A0A5K4FAQ8_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession A0A5K4FAQ8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 35 aa.

						>A0A5K4FAQ8_SCHMA|A0A5K4FAQ8
MNLHLIHVTYRTRSNLTHYCTYLRQEKVTSTMKLI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	71.6	Confident	86.5	Confident	215 Å²	215	133.3 Å²	133.3	100%	1.059	65%	0.647	S	S	*	*				0	-25.4	0	-71.2	170.5	88.9	0	0	114.2	L3 H4	M1-L3 PolarHBondContact O-N 3.13Å; M1-H4 PolarHBondContact O-N 3.34Å
2	N	72.3	Confident	86.8	Confident	129 Å²	129	129.6 Å²	129.6	69%	0.69	64%	0.638	S	S	*	*	H	α-helix	trans	-64.3	-37	-177.6	-70.6	-40.6	0	0	0	115.7	H4 L5 I6	N2-H4 VanDerWaalsContact C-N 3.28Å; N2-H4 PolarHBondContact O-N 3.3Å; N2-L5 PolarHBondContact O-N 3.49Å; N2-I6 WeakPolarHBondContact O-CG1 3.29Å; N2-I6 PolarHBondContact O-N 2.79Å
3	L	84.8	Confident	87	Confident	151 Å²	151	133.4 Å²	133.4	79%	0.791	64%	0.641	S	S	*	*	H	α-helix	trans	-61.7	-36	178.8	-82.2	155.4	0	0	0	112.9	M1 I6 H7	M1-L3 PolarHBondContact O-N 3.13Å; L3-I6 PolarHBondContact O-N 3.13Å; L3-H7 WeakPolarHBondContact O-CB 3.4Å; L3-H7 PolarHBondContact O-N 3.25Å
4	H	86.3	Confident	87.3	Confident	129 Å²	129	128.7 Å²	128.7	60%	0.597	63%	0.629	S	S	*	*	H	α-helix	trans	-65.3	-43.5	179.7	-173.2	78	0	0	0	111.2	M1 N2 H7 V8	M1-H4 PolarHBondContact O-N 3.34Å; N2-H4 VanDerWaalsContact C-N 3.28Å; N2-H4 PolarHBondContact O-N 3.3Å; H4-H7 PolarHBondContact O-N 2.85Å; H4-V8 VanDerWaalsContact O-CG2 3.31Å; H4-V8 WeakPolarHBondContact O-CG2 3.35Å; H4-V8 PolarHBondContact O-N 2.93Å
5	L	88.9	Confident	87.5	Confident	108 Å²	108	127.9 Å²	127.9	57%	0.565	63%	0.629	S	S	*	*	H	α-helix	trans	-62.8	-44.4	176.9	-66.1	174.1	0	0	0	111.3	N2 H7 V8 T9	N2-L5 PolarHBondContact O-N 3.49Å; L5-H7 VanDerWaalsContact C-N 3.34Å; L5-H7 PolarHBondContact O-N 3.36Å; L5-V8 PolarHBondContact O-N 3.36Å; L5-T9 WeakPolarHBondContact O-CB 3.37Å; L5-T9 PolarHBondContact O-N 2.95Å; L5-T9 PolarHBondContact O-OG1 3.45Å
6	I	91	Very high	87.8	Confident	116 Å²	116	126.8 Å²	126.8	60%	0.595	63%	0.625	S	S	*	*	H	α-helix	trans	-60.6	-44	177.3	-62	170.2	0	0	0	111	N2 L3 T9 Y10	N2-I6 WeakPolarHBondContact O-CG1 3.29Å; N2-I6 PolarHBondContact O-N 2.79Å; L3-I6 PolarHBondContact O-N 3.13Å; I6-T9 PolarHBondContact O-N 3.29Å; I6-Y10 WeakPolarHBondContact O-CB 3.25Å; I6-Y10 PolarHBondContact O-N 2.95Å
