A0A5K4FAU7_SCHMA Loading...

Kinesin motor domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4FAU7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 62 aa.

						>A0A5K4FAU7_SCHMA|A0A5K4FAU7
MSEEQVKVAVRIRPFNKRERERNAELIVFMNGNTTTIRHPESTSNILALSCLEDVCRIYPYV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62	Low	85.5	Confident	231 Å²	231	160.4 Å²	160.4	100%	1.138	83%	0.83	S	S	*	*				0	111.6	0	-64	-56.3	-176.4	0	0	106.5	E3	M1-E3 PolarHBondContact O-N 3.15Å; M1-E3 VanDerWaalsContact O-N 3.15Å
2	S	78.9	Confident	85.7	Confident	121 Å²	121	152.5 Å²	152.5	85%	0.846	79%	0.789	S	S	*	*			trans	-69	106.6	172	45	0	0	0	0	107.5	E4	S2-E4 PolarHBondContact O-N 3Å
3	E	80.5	Confident	86.2	Confident	192 Å²	192	151.5 Å²	151.5	90%	0.897	77%	0.769	S	S	*	*			trans	-66.7	98.2	173.5	-70.7	178.7	175.1	0	0	108.4	M1	M1-E3 PolarHBondContact O-N 3.15Å; M1-E3 VanDerWaalsContact O-N 3.15Å
4	E	85.6	Confident	86.7	Confident	183 Å²	183	148.5 Å²	148.5	86%	0.855	77%	0.765	S	S	*	*	P	Polyproline II helix	trans	-80.4	118.9	173.9	-167.4	168.5	-164.5	0	0	109	S2	S2-E4 PolarHBondContact O-N 3Å
5	Q	88	Confident	87	Confident	172 Å²	172	144 Å²	144	80%	0.804	74%	0.738	S	S	*	*	P	Polyproline II helix	trans	-80.4	124.1	176.2	-173.6	177.5	46.2	0	0	110.2	K7	Q5-K7 PolarHBondContact O-N 2.84Å
6	V	89.8	Confident	87.4	Confident	122 Å²	122	139 Å²	139	74%	0.739	71%	0.713	S	S	*	*	P	Polyproline II helix	trans	-67	117.9	172.1	-179.5	0	0	0	0	109.3	V8	V6-V8 HydrophobicContact CG1-CG2 4.24Å
7	K	91.1	Very high	87.8	Confident	199 Å²	199	139.2 Å²	139.2	87%	0.865	71%	0.708	S	S	*	*	P	Polyproline II helix	trans	-82	120.6	173.1	-66.6	-179.5	-178.1	175.7	0	109.6	Q5	Q5-K7 PolarHBondContact O-N 2.84Å
8	V	91.7	Very high	88.2	Confident	125 Å²	125	139.7 Å²	139.7	76%	0.758	70%	0.699	S	S	*	*			trans	-108.1	135.2	176.3	-178.1	0	0	0	0	109.1	V6	V6-V8 HydrophobicContact CG1-CG2 4.24Å
9	A	91	Very high	88.4	Confident	97 Å²	97	134.8 Å²	134.8	80%	0.802	67%	0.674	S	S	*	*			trans	-124.6	140.7	174.8	0	0	0	0	0	110.1
10	V	91	Very high	88.6	Confident	93 Å²	93	136.3 Å²	136.3	56%	0.564	67%	0.671	S	S	*	*			trans	-115.6	138.6	178.2	-176.9	0	0	0	0	108.7
11	R	90.6	Very high	88.9	Confident	229 Å²	229	135.4 Å²	135.4	86%	0.864	67%	0.666	S	S	*	*			trans	-129.2	119.3	176.3	179.4	-178.8	177.1	-175.9	0.7	109.8
