L48 HydrophobicContact CZ-CD2 4.07Å; F44-L48 HydrophobicContact CZ-CG 4.08Å; F44-L48 WeakPolarHBondContact O-CG 3.41Å; F44-L48 PolarHBondContact O-N 2.97Å
45	S	90.8	Very high	91.5	Very high	53 Å²	53	100.1 Å²	100.1	37%	0.371	50%	0.495	S	S	.	.	H	α-helix	trans	-61.3	-40.8	174.6	-64.6	0	0	0	0	112.2	D41 D42 L48 K49	D41-S45 VanDerWaalsContact O-CB 3.29Å; D41-S45 WeakPolarHBondContact O-CB 3.45Å; D41-S45 PolarHBondContact O-N 3.43Å; D41-S45 PolarHBondContact O-OG 3.39Å; D42-S45 PolarHBondContact O-N 3.46Å; S45-L48 PolarHBondContact O-N 3.24Å; S45-K49 WeakPolarHBondContact O-CG 3.39Å; S45-K49 PolarHBondContact O-N 3.4Å
46	M	92.3	Very high	91.2	Very high	103 Å²	103	97.2 Å²	97.2	51%	0.507	49%	0.49	S	S	.	.	H	α-helix	trans	-65.1	-41.5	174	-175.4	178.5	66.1	0	0	111.6	D42 L43 F44 K49 N50	D42-M46 WeakPolarHBondContact O-CB 3.47Å; D42-M46 PolarHBondContact O-N 3.06Å; L43-M46 HydrophobicContact CD2-CE 3.9Å; L43-M46 PolarHBondContact O-N 3.48Å; F44-M46 VanDerWaalsContact C-N 3.33Å; F44-M46 PolarHBondContact O-N 3.3Å; M46-K49 PolarHBondContact O-N 3.14Å; M46-N50 PolarHBondContact O-N 2.99Å; M46-N50 PolarHBondContact O-ND2 3.29Å
47	F	90.3	Very high	91.2	Very high	109 Å²	109	99.9 Å²	99.9	48%	0.478	50%	0.497	S	S	.	.	H	α-helix	trans	-59.4	-47.8	174.8	169.2	-98.6	0	0	0	111.6	L43 F44 K49 N50 M51	L43-F47 WeakPolarHBondContact O-CB 3.44Å; L43-F47 PolarHBondContact O-N 3.23Å; F44-F47 HydrophobicContact CD2-CD1 4.42Å; F44-F47 HydrophobicContact CE2-CD1 4.37Å; F44-F47 WeakPolarHBondContact O-CB 3.31Å; F44-F47 PolarHBondContact O-N 3.15Å; F44-F47 VanDerWaalsContact O-N 3.17Å; F47-K49 PolarHBondContact O-N 2.95Å; F47-N50 PolarHBondContact O-N 3.4Å; F47-N50 VanDerWaalsContact O-N 3.15Å; F47-M51 HydrophobicContact CD1-CG 4.29Å; F47-M51 HydrophobicContact CD2-CG 4.26Å; F47-M51 HydrophobicContact CE1-CG 3.79Å; F47-M51 HydrophobicContact CE2-CG 3.74Å; F47-M51 HydrophobicContact CE2-SD 4.11Å; F47-M51 HydrophobicContact CZ-CG 3.49Å; F47-M51 VanDerWaalsContact CZ-CG 3.49Å; F47-M51 HydrophobicContact CZ-SD 3.98Å; F47-M51 WeakPolarHBondContact O-CG 3.15Å; F47-M51 PolarHBondContact O-N 2.81Å
48	L	88.3	Confident	91.1	Very high	54 Å²	54	98.3 Å²	98.3	28%	0.283	50%	0.495	S	S	.	.	H	α-helix	trans	-59.4	-46.6	177.1	-70.9	-179.1	0	0	0	111.7	F44 S45 N50 M51 E52 L59	F44-L48 HydrophobicContact CD1-CD1 4Å; F44-L48 HydrophobicContact CD1-CG 4.36Å; F44-L48 HydrophobicContact CE1-CD1 3.52Å; F44-L48 HydrophobicContact CE1-CD2 4.43Å; F44-L48 HydrophobicContact CE1-CG 4Å; F44-L48 HydrophobicContact CZ-CD1 4.01Å; F44-L48 HydrophobicContact CZ-CD2 4.07Å; F44-L48 HydrophobicContact CZ-CG 4.08Å; F44-L48 WeakPolarHBondContact O-CG 3.41Å; F44-L48 PolarHBondContact O-N 2.97Å; S45-L48 PolarHBondContact O-N 3.24Å; L48-N50 VanDerWaalsContact C-N 3.27Å; L48-N50 PolarHBondContact O-N 3.29Å; L48-M51 WeakPolarHBondContact O-CB 3.29Å; L48-M51 PolarHBondContact O-N 2.87Å; L48-M51 VanDerWaalsContact O-N 3.11Å; L48-E52 WeakPolarHBondContact O-CG 3.34Å; L48-E52 PolarHBondContact O-N 2.97Å; L48-L59 HydrophobicContact CD2-CD1 3.99Å