7	H	92	Very high	88	Confident	114 Å²	114	123.9 Å²	123.9	53%	0.528	62%	0.617	S	S	.	*	H	α-helix	trans	-66	-42.8	179.1	-178.1	-114	0	0	0	112.5	L3 H4 L5 Y10 R11	L3-H7 WeakPolarHBondContact O-CB 3.4Å; L3-H7 PolarHBondContact O-N 3.25Å; H4-H7 PolarHBondContact O-N 2.85Å; L5-H7 VanDerWaalsContact C-N 3.34Å; L5-H7 PolarHBondContact O-N 3.36Å; H7-Y10 PolarHBondContact O-N 2.76Å; H7-R11 WeakPolarHBondContact O-CB 3.46Å; H7-R11 PolarHBondContact O-N 3.25Å
8	V	91.8	Very high	88.2	Confident	63 Å²	63	124.8 Å²	124.8	38%	0.382	62%	0.619	S	S	.	*	H	α-helix	trans	-63.3	-46.3	174.9	174	0	0	0	0	110.3	H4 L5 Y10 R11 T12	H4-V8 VanDerWaalsContact O-CG2 3.31Å; H4-V8 WeakPolarHBondContact O-CG2 3.35Å; H4-V8 PolarHBondContact O-N 2.93Å; L5-V8 PolarHBondContact O-N 3.36Å; V8-Y10 VanDerWaalsContact C-N 3.34Å; V8-Y10 PolarHBondContact O-N 2.74Å; V8-R11 PolarHBondContact O-N 3.4Å; V8-T12 WeakPolarHBondContact O-CB 3.44Å; V8-T12 PolarHBondContact O-N 3.47Å; V8-T12 PolarHBondContact O-OG1 2.77Å
9	T	90.5	Very high	88.4	Confident	92 Å²	92	125.4 Å²	125.4	56%	0.564	61%	0.614	S	S	*	*	H	α-helix	trans	-59.7	-43	176.5	-57.2	0	0	0	0	111.8	L5 I6 R13	L5-T9 WeakPolarHBondContact O-CB 3.37Å; L5-T9 PolarHBondContact O-N 2.95Å; L5-T9 PolarHBondContact O-OG1 3.45Å; I6-T9 PolarHBondContact O-N 3.29Å; T9-R13 VanDerWaalsContact O-CB 3.27Å; T9-R13 WeakPolarHBondContact O-CB 3.41Å; T9-R13 PolarHBondContact O-N 3.22Å
10	Y	92.8	Very high	88.5	Confident	168 Å²	168	122.5 Å²	122.5	66%	0.659	61%	0.606	S	S	*	*	H	α-helix	trans	-66.1	-44.6	178	-169.4	-93	0	0	0	112.1	I6 H7 V8 R13 S14	I6-Y10 WeakPolarHBondContact O-CB 3.25Å; I6-Y10 PolarHBondContact O-N 2.95Å; H7-Y10 PolarHBondContact O-N 2.76Å; V8-Y10 VanDerWaalsContact C-N 3.34Å; V8-Y10 PolarHBondContact O-N 2.74Å; Y10-R13 PolarHBondContact O-N 2.75Å; Y10-S14 WeakPolarHBondContact O-CB 3.37Å; Y10-S14 PolarHBondContact O-N 2.88Å
11	R	90.1	Very high	88.7	Confident	181 Å²	181	119.7 Å²	119.7	68%	0.683	60%	0.596	S	S	*	*	H	α-helix	trans	-62.3	-44.8	177.1	-173.1	172.2	179.6	157.5	-0.7	111.6	H7 V8 S14 N15	H7-R11 WeakPolarHBondContact O-CB 3.46Å; H7-R11 PolarHBondContact O-N 3.25Å; V8-R11 PolarHBondContact O-N 3.4Å; R11-S14 PolarHBondContact O-N 2.95Å; R11-N15 WeakPolarHBondContact O-CB 3.38Å; R11-N15 PolarHBondContact O-N 2.96Å
12	T	89.2	Confident	89.6	Confident	89 Å²	89	114.9 Å²	114.9	55%	0.546	57%	0.567	S	S	.	*	H	α-helix	trans	-63	-44.4	176.3	-59.5	0	0	0	0	111.3	V8 N15 L16	V8-T12 WeakPolarHBondContact O-CB 3.44Å; V8-T12 PolarHBondContact O-N 3.47Å; V8-T12 PolarHBondContact O-OG1 2.77Å; T12-N15 PolarHBondContact O-N 3.15Å; T12-L16 WeakPolarHBondContact O-CB 3.36Å; T12-L16 PolarHBondContact O-N 3.4Å