12	I	88	Confident	90.4	Very high	66 Å²	66	132.5 Å²	132.5	34%	0.338	64%	0.642	S	S	.	*	P	Polyproline II helix	trans	-80.6	136.3	168.1	-61.1	178.3	0	0	0	108.7	V28 M30	I12-V28 HydrophobicContact CD1-CB 4.11Å; I12-V28 HydrophobicContact CD1-CG1 3.46Å; I12-V28 VanDerWaalsContact CD1-CG1 3.46Å; I12-V28 HydrophobicContact CG1-CG1 4.09Å; I12-M30 HydrophobicContact CB-SD 4.41Å; I12-M30 HydrophobicContact CD1-CB 4.47Å; I12-M30 HydrophobicContact CD1-CG 3.43Å; I12-M30 VanDerWaalsContact CD1-CG 3.43Å; I12-M30 HydrophobicContact CD1-SD 3.4Å; I12-M30 WeakPolarHBondContact CD1-SD 3.12Å; I12-M30 HydrophobicContact CG1-CG 4.27Å; I12-M30 HydrophobicContact CG1-SD 3.62Å
13	R	93	Very high	90.9	Very high	139 Å²	139	133.9 Å²	133.9	53%	0.525	64%	0.64	S	S	.	*	P	Polyproline II helix	trans	-99.4	152.6	174.8	66.3	170.5	-178.7	77.2	2.3	111.1	E19	R13-E19 IonicContact CZ-OE1 3.61Å; R13-E19 IonicContact CZ-OE2 3.88Å; R13-E19 IonicContact NH1-OE1 3.43Å; R13-E19 PolarHBondContact NH1-OE1 2.85Å; R13-E19 IonicContact NH1-OE2 2.76Å; R13-E19 PolarHBondContact NH1-OE2 3.2Å; R13-E19 IonicContact NH2-OE1 3.53Å; R13-E19 PolarHBondContact NH2-OE1 2.74Å; R13-E19 IonicContact NH2-OE2 3.5Å
14	P	93	Very high	91.3	Very high	110 Å²	110	126.9 Å²	126.9	71%	0.714	62%	0.615	S	S	*	*	P	Polyproline II helix	trans	-62.9	164	166.9	-20.7	33.2	0	0	0	112.6
15	F	91.6	Very high	91.4	Very high	81 Å²	81	124.2 Å²	124.2	36%	0.355	60%	0.602	S	S	.	*	P	Polyproline II helix	trans	-64	132.9	174.6	-71	-63.4	0	0	0	112.4	E19 R20 A24 L26	F15-E19 VanDerWaalsContact CA-OE2 3.27Å; F15-E19 WeakPolarHBondContact CA-OE2 3.43Å; F15-E19 HydrophobicContact CB-CB 4.06Å; F15-E19 HydrophobicContact CD1-CB 3.59Å; F15-E19 HydrophobicContact CD1-CG 4.1Å; F15-E19 HydrophobicContact CE1-CB 4.43Å; F15-E19 HydrophobicContact CG-CB 4.22Å; F15-R20 HydrophobicContact CB-CG 3.94Å; F15-A24 HydrophobicContact CE1-CB 4.09Å; F15-L26 HydrophobicContact CE2-CB 4.2Å; F15-L26 HydrophobicContact CZ-CB 3.95Å; F15-L26 HydrophobicContact CZ-CD1 4.33Å
16	N	92.8	Very high	91.4	Very high	64 Å²	64	120.2 Å²	120.2	34%	0.342	59%	0.586	S	S	.	*			trans	-75.3	176.5	171.8	69.1	33.3	0	0	0	110.8	R18 E19 R20	N16-R18 PolarHBondContact O-N 3.08Å; N16-R18 WeakPolarHBondContact OD1-CB 3.48Å; N16-R18 PolarHBondContact OD1-N 2.99Å; N16-R18 VanDerWaalsContact OD1-N 3.11Å; N16-E19 VanDerWaalsContact CG-CD 3.49Å; N16-E19 PolarHBondContact N-OE2 2.8Å; N16-E19 PolarHBondContact ND2-OE2 3.45Å; N16-E19 PolarHBondContact O-N 3.19Å; N16-E19 WeakPolarHBondContact OD1-CB 3.41Å; N16-E19 VanDerWaalsContact OD1-CG 3.25Å; N16-E19 WeakPolarHBondContact OD1-CG 3.4Å; N16-E19 PolarHBondContact OD1-N 2.83Å; N16-E19 PolarHBondContact OD1-OE2 3.04Å; N16-R20 PolarHBondContact O-N 2.84Å; N16-R20 PolarHBondContact O-NE 3.24Å