49	K	90.5	Very high	91	Very high	121 Å²	121	93.8 Å²	93.8	53%	0.526	47%	0.474	S	S	.	.	H	α-helix	trans	-59.6	-36.6	175.7	-73.6	173.5	-177.8	172.1	0	112.8	S45 M46 F47 R53	S45-K49 WeakPolarHBondContact O-CG 3.39Å; S45-K49 PolarHBondContact O-N 3.4Å; M46-K49 PolarHBondContact O-N 3.14Å; F47-K49 PolarHBondContact O-N 2.95Å; K49-R53 VanDerWaalsContact O-CG 3.31Å; K49-R53 WeakPolarHBondContact O-CG 3.41Å; K49-R53 PolarHBondContact O-N 2.86Å
50	N	90	Very high	90.9	Very high	77 Å²	77	95.1 Å²	95.1	41%	0.412	48%	0.478	S	S	.	.	H	α-helix	trans	-70.6	-40.8	175.4	-74.6	-19.8	0	0	0	111.5	M46 F47 L48 R53 S54	M46-N50 PolarHBondContact O-N 2.99Å; M46-N50 PolarHBondContact O-ND2 3.29Å; F47-N50 PolarHBondContact O-N 3.4Å; F47-N50 VanDerWaalsContact O-N 3.15Å; L48-N50 VanDerWaalsContact C-N 3.27Å; L48-N50 PolarHBondContact O-N 3.29Å; N50-R53 PolarHBondContact O-N 3.33Å; N50-S54 WeakPolarHBondContact O-CB 3.47Å; N50-S54 PolarHBondContact O-N 2.89Å; N50-S54 PolarHBondContact O-OG 3.35Å
51	M	89.5	Confident	90.8	Very high	37 Å²	37	96 Å²	96	18%	0.182	48%	0.481	C	S	.	.	H	α-helix	trans	-63.2	-42.1	175.1	-74.7	-65.8	-68.7	0	0	112.3	F47 L48 R53 S54 N55 L58	F47-M51 HydrophobicContact CD1-CG 4.29Å; F47-M51 HydrophobicContact CD2-CG 4.26Å; F47-M51 HydrophobicContact CE1-CG 3.79Å; F47-M51 HydrophobicContact CE2-CG 3.74Å; F47-M51 HydrophobicContact CE2-SD 4.11Å; F47-M51 HydrophobicContact CZ-CG 3.49Å; F47-M51 VanDerWaalsContact CZ-CG 3.49Å; F47-M51 HydrophobicContact CZ-SD 3.98Å; F47-M51 WeakPolarHBondContact O-CG 3.15Å; F47-M51 PolarHBondContact O-N 2.81Å; L48-M51 WeakPolarHBondContact O-CB 3.29Å; L48-M51 PolarHBondContact O-N 2.87Å; L48-M51 VanDerWaalsContact O-N 3.11Å; M51-R53 PolarHBondContact O-N 3.48Å; M51-S54 PolarHBondContact O-N 2.88Å; M51-N55 HydrophobicContact CE-CB 4.48Å; M51-N55 CarbonylContact O-C 3.13Å; M51-N55 WeakPolarHBondContact O-CA 3.37Å; M51-N55 PolarHBondContact O-N 3.41Å; M51-L58 HydrophobicContact CE-CD2 3.9Å; M51-L58 HydrophobicContact CE-CG 4.22Å
52	E	90.4	Very high	90.5	Very high	114 Å²	114	95.2 Å²	95.2	53%	0.533	49%	0.485	S	S	.	.	H	α-helix	trans	-56.3	-39.8	173.6	-76.5	176.4	178.6	0	0	111.9	L48 P56 L59	L48-E52 WeakPolarHBondContact O-CG 3.34Å; L48-E52 PolarHBondContact O-N 2.97Å; E52-P56 WeakPolarHBondContact O-CB 3.37Å; E52-P56 WeakPolarHBondContact O-CD 3.43Å; E52-L59 HydrophobicContact CB-CD2 4.28Å; E52-L59 HydrophobicContact CG-CD2 3.25Å
53	R	91.5	Very high	90.3	Very high	197 Å²	197	94.1 Å²	94.1	74%	0.743	48%	0.478	S	S	*	.	H	α-helix	trans	-78.3	-45.3	-179.5	-70.2	171.6	-178.4	179.3	-0.3	112.8	K49 N50 M51	K49-R53 VanDerWaalsContact O-CG 3.31Å; K49-R53 WeakPolarHBondContact O-CG 3.41Å; K49-R53 PolarHBondContact O-N 2.86Å; N50-R53 PolarHBondContact O-N 3.33Å; M51-R53 PolarHBondContact O-N 3.48Å