13	R	90.1	Very high	90.4	Very high	179 Å²	179	112.5 Å²	112.5	68%	0.675	55%	0.554	S	S	*	*	H	α-helix	trans	-61.7	-48.8	176.9	-178.6	178.6	-115.4	175.3	-2	111.6	T9 Y10 N15 L16 T17	T9-R13 VanDerWaalsContact O-CB 3.27Å; T9-R13 WeakPolarHBondContact O-CB 3.41Å; T9-R13 PolarHBondContact O-N 3.22Å; Y10-R13 PolarHBondContact O-N 2.75Å; R13-N15 VanDerWaalsContact C-N 3.29Å; R13-N15 PolarHBondContact O-N 3.32Å; R13-L16 PolarHBondContact O-N 2.93Å; R13-T17 PolarHBondContact O-N 2.81Å; R13-T17 PolarHBondContact O-OG1 2.88Å; R13-T17 VanDerWaalsContact O-OG1 3.1Å
14	S	91.1	Very high	90.7	Very high	68 Å²	68	114.4 Å²	114.4	48%	0.476	55%	0.551	S	S	.	*	H	α-helix	trans	-58.3	-43.3	178.3	-171	0	0	0	0	111.5	Y10 R11 H18	Y10-S14 WeakPolarHBondContact O-CB 3.37Å; Y10-S14 PolarHBondContact O-N 2.88Å; R11-S14 PolarHBondContact O-N 2.95Å; S14-H18 WeakPolarHBondContact O-CB 3.18Å; S14-H18 PolarHBondContact O-N 3.27Å
15	N	90.7	Very high	90.8	Very high	117 Å²	117	114 Å²	114	63%	0.626	55%	0.549	S	S	*	.	H	α-helix	trans	-66	-43.8	178.5	-163.6	34.5	0	0	0	111.9	R11 T12 R13 H18 Y19	R11-N15 WeakPolarHBondContact O-CB 3.38Å; R11-N15 PolarHBondContact O-N 2.96Å; T12-N15 PolarHBondContact O-N 3.15Å; R13-N15 VanDerWaalsContact C-N 3.29Å; R13-N15 PolarHBondContact O-N 3.32Å; N15-H18 PolarHBondContact O-N 2.72Å; N15-Y19 WeakPolarHBondContact O-CB 3.47Å; N15-Y19 PolarHBondContact O-N 3.35Å
16	L	91.7	Very high	90.7	Very high	109 Å²	109	113.4 Å²	113.4	57%	0.571	54%	0.543	S	S	*	.	H	α-helix	trans	-61.5	-46.6	176.8	-169.7	86.6	0	0	0	111.4	T12 R13 H18 Y19 C20	T12-L16 WeakPolarHBondContact O-CB 3.36Å; T12-L16 PolarHBondContact O-N 3.4Å; R13-L16 PolarHBondContact O-N 2.93Å; L16-H18 VanDerWaalsContact C-N 3.34Å; L16-H18 PolarHBondContact O-N 3.1Å; L16-Y19 PolarHBondContact O-N 3.02Å; L16-C20 WeakPolarHBondContact O-CB 3.47Å; L16-C20 PolarHBondContact O-N 3.36Å; L16-C20 PolarHBondContact O-SG 3.45Å; L16-C20 VanDerWaalsContact O-SG 3.35Å
17	T	91.5	Very high	90.4	Very high	79 Å²	79	115.4 Å²	115.4	49%	0.485	55%	0.547	S	S	.	.	H	α-helix	trans	-62.7	-41.2	178.6	-60.3	0	0	0	0	111.6	R13 T21	R13-T17 PolarHBondContact O-N 2.81Å; R13-T17 PolarHBondContact O-OG1 2.88Å; R13-T17 VanDerWaalsContact O-OG1 3.1Å; T17-T21 WeakPolarHBondContact O-CB 3.46Å; T17-T21 PolarHBondContact O-N 3.28Å; T17-T21 PolarHBondContact O-OG1 3Å