17	K	94.4	Very high	91.4	Very high	143 Å²	143	117 Å²	117	62%	0.622	56%	0.564	S	S	*	*	H	α-helix	trans	-60.6	-45.5	-179.2	-164.8	-168.8	-173.2	-121.9	0	111.8	E19 R20 E21	K17-E19 PolarHBondContact O-N 3.44Å; K17-R20 PolarHBondContact O-N 3.04Å; K17-E21 WeakPolarHBondContact CD-OE1 3.31Å; K17-E21 WeakPolarHBondContact CE-OE1 3.42Å; K17-E21 HydrophobicContact CG-CG 4.43Å; K17-E21 WeakPolarHBondContact CG-OE1 3.4Å; K17-E21 IonicContact NZ-OE1 2.69Å; K17-E21 PolarHBondContact NZ-OE1 2.84Å; K17-E21 WeakPolarHBondContact O-CB 3.35Å; K17-E21 VanDerWaalsContact O-CG 3.3Å; K17-E21 WeakPolarHBondContact O-CG 3.5Å; K17-E21 PolarHBondContact O-N 2.8Å
18	R	95	Very high	91.2	Very high	148 Å²	148	109.5 Å²	109.5	56%	0.558	54%	0.535	S	S	*	.	H	α-helix	trans	-61.1	-40.7	-179.3	175.9	178.5	170.8	167.8	-3.2	112.7	N16 E21 R22	N16-R18 PolarHBondContact O-N 3.08Å; N16-R18 WeakPolarHBondContact OD1-CB 3.48Å; N16-R18 PolarHBondContact OD1-N 2.99Å; N16-R18 VanDerWaalsContact OD1-N 3.11Å; R18-E21 PolarHBondContact O-N 2.8Å; R18-R22 WeakPolarHBondContact O-CB 3.27Å; R18-R22 WeakPolarHBondContact O-CG 3.33Å; R18-R22 PolarHBondContact O-N 3.28Å
19	E	92.5	Very high	91.1	Very high	46 Å²	46	107 Å²	107	22%	0.215	51%	0.514	C	S	.	.	H	α-helix	trans	-67.3	-40.9	178.6	-73.6	160.9	163	0	0	111.1	R13 F15 N16 K17 R22 N23 A24	R13-E19 IonicContact CZ-OE1 3.61Å; R13-E19 IonicContact CZ-OE2 3.88Å; R13-E19 IonicContact NH1-OE1 3.43Å; R13-E19 PolarHBondContact NH1-OE1 2.85Å; R13-E19 IonicContact NH1-OE2 2.76Å; R13-E19 PolarHBondContact NH1-OE2 3.2Å; R13-E19 IonicContact NH2-OE1 3.53Å; R13-E19 PolarHBondContact NH2-OE1 2.74Å; R13-E19 IonicContact NH2-OE2 3.5Å; F15-E19 VanDerWaalsContact CA-OE2 3.27Å; F15-E19 WeakPolarHBondContact CA-OE2 3.43Å; F15-E19 HydrophobicContact CB-CB 4.06Å; F15-E19 HydrophobicContact CD1-CB 3.59Å; F15-E19 HydrophobicContact CD1-CG 4.1Å; F15-E19 HydrophobicContact CE1-CB 4.43Å; F15-E19 HydrophobicContact CG-CB 4.22Å; N16-E19 VanDerWaalsContact CG-CD 3.49Å; N16-E19 PolarHBondContact N-OE2 2.8Å; N16-E19 PolarHBondContact ND2-OE2 3.45Å; N16-E19 PolarHBondContact O-N 3.19Å; N16-E19 WeakPolarHBondContact OD1-CB 3.41Å; N16-E19 VanDerWaalsContact OD1-CG 3.25Å; N16-E19 WeakPolarHBondContact OD1-CG 3.4Å; N16-E19 PolarHBondContact OD1-N 2.83Å; N16-E19 PolarHBondContact OD1-OE2 3.04Å; K17-E19 PolarHBondContact O-N 3.44Å; E19-R22 PolarHBondContact O-N 3.26Å; E19-N23 PolarHBondContact O-N 2.73Å; E19-A24 HydrophobicContact CB-CB 3.95Å; E19-A24 HydrophobicContact CG-CB 4.33Å; E19-A24 WeakPolarHBondContact O-CB 3.49Å; E19-A24 PolarHBondContact O-N 3.26Å