54	S	92.6	Very high	90.3	Very high	85 Å²	85	93.5 Å²	93.5	59%	0.594	48%	0.475	S	S	*	.	H	α-helix	trans	-84.6	-38.3	-171.7	-62.3	0	0	0	0	112.7	N50 M51	N50-S54 WeakPolarHBondContact O-CB 3.47Å; N50-S54 PolarHBondContact O-N 2.89Å; N50-S54 PolarHBondContact O-OG 3.35Å; M51-S54 PolarHBondContact O-N 2.88Å
55	N	92.3	Very high	90.2	Very high	84 Å²	84	90.6 Å²	90.6	45%	0.449	47%	0.473	S	S	.	.			trans	-145.9	60.6	-172.3	-63.5	-69.8	0	0	0	112.2	M51 K57 L58 L59	M51-N55 HydrophobicContact CE-CB 4.48Å; M51-N55 CarbonylContact O-C 3.13Å; M51-N55 WeakPolarHBondContact O-CA 3.37Å; M51-N55 PolarHBondContact O-N 3.41Å; N55-K57 VanDerWaalsContact C-N 3.29Å; N55-K57 PolarHBondContact O-N 2.92Å; N55-L58 HydrophobicContact CB-CB 4.04Å; N55-L58 PolarHBondContact O-N 3.5Å; N55-L59 PolarHBondContact O-N 3.2Å
56	P	90.6	Very high	90.1	Very high	75 Å²	75	91.7 Å²	91.7	49%	0.487	48%	0.48	S	S	.	.	H	α-helix	trans	-57	-39.3	-174.1	19.4	-31.3	0	0	0	113.4	E52 L58 L59 E60	E52-P56 WeakPolarHBondContact O-CB 3.37Å; E52-P56 WeakPolarHBondContact O-CD 3.43Å; P56-L58 VanDerWaalsContact C-N 3.31Å; P56-L58 PolarHBondContact O-N 2.91Å; P56-L59 PolarHBondContact O-N 2.97Å; P56-E60 PolarHBondContact O-N 3.43Å
57	K	91.7	Very high	90.1	Very high	165 Å²	165	89.8 Å²	89.8	72%	0.717	48%	0.477	S	S	*	.	H	α-helix	trans	-62.8	-36.1	178	-69.4	-174.9	177.5	-177.5	0	113.2	N55 T61	N55-K57 VanDerWaalsContact C-N 3.29Å; N55-K57 PolarHBondContact O-N 2.92Å; K57-T61 WeakPolarHBondContact O-CB 3.33Å; K57-T61 PolarHBondContact O-N 3.31Å; K57-T61 PolarHBondContact O-OG1 3.43Å
58	L	89.7	Confident	90	Very high	102 Å²	102	90.9 Å²	90.9	53%	0.534	48%	0.483	S	S	.	.	H	α-helix	trans	-70.4	-38.7	178.8	-178.7	59.4	0	0	0	110.4	M51 N55 P56 T61 A62	M51-L58 HydrophobicContact CE-CD2 3.9Å; M51-L58 HydrophobicContact CE-CG 4.22Å; N55-L58 HydrophobicContact CB-CB 4.04Å; N55-L58 PolarHBondContact O-N 3.5Å; P56-L58 VanDerWaalsContact C-N 3.31Å; P56-L58 PolarHBondContact O-N 2.91Å; L58-T61 PolarHBondContact O-N 3.45Å; L58-A62 WeakPolarHBondContact O-CB 3.27Å; L58-A62 PolarHBondContact O-N 2.9Å
59	L	89.4	Confident	90.1	Very high	26 Å²	26	94.9 Å²	94.9	14%	0.136	50%	0.499	C	S	.	.	H	α-helix	trans	-65.1	-45.8	174.4	-178.4	63.9	0	0	0	111.8	L48 E52 N55 P56 T61 A62 I63	L48-L59 HydrophobicContact CD2-CD1 3.99Å; E52-L59 HydrophobicContact CB-CD2 4.28Å; E52-L59 HydrophobicContact CG-CD2 3.25Å; N55-L59 PolarHBondContact O-N 3.2Å; P56-L59 PolarHBondContact O-N 2.97Å; L59-T61 VanDerWaalsContact C-N 3.34Å; L59-T61 PolarHBondContact O-N 3.42Å; L59-A62 WeakPolarHBondContact O-CB 3.48Å; L59-A62 PolarHBondContact O-N 3Å; L59-A62 VanDerWaalsContact O-N 3.15Å; L59-I63 HydrophobicContact CD1-CD1 4.33Å; L59-I63 HydrophobicContact CG-CD1 4.02Å; L59-I63 WeakPolarHBondContact O-CG1 3.29Å; L59-I63 PolarHBondContact O-N 2.99Å
