A0A5K4FAV7_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4FAV7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 80 aa.

						>A0A5K4FAV7_SCHMA|A0A5K4FAV7
MSVVPTIKHFIIINTYVFRDAFKLFDCTNNLTLLRFRPQLITSTTDHITTEGIISQTENVTHPILTVQDVYRIGNETKLI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.5	Very low	43.4	Very low	242 Å²	242	109.9 Å²	109.9	100%	1.192	59%	0.591	S	S	*	*				0	120.1	0	-91.1	167.2	150.7	0	0	107.8
2	S	34.8	Very low	43.7	Very low	121 Å²	121	110.1 Å²	110.1	85%	0.846	59%	0.589	S	S	*	*			trans	-85.3	118	173.7	-155	0	0	0	0	107.9	V4	S2-V4 PolarHBondContact O-N 3.03Å
3	V	40.5	Very low	43.7	Very low	84 Å²	84	107.9 Å²	107.9	51%	0.509	58%	0.576	S	S	.	*			trans	-77.1	114.8	178.7	-177.2	0	0	0	0	107.7	P5 T28	V3-P5 WeakPolarHBondContact O-CD 3.42Å; V3-T28 HydrophobicContact CG1-CG2 4.38Å
4	V	42.3	Very low	43.6	Very low	120 Å²	120	107.5 Å²	107.5	73%	0.727	57%	0.574	S	S	*	*	P	Polyproline II helix	trans	-78	119.9	174.1	-179.7	0	0	0	0	108.1	S2 T6	S2-V4 PolarHBondContact O-N 3.03Å; V4-T6 PolarHBondContact O-N 3.25Å
5	P	44.7	Very low	43.1	Very low	59 Å²	59	106 Å²	106	38%	0.383	57%	0.571	S	S	.	*	P	Polyproline II helix	trans	-63.5	124.2	176.5	-19	31.6	0	0	0	109.9	V3 F25	V3-P5 WeakPolarHBondContact O-CD 3.42Å; P5-F25 HydrophobicContact CB-CB 4.41Å; P5-F25 HydrophobicContact CB-CD1 3.74Å
6	T	40.3	Very low	42.7	Very low	90 Å²	90	114.4 Å²	114.4	55%	0.552	59%	0.594	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-90.9	116.9	171.5	-53.3	0	0	0	0	108.4	V4 K8	V4-T6 PolarHBondContact O-N 3.25Å; T6-K8 PolarHBondContact O-N 2.92Å
7	I	49.4	Very low	42.4	Very low	75 Å²	75	114.2 Å²	114.2	39%	0.385	60%	0.598	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-71.9	115.1	172.6	-61	171.6	0	0	0	107.2	F10 F25	I7-F10 HydrophobicContact CG2-CD2 4.45Å; I7-F10 HydrophobicContact CG2-CE2 3.95Å; I7-F10 HydrophobicContact CG2-CZ 4.39Å; I7-F25 HydrophobicContact CD1-CE1 3.72Å; I7-F25 HydrophobicContact CD1-CZ 4.13Å; I7-F25 HydrophobicContact CG1-CD1 3.78Å; I7-F25 HydrophobicContact CG1-CE1 3.4Å; I7-F25 VanDerWaalsContact CG1-CE1 3.4Å; I7-F25 HydrophobicContact CG1-CZ 4.13Å
8	K	45.7	Very low	42.2	Very low	117 Å²	117	115.8 Å²	115.8	51%	0.509	60%	0.6	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-95.6	-37.6	179.3	-71.1	-178.7	177.7	169.6	0	112.8	T6 D26	T6-K8 PolarHBondContact O-N 2.92Å; K8-D26 HydrophobicContact CD-CB 4.34Å; K8-D26 IonicContact NZ-OD2 2.72Å; K8-D26 PolarHBondContact NZ-OD2 3.01Å
9	H	47.7	Very low	42.6	Very low	105 Å²	105	115.8 Å²	115.8	49%	0.486	59%	0.592	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-150.1	146	-173.2	-60.9	101	0	0	0	113
10	F	47.8	Very low	42.9	Very low	132 Å²	132	111.3 Å²	111.3	58%	0.579	57%	0.569	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-103.9	127.5	166.2	-74.6	-95.9	0	0	0	108.5	I7 K23	I7-F10 HydrophobicContact CG2-CD2 4.45Å; I7-F10 HydrophobicContact CG2-CE2 3.95Å; I7-F10 HydrophobicContact CG2-CZ 4.39Å; F10-K23 HydrophobicContact CD1-CG 4.06Å; F10-K23 HydrophobicContact CE1-CD 4.13Å; F10-K23 HydrophobicContact CE1-CG 3.75Å