20	R	91.1	Very high	91	Very high	165 Å²	165	106.8 Å²	106.8	62%	0.623	50%	0.497	S	S	*	.	H	α-helix	trans	-65.6	-43.9	173.3	-71.5	-176	-77.8	158.5	-6	112.2	F15 N16 K17 R22 N23	F15-R20 HydrophobicContact CB-CG 3.94Å; N16-R20 PolarHBondContact O-N 2.84Å; N16-R20 PolarHBondContact O-NE 3.24Å; K17-R20 PolarHBondContact O-N 3.04Å; R20-R22 PolarHBondContact O-N 2.71Å; R20-N23 PolarHBondContact O-N 3.43Å
21	E	95.2	Very high	90.9	Very high	118 Å²	118	108.8 Å²	108.8	55%	0.551	51%	0.505	S	S	*	.	H	α-helix	trans	-62.2	-28.5	176.9	-74.8	170.1	176.1	0	0	112.8	K17 R18	K17-E21 WeakPolarHBondContact CD-OE1 3.31Å; K17-E21 WeakPolarHBondContact CE-OE1 3.42Å; K17-E21 HydrophobicContact CG-CG 4.43Å; K17-E21 WeakPolarHBondContact CG-OE1 3.4Å; K17-E21 IonicContact NZ-OE1 2.69Å; K17-E21 PolarHBondContact NZ-OE1 2.84Å; K17-E21 WeakPolarHBondContact O-CB 3.35Å; K17-E21 VanDerWaalsContact O-CG 3.3Å; K17-E21 WeakPolarHBondContact O-CG 3.5Å; K17-E21 PolarHBondContact O-N 2.8Å; R18-E21 PolarHBondContact O-N 2.8Å
22	R	93	Very high	90.8	Very high	170 Å²	170	100.7 Å²	100.7	64%	0.642	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.4	7.1	179.4	-67.6	-179	-178.6	-160	-4.9	114.1	R18 E19 R20 A24	R18-R22 WeakPolarHBondContact O-CB 3.27Å; R18-R22 WeakPolarHBondContact O-CG 3.33Å; R18-R22 PolarHBondContact O-N 3.28Å; E19-R22 PolarHBondContact O-N 3.26Å; R20-R22 PolarHBondContact O-N 2.71Å; R22-A24 VanDerWaalsContact C-N 3.25Å; R22-A24 PolarHBondContact O-N 2.76Å
23	N	90.7	Very high	90.9	Very high	150 Å²	150	105.6 Å²	105.6	80%	0.802	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.1	44.4	-175.3	-60.6	-44.8	0	0	0	113	E19 R20	E19-N23 PolarHBondContact O-N 2.73Å; R20-N23 PolarHBondContact O-N 3.43Å
24	A	88.1	Confident	90.8	Very high	45 Å²	45	103.3 Å²	103.3	37%	0.372	52%	0.521	S	S	.	.			trans	-61.6	142	179.6	0	0	0	0	0	111.7	F15 E19 R22	F15-A24 HydrophobicContact CE1-CB 4.09Å; E19-A24 HydrophobicContact CB-CB 3.95Å; E19-A24 HydrophobicContact CG-CB 4.33Å; E19-A24 WeakPolarHBondContact O-CB 3.49Å; E19-A24 PolarHBondContact O-N 3.26Å; R22-A24 VanDerWaalsContact C-N 3.25Å; R22-A24 PolarHBondContact O-N 2.76Å
25	E	87.7	Confident	90.6	Very high	126 Å²	126	100.6 Å²	100.6	59%	0.589	50%	0.503	S	S	*	.			trans	-86.8	144.8	177.8	-171.4	178.4	176.9	0	0	111.8	I27	E25-I27 PolarHBondContact O-N 3.49Å