60	E	89.8	Confident	90.1	Very high	121 Å²	121	93 Å²	93	57%	0.565	49%	0.492	S	S	*	.	H	α-helix	trans	-57.3	-47.1	174.9	-174.5	177.5	-161.4	0	0	111.3	P56 A62 I63 D64	P56-E60 PolarHBondContact O-N 3.43Å; E60-A62 VanDerWaalsContact C-N 3.29Å; E60-A62 PolarHBondContact O-N 3.21Å; E60-I63 PolarHBondContact O-N 3.18Å; E60-I63 VanDerWaalsContact O-N 3.16Å; E60-D64 PolarHBondContact O-N 2.71Å
61	T	90.2	Very high	90.2	Very high	88 Å²	88	94.2 Å²	94.2	54%	0.54	50%	0.497	S	S	.	.	H	α-helix	trans	-59.7	-39.5	176.1	-55.3	0	0	0	0	111.9	K57 L58 L59 A65	K57-T61 WeakPolarHBondContact O-CB 3.33Å; K57-T61 PolarHBondContact O-N 3.31Å; K57-T61 PolarHBondContact O-OG1 3.43Å; L58-T61 PolarHBondContact O-N 3.45Å; L59-T61 VanDerWaalsContact C-N 3.34Å; L59-T61 PolarHBondContact O-N 3.42Å; T61-A65 VanDerWaalsContact O-CB 3.31Å; T61-A65 WeakPolarHBondContact O-CB 3.49Å; T61-A65 PolarHBondContact O-N 3.21Å
62	A	86.1	Confident	90.2	Very high	57 Å²	57	96.4 Å²	96.4	47%	0.471	51%	0.512	S	S	.	.	H	α-helix	trans	-67.9	-39.9	177.6	0	0	0	0	0	112.2	L58 L59 E60 S66	L58-A62 WeakPolarHBondContact O-CB 3.27Å; L58-A62 PolarHBondContact O-N 2.9Å; L59-A62 WeakPolarHBondContact O-CB 3.48Å; L59-A62 PolarHBondContact O-N 3Å; L59-A62 VanDerWaalsContact O-N 3.15Å; E60-A62 VanDerWaalsContact C-N 3.29Å; E60-A62 PolarHBondContact O-N 3.21Å; A62-S66 WeakPolarHBondContact O-CB 3.35Å; A62-S66 PolarHBondContact O-N 2.92Å
63	I	88.3	Confident	90.3	Very high	95 Å²	95	98 Å²	98	49%	0.487	51%	0.513	S	S	.	.	H	α-helix	trans	-64.3	-44.3	175.8	-69	167.6	0	0	0	110.6	L59 E60 S66 S67	L59-I63 HydrophobicContact CD1-CD1 4.33Å; L59-I63 HydrophobicContact CG-CD1 4.02Å; L59-I63 WeakPolarHBondContact O-CG1 3.29Å; L59-I63 PolarHBondContact O-N 2.99Å; E60-I63 PolarHBondContact O-N 3.18Å; E60-I63 VanDerWaalsContact O-N 3.16Å; I63-S66 PolarHBondContact O-N 3.45Å; I63-S67 WeakPolarHBondContact O-CB 3.38Å; I63-S67 PolarHBondContact O-N 3.41Å; I63-S67 PolarHBondContact O-OG 3.39Å
64	D	91.9	Very high	90.4	Very high	86 Å²	86	95.1 Å²	95.1	46%	0.46	51%	0.507	S	S	.	.	H	α-helix	trans	-63.3	-46.7	177.5	-77.9	-12.9	0	0	0	111.5	E60 S66 S67 Q68	E60-D64 PolarHBondContact O-N 2.71Å; D64-S66 VanDerWaalsContact C-N 3.32Å; D64-S66 PolarHBondContact O-N 3.12Å; D64-S67 PolarHBondContact O-N 3.48Å; D64-Q68 WeakPolarHBondContact O-CG 3.41Å; D64-Q68 PolarHBondContact O-N 2.95Å
65	A	88.3	Confident	90.5	Very high	54 Å²	54	96 Å²	96	45%	0.446	50%	0.503	S	S	.	.	H	α-helix	trans	-60.8	-41.3	177.4	0	0	0	0	0	112	T61 Q68 F69	T61-A65 VanDerWaalsContact O-CB 3.31Å; T61-A65 WeakPolarHBondContact O-CB 3.49Å; T61-A65 PolarHBondContact O-N 3.21Å; A65-Q68 PolarHBondContact O-N 3.34Å; A65-F69 WeakPolarHBondContact O-CB 3.43Å; A65-F69 PolarHBondContact O-N 3.44Å