18	H	91.4	Very high	89.9	Confident	140 Å²	140	113.8 Å²	113.8	65%	0.648	55%	0.546	S	S	*	.	H	α-helix	trans	-62.7	-45.5	175.4	-167	-96.9	0	0	0	111.3	S14 N15 L16 T21 Y22	S14-H18 WeakPolarHBondContact O-CB 3.18Å; S14-H18 PolarHBondContact O-N 3.27Å; N15-H18 PolarHBondContact O-N 2.72Å; L16-H18 VanDerWaalsContact C-N 3.34Å; L16-H18 PolarHBondContact O-N 3.1Å; H18-T21 PolarHBondContact O-N 3.26Å; H18-Y22 WeakPolarHBondContact O-CB 3.43Å; H18-Y22 PolarHBondContact O-N 2.89Å
19	Y	91.4	Very high	89.3	Confident	135 Å²	135	113.8 Å²	113.8	53%	0.529	55%	0.546	S	S	.	.	H	α-helix	trans	-63.3	-45.1	177.1	-177.5	-109.1	0	0	0	113	N15 L16 T21 Y22 L23	N15-Y19 WeakPolarHBondContact O-CB 3.47Å; N15-Y19 PolarHBondContact O-N 3.35Å; L16-Y19 PolarHBondContact O-N 3.02Å; Y19-T21 VanDerWaalsContact C-N 3.29Å; Y19-T21 PolarHBondContact O-N 2.9Å; Y19-Y22 WeakPolarHBondContact O-CB 3.46Å; Y19-Y22 PolarHBondContact O-N 2.92Å; Y19-L23 HydrophobicContact CD1-CD1 3.94Å; Y19-L23 HydrophobicContact CD1-CG 4.45Å; Y19-L23 HydrophobicContact CE1-CD1 3.37Å; Y19-L23 HydrophobicContact CE1-CG 4.06Å; Y19-L23 HydrophobicContact CE2-CD1 4.45Å; Y19-L23 HydrophobicContact CE2-CD2 4.45Å; Y19-L23 HydrophobicContact CE2-CG 4.29Å; Y19-L23 WeakPolarHBondContact O-CG 3.47Å; Y19-L23 PolarHBondContact O-N 2.83Å
20	C	90.7	Very high	88.7	Confident	67 Å²	67	112.6 Å²	112.6	45%	0.453	54%	0.541	S	S	.	.	H	α-helix	trans	-62.2	-37.7	174.9	-71.2	0	0	0	0	112.2	L16 R24	L16-C20 WeakPolarHBondContact O-CB 3.47Å; L16-C20 PolarHBondContact O-N 3.36Å; L16-C20 PolarHBondContact O-SG 3.45Å; L16-C20 VanDerWaalsContact O-SG 3.35Å; C20-R24 WeakPolarHBondContact O-CB 3.27Å; C20-R24 PolarHBondContact O-N 3.27Å
21	T	92	Very high	87.8	Confident	65 Å²	65	108 Å²	108	40%	0.399	53%	0.531	S	S	.	.	H	α-helix	trans	-66.3	-44.5	176.2	-56.5	0	0	0	0	110.9	T17 H18 Y19 R24 Q25	T17-T21 WeakPolarHBondContact O-CB 3.46Å; T17-T21 PolarHBondContact O-N 3.28Å; T17-T21 PolarHBondContact O-OG1 3Å; H18-T21 PolarHBondContact O-N 3.26Å; Y19-T21 VanDerWaalsContact C-N 3.29Å; Y19-T21 PolarHBondContact O-N 2.9Å; T21-R24 PolarHBondContact O-N 2.93Å; T21-Q25 WeakPolarHBondContact O-CG 3.4Å; T21-Q25 PolarHBondContact O-N 3.47Å