11	I	48.5	Very low	43.2	Very low	64 Å²	64	107.2 Å²	107.2	33%	0.328	55%	0.552	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-110.4	118.9	171.8	-59.5	174.6	0	0	0	107.7	I13 F22	I11-I13 HydrophobicContact CG2-CD1 4.46Å; I11-I13 HydrophobicContact CG2-CG1 3.91Å; I11-F22 PolarHBondContact N-O 2.69Å; I11-F22 PolarHBondContact O-N 3.41Å; I11-F22 VanDerWaalsContact O-N 3.09Å
12	I	47.4	Very low	44	Very low	112 Å²	112	98 Å²	98	57%	0.574	51%	0.505	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.1	111.5	173.1	-57.6	175.1	0	0	0	107.2
13	I	44	Very low	44.8	Very low	82 Å²	82	95 Å²	95	42%	0.421	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98	100.7	172.4	-52.8	-179.5	0	0	0	107.3	I11 T15 F22	I11-I13 HydrophobicContact CG2-CD1 4.46Å; I11-I13 HydrophobicContact CG2-CG1 3.91Å; I13-T15 PolarHBondContact O-N 2.69Å; I13-F22 HydrophobicContact CD1-CD2 4.28Å; I13-F22 HydrophobicContact CD1-CE2 4.09Å
14	N	41.3	Very low	45.3	Very low	102 Å²	102	92.5 Å²	92.5	55%	0.545	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.2	96.4	166.4	-92.1	-55.5	0	0	0	108.2	R19	N14-R19 WeakPolarHBondContact OD1-CG 2.99Å; N14-R19 PolarHBondContact OD1-NE 2.73Å
15	T	36.4	Very low	45.7	Very low	85 Å²	85	88.7 Å²	88.7	52%	0.521	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.6	134.5	161	-38.1	0	0	0	0	107	I13 V17 F18	I13-T15 PolarHBondContact O-N 2.69Å; T15-V17 PolarHBondContact O-N 3.2Å; T15-F18 CarbonylContact O-C 3.6Å; T15-F18 PolarHBondContact O-N 3.01Å; T15-F18 VanDerWaalsContact O-N 3.1Å
16	Y	36.4	Very low	45.7	Very low	240 Å²	240	88.9 Å²	88.9	94%	0.941	43%	0.432	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.7	0.6	-175	-80.7	-91.6	0	0	0	116.5
17	V	38.5	Very low	45.8	Very low	111 Å²	111	86.4 Å²	86.4	67%	0.673	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	trans	-132.4	-22.2	-174	-164.4	0	0	0	0	112.5	T15	T15-V17 PolarHBondContact O-N 3.2Å
18	F	38.7	Very low	45.8	Very low	144 Å²	144	87.6 Å²	87.6	63%	0.632	43%	0.429	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-152.4	119.6	179.5	-66.3	-80.1	0	0	0	109.9	T15 D20	T15-F18 CarbonylContact O-C 3.6Å; T15-F18 PolarHBondContact O-N 3.01Å; T15-F18 VanDerWaalsContact O-N 3.1Å; F18-D20 PolarHBondContact O-N 3.38Å
19	R	49.8	Very low	45.7	Very low	116 Å²	116	88.5 Å²	88.5	44%	0.438	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.9	104.6	165.7	-88.3	-172.7	172.9	-177	0.8	106.8	N14 P38	N14-R19 WeakPolarHBondContact OD1-CG 2.99Å; N14-R19 PolarHBondContact OD1-NE 2.73Å; R19-P38 HydrophobicContact CB-CG 3.46Å; R19-P38 VanDerWaalsContact CB-CG 3.46Å; R19-P38 WeakPolarHBondContact O-CD 3.23Å; R19-P38 VanDerWaalsContact O-CG 3.23Å; R19-P38 WeakPolarHBondContact O-CG 3.08Å