66	S	88	Confident	90.6	Very high	76 Å²	76	95.6 Å²	95.6	53%	0.531	51%	0.506	S	S	.	.	H	α-helix	trans	-61.6	-45.5	175.3	-174	0	0	0	0	111.6	A62 I63 D64 Q68 F69 E70	A62-S66 WeakPolarHBondContact O-CB 3.35Å; A62-S66 PolarHBondContact O-N 2.92Å; I63-S66 PolarHBondContact O-N 3.45Å; D64-S66 VanDerWaalsContact C-N 3.32Å; D64-S66 PolarHBondContact O-N 3.12Å; S66-Q68 PolarHBondContact O-N 2.94Å; S66-F69 PolarHBondContact O-N 2.93Å; S66-E70 PolarHBondContact O-N 3.04Å
67	S	92.1	Very high	90.7	Very high	62 Å²	62	95.8 Å²	95.8	43%	0.434	51%	0.509	S	S	.	.	H	α-helix	trans	-62.9	-41.4	177.9	-58	0	0	0	0	112	I63 D64 E70 I71	I63-S67 WeakPolarHBondContact O-CB 3.38Å; I63-S67 PolarHBondContact O-N 3.41Å; I63-S67 PolarHBondContact O-OG 3.39Å; D64-S67 PolarHBondContact O-N 3.48Å; S67-E70 PolarHBondContact O-N 3.29Å; S67-I71 WeakPolarHBondContact O-CG1 3.34Å; S67-I71 PolarHBondContact O-N 3.17Å; S67-I71 VanDerWaalsContact O-N 3.15Å
68	Q	89.9	Confident	90.9	Very high	132 Å²	132	93.1 Å²	93.1	62%	0.617	50%	0.499	S	S	*	.	H	α-helix	trans	-64.4	-41.6	175.1	-71.9	-178.3	9.5	0	0	112.1	D64 A65 S66 E70 I71 V72	D64-Q68 WeakPolarHBondContact O-CG 3.41Å; D64-Q68 PolarHBondContact O-N 2.95Å; A65-Q68 PolarHBondContact O-N 3.34Å; S66-Q68 PolarHBondContact O-N 2.94Å; Q68-E70 VanDerWaalsContact C-N 3.31Å; Q68-E70 PolarHBondContact O-N 3.17Å; Q68-I71 PolarHBondContact O-N 3.37Å; Q68-V72 WeakPolarHBondContact O-CG2 3.49Å; Q68-V72 PolarHBondContact O-N 3.2Å
69	F	90.3	Very high	91.1	Very high	139 Å²	139	94.3 Å²	94.3	61%	0.61	50%	0.502	S	S	*	.	H	α-helix	trans	-60.2	-41.3	176.3	-175.2	-97.6	0	0	0	111.8	A65 S66 V72 R73	A65-F69 WeakPolarHBondContact O-CB 3.43Å; A65-F69 PolarHBondContact O-N 3.44Å; S66-F69 PolarHBondContact O-N 2.93Å; F69-V72 PolarHBondContact O-N 3.41Å; F69-R73 WeakPolarHBondContact O-CB 3.24Å; F69-R73 PolarHBondContact O-N 3.25Å
70	E	90.4	Very high	91.3	Very high	81 Å²	81	99.2 Å²	99.2	38%	0.379	52%	0.524	S	S	.	.	H	α-helix	trans	-63.7	-39.7	175.9	-79.2	-60.3	150	0	0	113.1	S66 S67 Q68 R73 K74	S66-E70 PolarHBondContact O-N 3.04Å; S67-E70 PolarHBondContact O-N 3.29Å; Q68-E70 VanDerWaalsContact C-N 3.31Å; Q68-E70 PolarHBondContact O-N 3.17Å; E70-R73 VanDerWaalsContact CD-NH2 3.29Å; E70-R73 PolarHBondContact O-N 2.87Å; E70-R73 IonicContact OE1-CZ 3.21Å; E70-R73 IonicContact OE1-NE 3.05Å; E70-R73 PolarHBondContact OE1-NE 2.97Å; E70-R73 IonicContact OE1-NH2 2.7Å; E70-R73 PolarHBondContact OE1-NH2 3.22Å; E70-R73 VanDerWaalsContact OE1-NH2 3.11Å; E70-R73 IonicContact OE2-CZ 3.99Å; E70-R73 IonicContact OE2-NE 3.11Å; E70-R73 PolarHBondContact OE2-NE 3.5Å; E70-R73 IonicContact OE2-NH2 3.32Å; E70-R73 PolarHBondContact OE2-NH2 3.01Å; E70-K74 WeakPolarHBondContact O-CB 3.48Å; E70-K74 PolarHBondContact O-N 3.36Å