22	Y	91.4	Very high	86.8	Confident	113 Å²	113	106.1 Å²	106.1	44%	0.443	53%	0.531	S	S	.	.	H	α-helix	trans	-57.3	-51	174	175.7	-94.2	0	0	0	111.4	H18 Y19 R24 Q25 E26	H18-Y22 WeakPolarHBondContact O-CB 3.43Å; H18-Y22 PolarHBondContact O-N 2.89Å; Y19-Y22 WeakPolarHBondContact O-CB 3.46Å; Y19-Y22 PolarHBondContact O-N 2.92Å; Y22-R24 VanDerWaalsContact C-N 3.3Å; Y22-R24 PolarHBondContact O-N 2.85Å; Y22-Q25 PolarHBondContact O-N 3.32Å; Y22-Q25 VanDerWaalsContact O-N 3.15Å; Y22-E26 HydrophobicContact CD1-CG 4.02Å; Y22-E26 HydrophobicContact CD2-CG 4.46Å; Y22-E26 HydrophobicContact CE1-CG 3.53Å; Y22-E26 WeakPolarHBondContact CE1-OE2 3.4Å; Y22-E26 HydrophobicContact CE2-CG 4.05Å; Y22-E26 HydrophobicContact CG-CG 4.45Å; Y22-E26 VanDerWaalsContact CZ-OE2 3.29Å; Y22-E26 WeakPolarHBondContact O-CB 3.4Å; Y22-E26 WeakPolarHBondContact O-CG 3.39Å; Y22-E26 PolarHBondContact O-N 3.37Å; Y22-E26 PolarHBondContact OH-OE2 3.34Å
23	L	89.1	Confident	85.8	Confident	79 Å²	79	110.1 Å²	110.1	41%	0.414	54%	0.541	S	S	.	.	H	α-helix	trans	-60.2	-38.5	177.3	-73.2	-179.9	0	0	0	112.7	Y19 K27	Y19-L23 HydrophobicContact CD1-CD1 3.94Å; Y19-L23 HydrophobicContact CD1-CG 4.45Å; Y19-L23 HydrophobicContact CE1-CD1 3.37Å; Y19-L23 HydrophobicContact CE1-CG 4.06Å; Y19-L23 HydrophobicContact CE2-CD1 4.45Å; Y19-L23 HydrophobicContact CE2-CD2 4.45Å; Y19-L23 HydrophobicContact CE2-CG 4.29Å; Y19-L23 WeakPolarHBondContact O-CG 3.47Å; Y19-L23 PolarHBondContact O-N 2.83Å; L23-K27 WeakPolarHBondContact O-CB 3.39Å; L23-K27 PolarHBondContact O-N 3.38Å
24	R	91.1	Very high	84.3	Confident	192 Å²	192	108.6 Å²	108.6	73%	0.725	55%	0.546	S	S	*	.	H	α-helix	trans	-66.2	-43	176.2	-178.2	179.2	-104.5	-177.4	-5.9	111	C20 T21 Y22 K27 V28	C20-R24 WeakPolarHBondContact O-CB 3.27Å; C20-R24 PolarHBondContact O-N 3.27Å; T21-R24 PolarHBondContact O-N 2.93Å; Y22-R24 VanDerWaalsContact C-N 3.3Å; Y22-R24 PolarHBondContact O-N 2.85Å; R24-K27 PolarHBondContact O-N 2.87Å; R24-V28 VanDerWaalsContact O-CG2 3.29Å; R24-V28 WeakPolarHBondContact O-CG2 3.4Å; R24-V28 PolarHBondContact O-N 3.43Å
25	Q	88.6	Confident	82.6	Confident	121 Å²	121	114.2 Å²	114.2	57%	0.565	57%	0.568	S	S	*	*	H	α-helix	trans	-65.7	-43.3	176.6	-74.7	-180	5.4	0	0	111.8	T21 Y22 K27 V28 T29	T21-Q25 WeakPolarHBondContact O-CG 3.4Å; T21-Q25 PolarHBondContact O-N 3.47Å; Y22-Q25 PolarHBondContact O-N 3.32Å; Y22-Q25 VanDerWaalsContact O-N 3.15Å; Q25-K27 VanDerWaalsContact C-N 3.33Å; Q25-K27 PolarHBondContact O-N 3.41Å; Q25-V28 PolarHBondContact O-N 2.92Å; Q25-T29 VanDerWaalsContact O-CB 3.25Å; Q25-T29 WeakPolarHBondContact O-CB 3.48Å; Q25-T29 PolarHBondContact O-N 3.45Å; Q25-T29 PolarHBondContact O-OG1 3.34Å