26	L	88.3	Confident	90.4	Very high	88 Å²	88	100.1 Å²	100.1	46%	0.461	51%	0.506	S	S	.	.			trans	-79.4	104.1	172.2	179.6	67	0	0	0	109.7	F15 V28 F29	F15-L26 HydrophobicContact CE2-CB 4.2Å; F15-L26 HydrophobicContact CZ-CB 3.95Å; F15-L26 HydrophobicContact CZ-CD1 4.33Å; L26-V28 WeakPolarHBondContact CD1-O 3.25Å; L26-F29 VanDerWaalsContact O-CZ 3.31Å; L26-F29 WeakPolarHBondContact O-CZ 3.4Å
27	I	89	Confident	90.2	Very high	55 Å²	55	102.2 Å²	102.2	28%	0.282	52%	0.516	S	S	.	.			trans	-97.8	-9.1	178.8	64.3	167.9	0	0	0	114.1	E25 I37 R38 P40	E25-I27 PolarHBondContact O-N 3.49Å; I27-I37 HydrophobicContact CD1-CG2 4.32Å; I27-I37 WeakPolarHBondContact O-CA 3.41Å; I27-R38 WeakPolarHBondContact CB-O 3.3Å; I27-R38 PolarHBondContact O-N 3.21Å; I27-P40 HydrophobicContact CG2-CB 4.21Å
28	V	87.7	Confident	89.7	Confident	42 Å²	42	102.5 Å²	102.5	26%	0.255	51%	0.514	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.5	128.2	-177.1	-167.9	0	0	0	0	110	I12 L26 T35 I37	I12-V28 HydrophobicContact CD1-CB 4.11Å; I12-V28 HydrophobicContact CD1-CG1 3.46Å; I12-V28 VanDerWaalsContact CD1-CG1 3.46Å; I12-V28 HydrophobicContact CG1-CG1 4.09Å; L26-V28 WeakPolarHBondContact CD1-O 3.25Å; V28-T35 HydrophobicContact CG1-CG2 3.7Å; V28-I37 HydrophobicContact CG1-CG1 4.38Å; V28-I37 HydrophobicContact CG2-CG1 4.43Å
29	F	88.6	Confident	89	Confident	72 Å²	72	98.7 Å²	98.7	32%	0.316	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.6	146.9	-179.1	-58	-90.2	0	0	0	109.7	L26 T35 T36 R38	L26-F29 VanDerWaalsContact O-CZ 3.31Å; L26-F29 WeakPolarHBondContact O-CZ 3.4Å; F29-T35 CarbonylContact O-C 3.58Å; F29-T35 WeakPolarHBondContact O-CA 3.39Å; F29-T36 PolarHBondContact N-O 3.23Å; F29-T36 PolarHBondContact O-N 3.32Å; F29-R38 HydrophobicContact CD2-CG 3.91Å; F29-R38 HydrophobicContact CE2-CB 4.19Å; F29-R38 VanDerWaalsContact CE2-CD 3.41Å; F29-R38 HydrophobicContact CE2-CG 3.68Å
30	M	88.9	Confident	88.2	Confident	92 Å²	92	99.4 Å²	99.4	45%	0.453	51%	0.511	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.5	133.7	171.6	-73.4	173.8	76.8	0	0	109.6	I12 T34 T35	I12-M30 HydrophobicContact CB-SD 4.41Å; I12-M30 HydrophobicContact CD1-CB 4.47Å; I12-M30 HydrophobicContact CD1-CG 3.43Å; I12-M30 VanDerWaalsContact CD1-CG 3.43Å; I12-M30 HydrophobicContact CD1-SD 3.4Å; I12-M30 WeakPolarHBondContact CD1-SD 3.12Å; I12-M30 HydrophobicContact CG1-CG 4.27Å; I12-M30 HydrophobicContact CG1-SD 3.62Å; M30-T34 CarbonylContact C-O 3.57Å; M30-T34 WeakPolarHBondContact CA-O 3.07Å; M30-T35 HydrophobicContact CG-CG2 4.13Å