71	I	90.8	Very high	91.6	Very high	103 Å²	103	99.7 Å²	99.7	53%	0.528	52%	0.524	S	S	.	.	H	α-helix	trans	-60.7	-49	174	-67.7	166.4	0	0	0	110.3	S67 Q68 R73 K74 I75	S67-I71 WeakPolarHBondContact O-CG1 3.34Å; S67-I71 PolarHBondContact O-N 3.17Å; S67-I71 VanDerWaalsContact O-N 3.15Å; Q68-I71 PolarHBondContact O-N 3.37Å; I71-R73 VanDerWaalsContact C-N 3.33Å; I71-R73 PolarHBondContact O-N 3.48Å; I71-K74 PolarHBondContact O-N 3.42Å; I71-I75 HydrophobicContact CG2-CD1 3.88Å; I71-I75 WeakPolarHBondContact O-CG1 3.27Å; I71-I75 PolarHBondContact O-N 3.38Å
72	V	88.9	Confident	91.8	Very high	82 Å²	82	99.2 Å²	99.2	50%	0.497	52%	0.521	S	S	.	.	H	α-helix	trans	-61.2	-43.9	178.8	173.9	0	0	0	0	110.8	Q68 F69 K74 I75 C76	Q68-V72 WeakPolarHBondContact O-CG2 3.49Å; Q68-V72 PolarHBondContact O-N 3.2Å; F69-V72 PolarHBondContact O-N 3.41Å; V72-K74 VanDerWaalsContact C-N 3.31Å; V72-K74 PolarHBondContact O-N 3.22Å; V72-I75 PolarHBondContact O-N 2.93Å; V72-C76 WeakPolarHBondContact O-CB 3.48Å; V72-C76 PolarHBondContact O-N 2.92Å; V72-C76 PolarHBondContact O-SG 2.72Å; V72-C76 VanDerWaalsContact O-SG 3.35Å
73	R	92.8	Very high	92.2	Very high	147 Å²	147	99.5 Å²	99.5	56%	0.555	52%	0.517	S	S	*	.	H	α-helix	trans	-58	-43.6	176.8	-170.8	178	72.5	152.3	-3	111.6	F69 E70 I71 C76 S77	F69-R73 WeakPolarHBondContact O-CB 3.24Å; F69-R73 PolarHBondContact O-N 3.25Å; E70-R73 VanDerWaalsContact CD-NH2 3.29Å; E70-R73 PolarHBondContact O-N 2.87Å; E70-R73 IonicContact OE1-CZ 3.21Å; E70-R73 IonicContact OE1-NE 3.05Å; E70-R73 PolarHBondContact OE1-NE 2.97Å; E70-R73 IonicContact OE1-NH2 2.7Å; E70-R73 PolarHBondContact OE1-NH2 3.22Å; E70-R73 VanDerWaalsContact OE1-NH2 3.11Å; E70-R73 IonicContact OE2-CZ 3.99Å; E70-R73 IonicContact OE2-NE 3.11Å; E70-R73 PolarHBondContact OE2-NE 3.5Å; E70-R73 IonicContact OE2-NH2 3.32Å; E70-R73 PolarHBondContact OE2-NH2 3.01Å; I71-R73 VanDerWaalsContact C-N 3.33Å; I71-R73 PolarHBondContact O-N 3.48Å; R73-C76 PolarHBondContact O-N 3.28Å; R73-S77 WeakPolarHBondContact O-CB 3.45Å; R73-S77 PolarHBondContact O-N 3.2Å
74	K	94	Very high	92.4	Very high	138 Å²	138	97.8 Å²	97.8	60%	0.6	51%	0.513	S	S	*	.	H	α-helix	trans	-63	-46.6	177.2	-171.6	178.8	177.5	-175.6	0	111.8	E70 I71 V72 C76 S77 E78	E70-K74 WeakPolarHBondContact O-CB 3.48Å; E70-K74 PolarHBondContact O-N 3.36Å; I71-K74 PolarHBondContact O-N 3.42Å; V72-K74 VanDerWaalsContact C-N 3.31Å; V72-K74 PolarHBondContact O-N 3.22Å; K74-C76 PolarHBondContact O-N 2.91Å; K74-S77 PolarHBondContact O-N 3.4Å; K74-E78 WeakPolarHBondContact CE-OE1 3.4Å; K74-E78 PolarHBondContact O-N 2.9Å
75	I	94	Very high	92.5	Very high	103 Å²	103	99.9 Å²	99.9	53%	0.528	52%	0.52	S	S	.	.	H	α-helix	trans	-59.4	-47.7	177.4	-67.5	166.9	0	0	0	110.7	I71 V72 S77 E78 H79	I71-I75 HydrophobicContact CG2-CD1 3.88Å; I71-I75 WeakPolarHBondContact O-CG1 3.27Å; I71-I75 PolarHBondContact O-N 3.38Å; V72-I75 PolarHBondContact O-N 2.93Å; I75-S77 VanDerWaalsContact C-N 3.32Å; I75-S77 PolarHBondContact O-N 3.43Å; I75-E78 PolarHBondContact O-N 3.37Å; I75-H79 WeakPolarHBondContact O-CB 3.44Å; I75-H79 PolarHBondContact O-N 3.46Å