20	D	48.9	Very low	45.4	Very low	25 Å²	25	88.2 Å²	88.2	13%	0.134	44%	0.441	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.3	127.6	161.5	-77.6	-52.1	0	0	0	107.3	F18 F22 R35 F36 R37	F18-D20 PolarHBondContact O-N 3.38Å; D20-F22 HydrophobicContact CB-CE2 3.73Å; D20-F22 HydrophobicContact CB-CZ 3.94Å; D20-R35 VanDerWaalsContact CG-NE 3.3Å; D20-R35 IonicContact OD1-CZ 3.57Å; D20-R35 IonicContact OD1-NE 2.86Å; D20-R35 PolarHBondContact OD1-NE 2.93Å; D20-R35 IonicContact OD1-NH2 3.42Å; D20-R35 PolarHBondContact OD1-NH2 3.09Å; D20-R35 IonicContact OD2-CZ 3.41Å; D20-R35 IonicContact OD2-NE 3.31Å; D20-R35 PolarHBondContact OD2-NE 3.1Å; D20-R35 IonicContact OD2-NH2 2.72Å; D20-R35 PolarHBondContact OD2-NH2 2.96Å; D20-F36 WeakPolarHBondContact CA-O 3.42Å; D20-R37 WeakPolarHBondContact OD1-CG 3.42Å
21	A	48.8	Very low	45.3	Very low	25 Å²	25	85 Å²	85	21%	0.207	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	139.1	170.5	0	0	0	0	0	109.3	F36	A21-F36 HydrophobicContact CB-CB 4.2Å; A21-F36 PolarHBondContact N-O 2.81Å; A21-F36 WeakPolarHBondContact O-CD2 3.29Å; A21-F36 PolarHBondContact O-N 3.35Å
22	F	52.3	Low	45.2	Very low	49 Å²	49	84 Å²	84	22%	0.215	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118	125	179.1	-61.6	-88.3	0	0	0	110.1	I11 I13 D20 L33 L34 R35	I11-F22 PolarHBondContact N-O 2.69Å; I11-F22 PolarHBondContact O-N 3.41Å; I11-F22 VanDerWaalsContact O-N 3.09Å; I13-F22 HydrophobicContact CD1-CD2 4.28Å; I13-F22 HydrophobicContact CD1-CE2 4.09Å; D20-F22 HydrophobicContact CB-CE2 3.73Å; D20-F22 HydrophobicContact CB-CZ 3.94Å; F22-L33 HydrophobicContact CB-CD2 4.09Å; F22-L33 HydrophobicContact CD1-CB 4.34Å; F22-L33 HydrophobicContact CD1-CD2 4.31Å; F22-L33 HydrophobicContact CG-CD2 4.47Å; F22-L34 VanDerWaalsContact CA-O 3.29Å; F22-L34 WeakPolarHBondContact CA-O 3.07Å; F22-R35 HydrophobicContact CD1-CB 4.26Å; F22-R35 HydrophobicContact CE1-CB 3.9Å; F22-R35 HydrophobicContact CE1-CG 3.87Å; F22-R35 HydrophobicContact CZ-CG 4.24Å
23	K	50.6	Low	45.4	Very low	58 Å²	58	80.2 Å²	80.2	25%	0.252	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	126.9	164.8	-75.3	178.2	-174.3	174.8	0	109.1	F10 F25 T32 L34 F36	F10-K23 HydrophobicContact CD1-CG 4.06Å; F10-K23 HydrophobicContact CE1-CD 4.13Å; F10-K23 HydrophobicContact CE1-CG 3.75Å; K23-F25 HydrophobicContact CB-CD2 4.29Å; K23-F25 HydrophobicContact CB-CE2 3.61Å; K23-F25 HydrophobicContact CB-CZ 4.25Å; K23-F25 HydrophobicContact CD-CE2 4.22Å; K23-F25 HydrophobicContact CD-CZ 4.13Å; K23-T32 VanDerWaalsContact O-O 3.06Å; K23-L34 HydrophobicContact CB-CB 4.29Å; K23-L34 PolarHBondContact N-O 3.38Å; K23-L34 VanDerWaalsContact N-O 3.13Å; K23-L34 PolarHBondContact O-N 2.99Å; K23-L34 VanDerWaalsContact O-N 3.1Å; K23-F36 HydrophobicContact CB-CE2 3.89Å; K23-F36 HydrophobicContact CD-CE2 3.61Å; K23-F36 HydrophobicContact CD-CZ 3.86Å; K23-F36 HydrophobicContact CG-CD2 4.39Å; K23-F36 HydrophobicContact CG-CE2 3.56Å; K23-F36 HydrophobicContact CG-CZ 4.33Å