31	N	89.6	Confident	87.4	Confident	135 Å²	135	97.6 Å²	97.6	72%	0.722	51%	0.509	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-124.2	98.9	168.8	-174.1	9.4	0	0	0	108.2	N33 T34	N31-N33 PolarHBondContact O-N 3.11Å; N31-T34 PolarHBondContact N-O 2.78Å; N31-T34 WeakPolarHBondContact O-CB 3.42Å; N31-T34 PolarHBondContact O-N 3.3Å
32	G	89.6	Confident	86	Confident	59 Å²	59	95.6 Å²	95.6	61%	0.608	51%	0.508	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.9	-121.9	-170.8	0	0	0	0	0	111.6	T34	G32-T34 VanDerWaalsContact C-N 3.32Å
33	N	89.9	Confident	84.1	Confident	170 Å²	170	93.2 Å²	93.2	91%	0.909	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.2	-3.5	178.6	-62	-6.5	0	0	0	113	N31	N31-N33 PolarHBondContact O-N 3.11Å
34	T	89.9	Confident	81.9	Confident	90 Å²	90	90.5 Å²	90.5	55%	0.552	51%	0.505	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.9	125.7	-179.3	-56.5	0	0	0	0	109.8	M30 N31 G32	M30-T34 CarbonylContact C-O 3.57Å; M30-T34 WeakPolarHBondContact CA-O 3.07Å; N31-T34 PolarHBondContact N-O 2.78Å; N31-T34 WeakPolarHBondContact O-CB 3.42Å; N31-T34 PolarHBondContact O-N 3.3Å; G32-T34 VanDerWaalsContact C-N 3.32Å
35	T	89.3	Confident	79.4	Confident	54 Å²	54	95.3 Å²	95.3	33%	0.331	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	132	172.7	-54.6	0	0	0	0	109.2	V28 F29 M30	V28-T35 HydrophobicContact CG1-CG2 3.7Å; F29-T35 CarbonylContact O-C 3.58Å; F29-T35 WeakPolarHBondContact O-CA 3.39Å; M30-T35 HydrophobicContact CG-CG2 4.13Å
36	T	88.1	Confident	77.4	Confident	70 Å²	70	96.5 Å²	96.5	43%	0.429	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.1	134.3	-179.6	-50.8	0	0	0	0	109.4	F29	F29-T36 PolarHBondContact N-O 3.23Å; F29-T36 PolarHBondContact O-N 3.32Å
37	I	88	Confident	75	Confident	108 Å²	108	100.5 Å²	100.5	55%	0.554	56%	0.555	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-111.7	125.4	176.6	-56.4	173.9	0	0	0	107.3	I27 V28	I27-I37 HydrophobicContact CD1-CG2 4.32Å; I27-I37 WeakPolarHBondContact O-CA 3.41Å; V28-I37 HydrophobicContact CG1-CG1 4.38Å; V28-I37 HydrophobicContact CG2-CG1 4.43Å
38	R	83.2	Confident	72.4	Confident	150 Å²	150	101.9 Å²	101.9	57%	0.566	57%	0.574	S	S	*	*			trans	-94.4	148.6	172.8	-64	-170.9	-176.9	177.7	-2.8	109.7	I27 F29	I27-R38 WeakPolarHBondContact CB-O 3.3Å; I27-R38 PolarHBondContact O-N 3.21Å; F29-R38 HydrophobicContact CD2-CG 3.91Å; F29-R38 HydrophobicContact CE2-CB 4.19Å; F29-R38 VanDerWaalsContact CE2-CD 3.41Å; F29-R38 HydrophobicContact CE2-CG 3.68Å