76	C	94.3	Very high	92.1	Very high	76 Å²	76	103.5 Å²	103.5	51%	0.514	53%	0.532	S	S	.	.	H	α-helix	trans	-62.3	-39	178.4	-71	0	0	0	0	112.2	V72 R73 K74 H79 H80	V72-C76 WeakPolarHBondContact O-CB 3.48Å; V72-C76 PolarHBondContact O-N 2.92Å; V72-C76 PolarHBondContact O-SG 2.72Å; V72-C76 VanDerWaalsContact O-SG 3.35Å; R73-C76 PolarHBondContact O-N 3.28Å; K74-C76 PolarHBondContact O-N 2.91Å; C76-H79 PolarHBondContact O-N 3.46Å; C76-H80 WeakPolarHBondContact O-CB 3.25Å; C76-H80 PolarHBondContact O-N 3.5Å
77	S	94.4	Very high	91.1	Very high	78 Å²	78	110.9 Å²	110.9	55%	0.545	56%	0.555	S	S	.	*	H	α-helix	trans	-65.3	-46.7	176.5	-174	0	0	0	0	112.1	R73 K74 I75 H79 H80 K81	R73-S77 WeakPolarHBondContact O-CB 3.45Å; R73-S77 PolarHBondContact O-N 3.2Å; K74-S77 PolarHBondContact O-N 3.4Å; I75-S77 VanDerWaalsContact C-N 3.32Å; I75-S77 PolarHBondContact O-N 3.43Å; S77-H79 VanDerWaalsContact C-N 3.34Å; S77-H79 PolarHBondContact O-N 3.02Å; S77-H80 PolarHBondContact O-N 3.35Å; S77-K81 PolarHBondContact O-N 3.41Å
78	E	95.4	Very high	91	Very high	109 Å²	109	113.4 Å²	113.4	51%	0.509	56%	0.561	S	S	.	*	H	α-helix	trans	-61.6	-43.3	174.9	-75.3	179.8	172.3	0	0	111.4	K74 I75 H80 K81 V82	K74-E78 WeakPolarHBondContact CE-OE1 3.4Å; K74-E78 PolarHBondContact O-N 2.9Å; I75-E78 PolarHBondContact O-N 3.37Å; E78-H80 PolarHBondContact O-N 3.48Å; E78-K81 WeakPolarHBondContact O-CB 3.39Å; E78-K81 PolarHBondContact O-N 2.93Å; E78-V82 WeakPolarHBondContact O-CG2 3.04Å; E78-V82 PolarHBondContact O-N 2.92Å
79	H	93.9	Very high	91.1	Very high	127 Å²	127	112.4 Å²	112.4	59%	0.588	56%	0.558	S	S	*	*	H	α-helix	trans	-60.8	-45.6	175.6	-174.1	69.5	0	0	0	111.8	I75 C76 S77 K81 V82 V83	I75-H79 WeakPolarHBondContact O-CB 3.44Å; I75-H79 PolarHBondContact O-N 3.46Å; C76-H79 PolarHBondContact O-N 3.46Å; S77-H79 VanDerWaalsContact C-N 3.34Å; S77-H79 PolarHBondContact O-N 3.02Å; H79-K81 VanDerWaalsContact C-N 3.3Å; H79-K81 PolarHBondContact O-N 3.01Å; H79-V82 PolarHBondContact O-N 2.98Å; H79-V83 WeakPolarHBondContact O-CG2 3.36Å; H79-V83 PolarHBondContact O-N 2.98Å
80	H	93.6	Very high	91.1	Very high	130 Å²	130	110.9 Å²	110.9	60%	0.602	56%	0.555	S	S	*	*	H	α-helix	trans	-60.2	-40.3	177	-176.6	68.2	0	0	0	112.2	C76 S77 E78 S84	C76-H80 WeakPolarHBondContact O-CB 3.25Å; C76-H80 PolarHBondContact O-N 3.5Å; S77-H80 PolarHBondContact O-N 3.35Å; E78-H80 PolarHBondContact O-N 3.48Å; H80-S84 WeakPolarHBondContact O-CB 3.37Å; H80-S84 PolarHBondContact O-N 3.38Å; H80-S84 PolarHBondContact O-OG 3.22Å