24	L	51.9	Low	45.7	Very low	32 Å²	32	77.4 Å²	77.4	17%	0.168	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	116.4	174.6	-152.2	84.5	0	0	0	109	L31 L33	L24-L31 HydrophobicContact CD1-CD1 3.39Å; L24-L31 HydrophobicContact CD1-CD2 3.84Å; L24-L31 HydrophobicContact CD1-CG 3.66Å; L24-L31 HydrophobicContact CD2-CD1 3.75Å; L24-L31 HydrophobicContact CG-CD1 3.47Å; L24-L31 VanDerWaalsContact CG-CD1 3.47Å; L24-L31 HydrophobicContact CG-CG 4.2Å; L24-L33 HydrophobicContact CD1-CD2 3.78Å
25	F	50.6	Low	46	Very low	39 Å²	39	75.9 Å²	75.9	17%	0.171	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.8	123.8	167.2	-62	-94.2	0	0	0	108.8	P5 I7 K23 T32 L34	P5-F25 HydrophobicContact CB-CB 4.41Å; P5-F25 HydrophobicContact CB-CD1 3.74Å; I7-F25 HydrophobicContact CD1-CE1 3.72Å; I7-F25 HydrophobicContact CD1-CZ 4.13Å; I7-F25 HydrophobicContact CG1-CD1 3.78Å; I7-F25 HydrophobicContact CG1-CE1 3.4Å; I7-F25 VanDerWaalsContact CG1-CE1 3.4Å; I7-F25 HydrophobicContact CG1-CZ 4.13Å; K23-F25 HydrophobicContact CB-CD2 4.29Å; K23-F25 HydrophobicContact CB-CE2 3.61Å; K23-F25 HydrophobicContact CB-CZ 4.25Å; K23-F25 HydrophobicContact CD-CE2 4.22Å; K23-F25 HydrophobicContact CD-CZ 4.13Å; F25-T32 PolarHBondContact N-O 3.09Å; F25-T32 VanDerWaalsContact N-O 3.11Å; F25-T32 PolarHBondContact O-N 2.86Å; F25-T32 VanDerWaalsContact O-N 3.15Å; F25-L34 HydrophobicContact CD2-CD1 4.31Å; F25-L34 HydrophobicContact CD2-CG 4.28Å; F25-L34 HydrophobicContact CE2-CD1 3.45Å; F25-L34 VanDerWaalsContact CE2-CD1 3.45Å; F25-L34 HydrophobicContact CE2-CG 3.83Å; F25-L34 HydrophobicContact CZ-CD1 4.11Å
26	D	45.3	Very low	46.7	Very low	63 Å²	63	72.4 Å²	72.4	34%	0.337	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.2	106.7	168.5	-178.8	1.8	0	0	0	107.7	K8	K8-D26 HydrophobicContact CD-CB 4.34Å; K8-D26 IonicContact NZ-OD2 2.72Å; K8-D26 PolarHBondContact NZ-OD2 3.01Å
27	C	42	Very low	47.3	Very low	38 Å²	38	67.2 Å²	67.2	26%	0.257	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	81.2	173.4	-74.8	0	0	0	0	109	N29 N30	C27-N29 PolarHBondContact O-N 2.72Å; C27-N30 PolarHBondContact N-O 3.31Å; C27-N30 PolarHBondContact O-N 3.42Å; C27-N30 VanDerWaalsContact O-N 3.16Å
28	T	48.8	Very low	47.6	Very low	101 Å²	101	63.6 Å²	63.6	62%	0.62	32%	0.315	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.4	-10.9	164.5	21.5	0	0	0	0	118.8	V3	V3-T28 HydrophobicContact CG1-CG2 4.38Å
29	N	43.9	Very low	47.8	Very low	136 Å²	136	63 Å²	63	73%	0.727	31%	0.314	S	S	*	.	T	Hydrogen-bonded Turn	trans	-176.5	-4.1	175.2	-84.6	-31	0	0	0	113	C27	C27-N29 PolarHBondContact O-N 2.72Å
30	N	40.8	Very low	47.4	Very low	99 Å²	99	65.4 Å²	65.4	53%	0.529	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	138.8	-176.9	-68.8	-36.4	0	0	0	112.3	C27	C27-N30 PolarHBondContact N-O 3.31Å; C27-N30 PolarHBondContact O-N 3.42Å; C27-N30 VanDerWaalsContact O-N 3.16Å