39	H	80.2	Confident	70.1	Confident	68 Å²	68	107.6 Å²	107.6	32%	0.315	60%	0.603	S	S	.	*			trans	-82	133.9	172.9	-168.4	72.1	0	0	0	109	E41 S42 Y59	H39-E41 PolarHBondContact CD2-N 3.07Å; H39-E41 IonicContact NE2-OE2 2.71Å; H39-E41 PolarHBondContact O-N 3.38Å; H39-S42 PolarHBondContact O-N 3.29Å; H39-S42 PolarHBondContact O-OG 3.3Å; H39-Y59 AromaticContact CE1-CD2 3.99Å; H39-Y59 AromaticContact CE1-CE2 3.6Å; H39-Y59 AromaticContact ND1-CE2 3.91Å
40	P	75.9	Confident	67.9	Low	60 Å²	60	107.5 Å²	107.5	39%	0.39	61%	0.611	S	S	.	*	T	Hydrogen-bonded Turn	trans	-63.7	-27.3	-176.9	24.3	-33.8	0	0	0	113.2	I27	I27-P40 HydrophobicContact CG2-CB 4.21Å
41	E	74.4	Confident	65.6	Low	128 Å²	128	109.9 Å²	109.9	60%	0.598	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.6	-3.9	-179.2	-53.2	177.3	-174.1	0	0	113.2	H39 T43 Y61	H39-E41 PolarHBondContact CD2-N 3.07Å; H39-E41 IonicContact NE2-OE2 2.71Å; H39-E41 PolarHBondContact O-N 3.38Å; E41-T43 PolarHBondContact O-N 3.27Å; E41-Y61 PolarHBondContact OE1-OH 2.88Å
42	S	66	Low	63.4	Low	75 Å²	75	109.9 Å²	109.9	52%	0.524	63%	0.634	S	S	.	*			trans	-85.4	44.4	-177.6	68.6	0	0	0	0	113.2	H39	H39-S42 PolarHBondContact O-N 3.29Å; H39-S42 PolarHBondContact O-OG 3.3Å
43	T	53.7	Low	61.2	Low	121 Å²	121	115.4 Å²	115.4	74%	0.742	64%	0.644	S	S	*	*			trans	-80.6	-10.1	-176.8	-45.6	0	0	0	0	113.6	E41	E41-T43 PolarHBondContact O-N 3.27Å
44	S	44.4	Very low	58.7	Low	92 Å²	92	114.7 Å²	114.7	64%	0.643	64%	0.64	S	S	*	*	S	Bend	trans	-146.7	101.1	-173.3	48.8	0	0	0	0	113.3
45	N	35.3	Very low	56.3	Low	147 Å²	147	115.9 Å²	115.9	79%	0.786	65%	0.647	S	S	*	*			trans	66.7	133.9	175.9	-52.2	-55.3	0	0	0	113.2
46	I	45.6	Very low	53.7	Low	151 Å²	151	118.4 Å²	118.4	77%	0.774	67%	0.666	S	S	*	*				-172.3	126.3	101.2	-78.7	144.4	0	0	0	107.2
47	L	37.1	Very low	51.3	Low	172 Å²	172	124.5 Å²	124.5	90%	0.901	68%	0.681	S	S	*	*			trans	-59.6	134.5	160.4	-68.8	160.1	0	0	0	108.7
48	A	35.5	Very low	49.2	Very low	84 Å²	84	126.6 Å²	126.6	69%	0.694	69%	0.692	S	S	*	*			trans	70.6	110.2	172.7	0	0	0	0	0	116.5
49	L	39.5	Very low	47.1	Very low	162 Å²	162	126.3 Å²	126.3	85%	0.848	69%	0.692	S	S	*	*				-162.3	107.2	122.9	-99.8	147.5	0	0	0	106.8	C51	L49-C51 PolarHBondContact O-N 3.21Å
50	S	41.9	Very low	45	Very low	70 Å²	70	128.2 Å²	128.2	49%	0.49	71%	0.71	S	S	.	*			trans	-22.6	127.7	153.9	48.7	0	0	0	0	113.1	L52	S50-L52 PolarHBondContact O-N 2.94Å
51	C	41	Very low	43.2	Very low	141 Å²	141	134 Å²	134	95%	0.953	73%	0.725	S	S	*	*			trans	-67.5	59.7	141.6	-75.9	0	0	0	0	108.5	L49	L49-C51 PolarHBondContact O-N 3.21Å