81	K	95.4	Very high	91.1	Very high	130 Å²	130	112.6 Å²	112.6	57%	0.565	57%	0.565	S	S	*	*	H	α-helix	trans	-60.2	-51.6	174.7	-176.9	-179.7	173.9	-177.1	0	111.4	S77 E78 H79 V83 S84 E85	S77-K81 PolarHBondContact O-N 3.41Å; E78-K81 WeakPolarHBondContact O-CB 3.39Å; E78-K81 PolarHBondContact O-N 2.93Å; H79-K81 VanDerWaalsContact C-N 3.3Å; H79-K81 PolarHBondContact O-N 3.01Å; K81-V83 VanDerWaalsContact C-N 3.35Å; K81-V83 PolarHBondContact O-N 3.37Å; K81-S84 PolarHBondContact O-N 3.32Å; K81-S84 VanDerWaalsContact O-N 3.14Å; K81-E85 WeakPolarHBondContact CE-OE1 3.46Å; K81-E85 WeakPolarHBondContact CG-OE1 3.49Å; K81-E85 IonicContact NZ-OE1 2.71Å; K81-E85 WeakPolarHBondContact O-CG 3.32Å; K81-E85 PolarHBondContact O-N 2.75Å
82	V	95.2	Very high	91.2	Very high	79 Å²	79	113.3 Å²	113.3	48%	0.479	57%	0.568	S	S	.	*	H	α-helix	trans	-61.3	-41.5	179.6	173.3	0	0	0	0	112	E78 H79 S84 E85 N86	E78-V82 WeakPolarHBondContact O-CG2 3.04Å; E78-V82 PolarHBondContact O-N 2.92Å; H79-V82 PolarHBondContact O-N 2.98Å; V82-S84 VanDerWaalsContact C-N 3.3Å; V82-S84 PolarHBondContact O-N 2.74Å; V82-E85 PolarHBondContact O-N 3.3Å; V82-N86 PolarHBondContact O-N 3.26Å; V82-N86 PolarHBondContact O-ND2 3.15Å
83	V	94.5	Very high	91.3	Very high	62 Å²	62	115.3 Å²	115.3	38%	0.376	57%	0.572	S	S	.	*	H	α-helix	trans	-65.6	-35.4	177.4	170.6	0	0	0	0	111.5	H79 K81	H79-V83 WeakPolarHBondContact O-CG2 3.36Å; H79-V83 PolarHBondContact O-N 2.98Å; K81-V83 VanDerWaalsContact C-N 3.35Å; K81-V83 PolarHBondContact O-N 3.37Å
84	S	93.3	Very high	91.2	Very high	59 Å²	59	113.1 Å²	113.1	41%	0.413	57%	0.574	S	S	.	*	H	α-helix	trans	-73.9	-34	179.7	-57.8	0	0	0	0	112.6	H80 K81 V82 N86	H80-S84 WeakPolarHBondContact O-CB 3.37Å; H80-S84 PolarHBondContact O-N 3.38Å; H80-S84 PolarHBondContact O-OG 3.22Å; K81-S84 PolarHBondContact O-N 3.32Å; K81-S84 VanDerWaalsContact O-N 3.14Å; V82-S84 VanDerWaalsContact C-N 3.3Å; V82-S84 PolarHBondContact O-N 2.74Å; S84-N86 VanDerWaalsContact C-N 3.32Å
85	E	92.7	Very high	91	Very high	130 Å²	130	111.2 Å²	111.2	61%	0.607	57%	0.572	S	S	*	*	H	α-helix	trans	-75.1	-17.8	178.5	-71.8	172.6	179.3	0	0	113.6	K81 V82	K81-E85 WeakPolarHBondContact CE-OE1 3.46Å; K81-E85 WeakPolarHBondContact CG-OE1 3.49Å; K81-E85 IonicContact NZ-OE1 2.71Å; K81-E85 WeakPolarHBondContact O-CG 3.32Å; K81-E85 PolarHBondContact O-N 2.75Å; V82-E85 PolarHBondContact O-N 3.3Å
86	N	81.2	Confident	90.7	Very high	131 Å²	131	111.8 Å²	111.8	70%	0.701	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.6	10.1	-179.9	-73.8	-58.2	0	0	0	114.1	V82 S84	V82-N86 PolarHBondContact O-N 3.26Å; V82-N86 PolarHBondContact O-ND2 3.15Å; S84-N86 VanDerWaalsContact C-N 3.32Å
87	K	65.2	Low	90.4	Very high	231 Å²	231	115.1 Å²	115.1	100%	1.004	58%	0.581	S	S	*	*			trans	-100.4	0	172.3	-75.9	-176.4	178.8	-179.4	0	110.9

Retrieved 87 of 87 residues in 265.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).