31	L	46.7	Very low	46.8	Very low	64 Å²	64	68.9 Å²	68.9	34%	0.335	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.1	110	168.1	-160.6	75.8	0	0	0	109	L24 L33	L24-L31 HydrophobicContact CD1-CD1 3.39Å; L24-L31 HydrophobicContact CD1-CD2 3.84Å; L24-L31 HydrophobicContact CD1-CG 3.66Å; L24-L31 HydrophobicContact CD2-CD1 3.75Å; L24-L31 HydrophobicContact CG-CD1 3.47Å; L24-L31 VanDerWaalsContact CG-CD1 3.47Å; L24-L31 HydrophobicContact CG-CG 4.2Å; L31-L33 HydrophobicContact CD2-CG 4.45Å
32	T	45.8	Very low	46.1	Very low	43 Å²	43	73.6 Å²	73.6	26%	0.264	38%	0.379	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.6	120.6	169.8	-54	0	0	0	0	109	K23 F25 L34	K23-T32 VanDerWaalsContact O-O 3.06Å; F25-T32 PolarHBondContact N-O 3.09Å; F25-T32 VanDerWaalsContact N-O 3.11Å; F25-T32 PolarHBondContact O-N 2.86Å; F25-T32 VanDerWaalsContact O-N 3.15Å; T32-L34 HydrophobicContact CG2-CD2 4.29Å
33	L	51.1	Low	45.4	Very low	33 Å²	33	74.1 Å²	74.1	17%	0.173	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.7	111.1	171.6	-71.6	165.3	0	0	0	108.5	F22 L24 L31	F22-L33 HydrophobicContact CB-CD2 4.09Å; F22-L33 HydrophobicContact CD1-CB 4.34Å; F22-L33 HydrophobicContact CD1-CD2 4.31Å; F22-L33 HydrophobicContact CG-CD2 4.47Å; L24-L33 HydrophobicContact CD1-CD2 3.78Å; L31-L33 HydrophobicContact CD2-CG 4.45Å
34	L	50.5	Low	44.6	Very low	23 Å²	23	78.5 Å²	78.5	12%	0.12	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.7	111.3	166.2	-64.8	-173	0	0	0	108.7	F22 K23 F25 T32 F36 T57 N59	F22-L34 VanDerWaalsContact CA-O 3.29Å; F22-L34 WeakPolarHBondContact CA-O 3.07Å; K23-L34 HydrophobicContact CB-CB 4.29Å; K23-L34 PolarHBondContact N-O 3.38Å; K23-L34 VanDerWaalsContact N-O 3.13Å; K23-L34 PolarHBondContact O-N 2.99Å; K23-L34 VanDerWaalsContact O-N 3.1Å; F25-L34 HydrophobicContact CD2-CD1 4.31Å; F25-L34 HydrophobicContact CD2-CG 4.28Å; F25-L34 HydrophobicContact CE2-CD1 3.45Å; F25-L34 VanDerWaalsContact CE2-CD1 3.45Å; F25-L34 HydrophobicContact CE2-CG 3.83Å; F25-L34 HydrophobicContact CZ-CD1 4.11Å; T32-L34 HydrophobicContact CG2-CD2 4.29Å; L34-F36 HydrophobicContact CB-CD2 4.4Å; L34-F36 HydrophobicContact CB-CE2 3.52Å; L34-F36 HydrophobicContact CB-CZ 3.64Å; L34-F36 HydrophobicContact CD1-CE2 4.4Å; L34-F36 HydrophobicContact CD1-CZ 3.84Å; L34-F36 HydrophobicContact CG-CZ 4.41Å; L34-F36 WeakPolarHBondContact O-CD2 3.44Å; L34-F36 WeakPolarHBondContact O-CE2 3.4Å; L34-T57 HydrophobicContact CD1-CG2 4.3Å; L34-T57 HydrophobicContact CD2-CG2 3.63Å; L34-T57 HydrophobicContact CG-CG2 4.48Å; L34-N59 WeakPolarHBondContact CD2-OD1 3.45Å
35	R	48.9	Very low	44	Very low	69 Å²	69	80.3 Å²	80.3	26%	0.26	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.7	128	171.9	-172.8	-177.1	-175.4	170.8	12	109.1	D20 F22	D20-R35 VanDerWaalsContact CG-NE 3.3Å; D20-R35 IonicContact OD1-CZ 3.57Å; D20-R35 IonicContact OD1-NE 2.86Å; D20-R35 PolarHBondContact OD1-NE 2.93Å; D20-R35 IonicContact OD1-NH2 3.42Å; D20-R35 PolarHBondContact OD1-NH2 3.09Å; D20-R35 IonicContact OD2-CZ 3.41Å; D20-R35 IonicContact OD2-NE 3.31Å; D20-R35 PolarHBondContact OD2-NE 3.1Å; D20-R35 IonicContact OD2-NH2 2.72Å; D20-R35 PolarHBondContact OD2-NH2 2.96Å; F22-R35 HydrophobicContact CD1-CB 4.26Å; F22-R35 HydrophobicContact CE1-CB 3.9Å; F22-R35 HydrophobicContact CE1-CG 3.87Å; F22-R35 HydrophobicContact CZ-CG 4.24Å