26	E	86.3	Confident	82.2	Confident	95 Å²	95	114.1 Å²	114.1	44%	0.444	57%	0.565	S	S	.	*	H	α-helix	trans	-58	-46.7	173.8	-76	-103.2	76.7	0	0	110.5	Y22 V28 T29 S30	Y22-E26 HydrophobicContact CD1-CG 4.02Å; Y22-E26 HydrophobicContact CD2-CG 4.46Å; Y22-E26 HydrophobicContact CE1-CG 3.53Å; Y22-E26 WeakPolarHBondContact CE1-OE2 3.4Å; Y22-E26 HydrophobicContact CE2-CG 4.05Å; Y22-E26 HydrophobicContact CG-CG 4.45Å; Y22-E26 VanDerWaalsContact CZ-OE2 3.29Å; Y22-E26 WeakPolarHBondContact O-CB 3.4Å; Y22-E26 WeakPolarHBondContact O-CG 3.39Å; Y22-E26 PolarHBondContact O-N 3.37Å; Y22-E26 PolarHBondContact OH-OE2 3.34Å; E26-V28 PolarHBondContact O-N 2.89Å; E26-T29 PolarHBondContact O-N 3Å; E26-S30 WeakPolarHBondContact O-CB 3.38Å; E26-S30 PolarHBondContact O-N 3.42Å
27	K	84.1	Confident	81.7	Confident	157 Å²	157	114.3 Å²	114.3	68%	0.683	57%	0.565	S	S	*	*	H	α-helix	trans	-61.1	-47.4	176.9	-172	173.6	-177.7	176.6	0	111.8	L23 R24 Q25 S30 T31	L23-K27 WeakPolarHBondContact O-CB 3.39Å; L23-K27 PolarHBondContact O-N 3.38Å; R24-K27 PolarHBondContact O-N 2.87Å; Q25-K27 VanDerWaalsContact C-N 3.33Å; Q25-K27 PolarHBondContact O-N 3.41Å; K27-S30 PolarHBondContact O-N 3.41Å; K27-T31 WeakPolarHBondContact O-CB 3.38Å; K27-T31 PolarHBondContact O-N 3.39Å; K27-T31 PolarHBondContact O-OG1 2.89Å
28	V	82.9	Confident	81.2	Confident	81 Å²	81	116.3 Å²	116.3	49%	0.491	57%	0.57	S	S	.	*	H	α-helix	trans	-62.7	-44.2	177.9	171.4	0	0	0	0	111.2	R24 Q25 E26 S30 T31 M32	R24-V28 VanDerWaalsContact O-CG2 3.29Å; R24-V28 WeakPolarHBondContact O-CG2 3.4Å; R24-V28 PolarHBondContact O-N 3.43Å; Q25-V28 PolarHBondContact O-N 2.92Å; E26-V28 PolarHBondContact O-N 2.89Å; V28-S30 VanDerWaalsContact C-N 3.35Å; V28-T31 PolarHBondContact O-N 3.19Å; V28-M32 HydrophobicContact CG1-SD 4.46Å; V28-M32 WeakPolarHBondContact O-CB 3.43Å; V28-M32 PolarHBondContact O-N 2.92Å
29	T	78.6	Confident	80.6	Confident	63 Å²	63	114.9 Å²	114.9	39%	0.387	57%	0.565	S	S	.	*	H	α-helix	trans	-64.1	-42.2	178	-56.9	0	0	0	0	110.8	Q25 E26 T31 M32 K33	Q25-T29 VanDerWaalsContact O-CB 3.25Å; Q25-T29 WeakPolarHBondContact O-CB 3.48Å; Q25-T29 PolarHBondContact O-N 3.45Å; Q25-T29 PolarHBondContact O-OG1 3.34Å; E26-T29 PolarHBondContact O-N 3Å; T29-T31 VanDerWaalsContact C-N 3.33Å; T29-M32 PolarHBondContact O-N 2.85Å; T29-K33 WeakPolarHBondContact O-CG 3.31Å; T29-K33 PolarHBondContact O-N 2.96Å