52	L	42.8	Very low	41.3	Very low	136 Å²	136	137.5 Å²	137.5	71%	0.712	76%	0.755	S	S	*	*			trans	-83.4	130.3	144.9	-93.7	146.9	0	0	0	102.5	S50	S50-L52 PolarHBondContact O-N 2.94Å
53	E	43.9	Very low	40.1	Very low	175 Å²	175	140.7 Å²	140.7	82%	0.818	77%	0.766	S	S	*	*	S	Bend	trans	86	90.3	-176.2	-49.5	-176.7	162.1	0	0	113.5
54	D	36.7	Very low	39.4	Very low	154 Å²	154	141.7 Å²	141.7	82%	0.824	77%	0.768	S	S	*	*			trans	-3.2	147.6	136.9	-60.3	-59.1	0	0	0	116.3
55	V	39.7	Very low	39.1	Very low	116 Å²	116	144.4 Å²	144.4	70%	0.703	78%	0.775	S	S	*	*			trans	94.4	84.4	178.7	-163.1	0	0	0	0	112.4	R57	V55-R57 HydrophobicContact CG1-CG 3.93Å; V55-R57 PolarHBondContact O-N 3.43Å
56	C	35.3	Very low	39.3	Very low	106 Å²	106	144.3 Å²	144.3	72%	0.716	77%	0.774	S	S	*	*			trans	-49.9	90.9	140	-91	0	0	0	0	107.4	I58	C56-I58 PolarHBondContact O-N 3.48Å
57	R	38.3	Very low	38.9	Very low	199 Å²	199	143.9 Å²	143.9	75%	0.751	77%	0.774	S	S	*	*			trans	-63.5	93.4	158.9	-89.6	-177.8	175.7	161	0	104.4	V55 Y59	V55-R57 HydrophobicContact CG1-CG 3.93Å; V55-R57 PolarHBondContact O-N 3.43Å; R57-Y59 PolarHBondContact O-N 3.47Å
58	I	42.9	Very low	39.1	Very low	152 Å²	152	142 Å²	142	78%	0.779	77%	0.766	S	S	*	*			trans	-55.8	93.4	159.5	-61.6	170.4	0	0	0	103.7	C56 P60	C56-I58 PolarHBondContact O-N 3.48Å; I58-P60 WeakPolarHBondContact O-CD 3.47Å
59	Y	39.6	Very low	39.3	Very low	144 Å²	144	146.1 Å²	146.1	57%	0.565	77%	0.771	S	S	*	*			trans	-55.4	112.8	174.5	-86.1	-86.9	0	0	0	106.5	H39 R57 Y61	H39-Y59 AromaticContact CE1-CD2 3.99Å; H39-Y59 AromaticContact CE1-CE2 3.6Å; H39-Y59 AromaticContact ND1-CE2 3.91Å; R57-Y59 PolarHBondContact O-N 3.47Å; Y59-Y61 VanDerWaalsContact C-N 3.26Å; Y59-Y61 PolarHBondContact O-N 2.69Å
60	P	35.6	Very low	39.3	Very low	107 Å²	107	144.9 Å²	144.9	70%	0.695	77%	0.765	S	S	*	*			trans	-78.4	89.1	173.1	31.5	-25.1	0	0	0	105.6	I58 V62	I58-P60 WeakPolarHBondContact O-CD 3.47Å; P60-V62 PolarHBondContact O-N 3.42Å; P60-V62 VanDerWaalsContact O-N 3.08Å
61	Y	38.9	Very low	39.1	Very low	183 Å²	183	151.2 Å²	151.2	72%	0.718	79%	0.788	S	S	*	*			trans	-76.1	90.9	160.1	-93.3	-80.1	0	0	0	106.9	E41 Y59	E41-Y61 PolarHBondContact OE1-OH 2.88Å; Y59-Y61 VanDerWaalsContact C-N 3.26Å; Y59-Y61 PolarHBondContact O-N 2.69Å
62	V	34.3	Very low	38.9	Very low	201 Å²	201	152.1 Å²	152.1	100%	1.218	77%	0.773	S	S	*	*			trans	-67.1	0	156.2	-158.2	0	0	0	0	108.1	P60	P60-V62 PolarHBondContact O-N 3.42Å; P60-V62 VanDerWaalsContact O-N 3.08Å

Retrieved 62 of 62 residues in 142.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).