36	F	51.1	Low	43.5	Very low	12 Å²	12	86.2 Å²	86.2	5%	0.053	47%	0.466	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.5	123.7	171.3	-61	-75	0	0	0	108.6	D20 A21 K23 L34 P38 I53	D20-F36 WeakPolarHBondContact CA-O 3.42Å; A21-F36 HydrophobicContact CB-CB 4.2Å; A21-F36 PolarHBondContact N-O 2.81Å; A21-F36 WeakPolarHBondContact O-CD2 3.29Å; A21-F36 PolarHBondContact O-N 3.35Å; K23-F36 HydrophobicContact CB-CE2 3.89Å; K23-F36 HydrophobicContact CD-CE2 3.61Å; K23-F36 HydrophobicContact CD-CZ 3.86Å; K23-F36 HydrophobicContact CG-CD2 4.39Å; K23-F36 HydrophobicContact CG-CE2 3.56Å; K23-F36 HydrophobicContact CG-CZ 4.33Å; L34-F36 HydrophobicContact CB-CD2 4.4Å; L34-F36 HydrophobicContact CB-CE2 3.52Å; L34-F36 HydrophobicContact CB-CZ 3.64Å; L34-F36 HydrophobicContact CD1-CE2 4.4Å; L34-F36 HydrophobicContact CD1-CZ 3.84Å; L34-F36 HydrophobicContact CG-CZ 4.41Å; L34-F36 WeakPolarHBondContact O-CD2 3.44Å; L34-F36 WeakPolarHBondContact O-CE2 3.4Å; F36-P38 WeakPolarHBondContact O-CD 3.34Å; F36-I53 HydrophobicContact CB-CG2 4.28Å; F36-I53 HydrophobicContact CD1-CG2 4.15Å; F36-I53 HydrophobicContact CG-CG2 4.42Å
37	R	49.6	Very low	43.2	Very low	131 Å²	131	89.5 Å²	89.5	49%	0.494	48%	0.479	S	S	.	.			trans	-94.5	94.9	164.8	-70.7	-174.9	-179.5	176.2	6.7	108.4	D20 Q39	D20-R37 WeakPolarHBondContact OD1-CG 3.42Å; R37-Q39 PolarHBondContact O-N 3.24Å
38	P	43.7	Very low	43.1	Very low	36 Å²	36	91.4 Å²	91.4	23%	0.234	49%	0.486	C	S	.	.			trans	-52.2	113.4	162.5	20.9	-34.2	0	0	0	108.6	R19 F36 L40	R19-P38 HydrophobicContact CB-CG 3.46Å; R19-P38 VanDerWaalsContact CB-CG 3.46Å; R19-P38 WeakPolarHBondContact O-CD 3.23Å; R19-P38 VanDerWaalsContact O-CG 3.23Å; R19-P38 WeakPolarHBondContact O-CG 3.08Å; F36-P38 WeakPolarHBondContact O-CD 3.34Å; P38-L40 PolarHBondContact O-N 3.29Å
39	Q	42.6	Very low	42.5	Very low	132 Å²	132	91 Å²	91	62%	0.617	48%	0.484	S	S	*	.			trans	-55.8	135.8	156.4	-72.4	-176.4	-5.9	0	0	106.5	R37 I41	R37-Q39 PolarHBondContact O-N 3.24Å; Q39-I41 VanDerWaalsContact C-N 3.25Å; Q39-I41 PolarHBondContact O-N 3.5Å
40	L	41.1	Very low	42.3	Very low	166 Å²	166	90 Å²	90	87%	0.869	48%	0.483	S	S	*	.			trans	-55.9	88.6	-178.7	-175.7	77.2	0	0	0	109.7	P38	P38-L40 PolarHBondContact O-N 3.29Å
41	I	37.3	Very low	42.1	Very low	98 Å²	98	94 Å²	94	50%	0.503	50%	0.498	S	S	.	.			trans	-83.3	114.8	161	-56.8	-176.6	0	0	0	103.8	Q39 S43 G52	Q39-I41 VanDerWaalsContact C-N 3.25Å; Q39-I41 PolarHBondContact O-N 3.5Å; I41-S43 PolarHBondContact O-N 3.41Å; I41-G52 WeakPolarHBondContact CD1-O 3.26Å
42	T	34.8	Very low	41.4	Very low	123 Å²	123	91.9 Å²	91.9	76%	0.755	49%	0.492	S	S	*	.			trans	-60.8	80.9	169.3	49.3	0	0	0	0	108.6