30	S	77.6	Confident	79.9	Confident	67 Å²	67	113.6 Å²	113.6	47%	0.469	57%	0.567	S	S	.	*	H	α-helix	trans	-66.8	-36	176.9	-154.1	0	0	0	0	111.3	E26 K27 V28 K33 L34	E26-S30 WeakPolarHBondContact O-CB 3.38Å; E26-S30 PolarHBondContact O-N 3.42Å; K27-S30 PolarHBondContact O-N 3.41Å; V28-S30 VanDerWaalsContact C-N 3.35Å; S30-K33 PolarHBondContact O-N 3.34Å; S30-L34 PolarHBondContact O-N 3.39Å
31	T	74.2	Confident	79.2	Confident	71 Å²	71	116.7 Å²	116.7	44%	0.436	58%	0.575	S	S	.	*	H	α-helix	trans	-68.4	-41.3	171.6	-58.3	0	0	0	0	111.7	K27 V28 T29 K33 L34 I35	K27-T31 WeakPolarHBondContact O-CB 3.38Å; K27-T31 PolarHBondContact O-N 3.39Å; K27-T31 PolarHBondContact O-OG1 2.89Å; V28-T31 PolarHBondContact O-N 3.19Å; T29-T31 VanDerWaalsContact C-N 3.33Å; T31-K33 PolarHBondContact O-N 3.31Å; T31-L34 PolarHBondContact O-N 2.94Å; T31-L34 VanDerWaalsContact O-N 3.13Å; T31-I35 HydrophobicContact CG2-CD1 4.03Å; T31-I35 WeakPolarHBondContact O-CG1 3.37Å; T31-I35 PolarHBondContact O-N 3.34Å; T31-I35 VanDerWaalsContact O-N 3.13Å
32	M	70.2	Confident	78.3	Confident	142 Å²	142	120.4 Å²	120.4	70%	0.7	59%	0.588	S	S	*	*	H	α-helix	trans	-63.7	-26.9	174.4	-101.8	169.9	69.9	0	0	113.4	V28 T29	V28-M32 HydrophobicContact CG1-SD 4.46Å; V28-M32 WeakPolarHBondContact O-CB 3.43Å; V28-M32 PolarHBondContact O-N 2.92Å; T29-M32 PolarHBondContact O-N 2.85Å
33	K	67.2	Low	77.3	Confident	172 Å²	172	121 Å²	121	75%	0.748	60%	0.599	S	S	*	*	H	α-helix	trans	-83.5	-17.7	174.5	-72.7	179.9	-178.1	179.4	0	113.7	T29 S30 T31	T29-K33 WeakPolarHBondContact O-CG 3.31Å; T29-K33 PolarHBondContact O-N 2.96Å; S30-K33 PolarHBondContact O-N 3.34Å; T31-K33 PolarHBondContact O-N 3.31Å
34	L	58.3	Low	76.3	Confident	147 Å²	147	124.5 Å²	124.5	77%	0.77	61%	0.614	S	S	*	*	H	α-helix	trans	-94.5	-19.1	179.9	-88.6	162	0	0	0	113	S30 T31	S30-L34 PolarHBondContact O-N 3.39Å; T31-L34 PolarHBondContact O-N 2.94Å; T31-L34 VanDerWaalsContact O-N 3.13Å
35	I	56.5	Low	75	Confident	186 Å²	186	118.4 Å²	118.4	95%	0.954	60%	0.604	S	S	*	*			trans	-83.1	0	168.5	-62.9	167.1	0	0	0	108.2	T31	T31-I35 HydrophobicContact CG2-CD1 4.03Å; T31-I35 WeakPolarHBondContact O-CG1 3.37Å; T31-I35 PolarHBondContact O-N 3.34Å; T31-I35 VanDerWaalsContact O-N 3.13Å

Retrieved 35 of 35 residues in 24.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).