43	S	35.9	Very low	41	Very low	61 Å²	61	92.3 Å²	92.3	43%	0.427	49%	0.492	S	S	.	.			trans	-89.1	118.6	172.2	-165.2	0	0	0	0	107.8	I41 T45	I41-S43 PolarHBondContact O-N 3.41Å; S43-T45 PolarHBondContact O-N 2.7Å; S43-T45 PolarHBondContact OG-OG1 3.25Å
44	T	35.6	Very low	40.3	Very low	149 Å²	149	96.3 Å²	96.3	91%	0.914	51%	0.512	S	S	*	.	S	Bend	trans	-78.6	13.5	174.2	47.5	0	0	0	0	112.5
45	T	37.5	Very low	39.8	Very low	71 Å²	71	97.9 Å²	97.9	44%	0.436	53%	0.525	S	S	.	.	S	Bend	trans	-126.2	143.3	-178.5	61.6	0	0	0	0	110.4	S43 H47	S43-T45 PolarHBondContact O-N 2.7Å; S43-T45 PolarHBondContact OG-OG1 3.25Å; T45-H47 PolarHBondContact O-N 3.4Å; T45-H47 PolarHBondContact OG1-O 3.1Å
46	D	41.4	Very low	39.3	Very low	162 Å²	162	101.4 Å²	101.4	87%	0.866	55%	0.545	S	S	*	.	S	Bend	trans	-68.7	11.2	179.2	-68.7	-41.8	0	0	0	113.7
47	H	38.8	Very low	38.9	Very low	133 Å²	133	104.8 Å²	104.8	62%	0.616	57%	0.566	S	S	*	*			trans	-128.4	116.4	-173.7	-20.8	-57.7	0	0	0	108.4	T45	T45-H47 PolarHBondContact O-N 3.4Å; T45-H47 PolarHBondContact OG1-O 3.1Å
48	I	38.9	Very low	38.6	Very low	77 Å²	77	103.1 Å²	103.1	40%	0.395	56%	0.564	S	S	.	*			trans	-84.1	114.8	168.6	-53.5	174.1	0	0	0	106.7	I53	I48-I53 HydrophobicContact CG2-CD1 4.45Å; I48-I53 HydrophobicContact CG2-CG1 4.24Å
49	T	37.1	Very low	38.7	Very low	94 Å²	94	107.5 Å²	107.5	58%	0.577	59%	0.585	S	S	*	*			trans	-74.2	143.4	168.7	53	0	0	0	0	109.4	E51 G52	T49-E51 PolarHBondContact O-N 3.13Å; T49-G52 PolarHBondContact O-N 3.48Å; T49-G52 VanDerWaalsContact O-N 3.09Å
50	T	39.1	Very low	38.7	Very low	114 Å²	114	103.7 Å²	103.7	70%	0.699	57%	0.571	S	S	*	*	G	3₁₀ helix	trans	-57.3	-19.8	-179.9	41.6	0	0	0	0	113.6	G52	T50-G52 VanDerWaalsContact C-N 3.32Å; T50-G52 PolarHBondContact O-N 2.95Å
51	E	36.6	Very low	38.8	Very low	183 Å²	183	101.3 Å²	101.3	86%	0.855	56%	0.564	S	S	*	*	G	3₁₀ helix	trans	-72.6	-21.1	180	-60.1	-176.5	161.9	0	0	113.3	T49	T49-E51 PolarHBondContact O-N 3.13Å
52	G	32.4	Very low	39	Very low	20 Å²	20	100.7 Å²	100.7	21%	0.206	56%	0.559	C	S	.	*	G	3₁₀ helix	trans	-87.2	-1.2	178.8	0	0	0	0	0	114.8	I41 T49 T50 I54	I41-G52 WeakPolarHBondContact CD1-O 3.26Å; T49-G52 PolarHBondContact O-N 3.48Å; T49-G52 VanDerWaalsContact O-N 3.09Å; T50-G52 VanDerWaalsContact C-N 3.32Å; T50-G52 PolarHBondContact O-N 2.95Å; G52-I54 PolarHBondContact O-N 3.11Å
53	I	37.5	Very low	38.9	Very low	52 Å²	52	100.4 Å²	100.4	27%	0.267	56%	0.559	S	S	.	*			trans	-92.4	89.7	-174.9	-50.7	-178.6	0	0	0	109.3	F36 I48 S55	F36-I53 HydrophobicContact CB-CG2 4.28Å; F36-I53 HydrophobicContact CD1-CG2 4.15Å; F36-I53 HydrophobicContact CG-CG2 4.42Å; I48-I53 HydrophobicContact CG2-CD1 4.45Å; I48-I53 HydrophobicContact CG2-CG1 4.24Å; I53-S55 VanDerWaalsContact C-N 3.26Å; I53-S55 PolarHBondContact O-N 3.27Å
54	I	37.2	Very low	38.9	Very low	117 Å²	117	103.3 Å²	103.3	60%	0.6	57%	0.568	S	S	*	*			trans	-70.2	91.9	160.5	-58.4	176.9	0	0	0	106.7	G52	G52-I54 PolarHBondContact O-N 3.11Å
55	S	39.8	Very low	38.8	Very low	55 Å²	55	101.7 Å²	101.7	39%	0.385	55%	0.553	S	S	.	*			trans	-87.1	117.6	-175.8	54.6	0	0	0	0	112.2	I53	I53-S55 VanDerWaalsContact C-N 3.26Å; I53-S55 PolarHBondContact O-N 3.27Å
56	Q	37.8	Very low	38.4	Very low	144 Å²	144	102.4 Å²	102.4	67%	0.673	56%	0.558	S	S	*	*			trans	-77.4	113	148.7	-77.7	-176.9	-35	0	0	106.9	E58	Q56-E58 PolarHBondContact O-N 2.87Å
57	T	43.6	Very low	37.9	Very low	82 Å²	82	100.1 Å²	100.1	50%	0.503	55%	0.549	S	S	.	.			trans	-85.4	108.4	177.1	-54.9	0	0	0	0	108.5	L34	L34-T57 HydrophobicContact CD1-CG2 4.3Å; L34-T57 HydrophobicContact CD2-CG2 3.63Å; L34-T57 HydrophobicContact CG-CG2 4.48Å
58	E	41.7	Very low	37.5	Very low	97 Å²	97	102 Å²	102	45%	0.453	56%	0.558	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-98.7	122.5	165	-73.3	-179.5	171.5	0	0	108.8	Q56 V60	Q56-E58 PolarHBondContact O-N 2.87Å; E58-V60 HydrophobicContact CB-CG2 4.41Å; E58-V60 PolarHBondContact O-N 3.46Å
59	N	45.9	Very low	37.1	Very low	127 Å²	127	103.8 Å²	103.8	68%	0.679	57%	0.569	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-77.9	110.2	169.7	-80.8	-14.3	0	0	0	108.4	L34	L34-N59 WeakPolarHBondContact CD2-OD1 3.45Å
60	V	43.7	Very low	36.8	Very low	52 Å²	52	104.4 Å²	104.4	32%	0.315	57%	0.572	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-113	113.4	172.4	-165.7	0	0	0	0	108.9	E58 H62	E58-V60 HydrophobicContact CB-CG2 4.41Å; E58-V60 PolarHBondContact O-N 3.46Å; V60-H62 WeakPolarHBondContact CG1-CE1 3.43Å
61	T	42.1	Very low	36.4	Very low	116 Å²	116	106.1 Å²	106.1	71%	0.712	57%	0.567	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-93.2	117.2	174.6	-44	0	0	0	0	108.4
62	H	40.9	Very low	36.1	Very low	86 Å²	86	107 Å²	107	40%	0.398	56%	0.562	S	S	.	*			trans	-104.1	134.5	168.9	-67.9	82.4	0	0	0	108.9	V60 I64	V60-H62 WeakPolarHBondContact CG1-CE1 3.43Å; H62-I64 PolarHBondContact O-N 3.36Å
63	P	33	Very low	36.1	Very low	117 Å²	117	112.3 Å²	112.3	76%	0.76	58%	0.584	S	S	*	*			trans	-58.6	137.9	164.9	25.4	-30.5	0	0	0	108.3	L65	P63-L65 PolarHBondContact O-N 3.15Å
64	I	36.5	Very low	36	Very low	121 Å²	121	112.5 Å²	112.5	62%	0.621	60%	0.6	S	S	*	*			trans	-40.6	103.7	-173.4	-62.9	166.4	0	0	0	110.4	H62 T66	H62-I64 PolarHBondContact O-N 3.36Å; I64-T66 PolarHBondContact O-N 2.72Å
65	L	32.7	Very low	35.6	Very low	116 Å²	116	114.8 Å²	114.8	61%	0.607	61%	0.613	S	S	*	*			trans	-72.1	118.4	156.5	-71.1	168.2	0	0	0	104.6	P63 V67	P63-L65 PolarHBondContact O-N 3.15Å; L65-V67 PolarHBondContact O-N 3.22Å
66	T	30.1	Very low	35	Very low	85 Å²	85	119.2 Å²	119.2	52%	0.521	63%	0.628	S	S	.	*			trans	-40.2	127.7	171.3	31.5	0	0	0	0	109.4	I64 Q68 D69	I64-T66 PolarHBondContact O-N 2.72Å; T66-Q68 PolarHBondContact O-N 3.27Å; T66-D69 PolarHBondContact O-N 3.16Å; T66-D69 PolarHBondContact OG1-OD2 2.65Å
67	V	31.9	Very low	34.6	Very low	114 Å²	114	117.5 Å²	117.5	69%	0.691	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.3	41.5	-176.4	-172.6	0	0	0	0	111.2	L65 Y71	L65-V67 PolarHBondContact O-N 3.22Å; V67-Y71 HydrophobicContact CG1-CE2 4.38Å
68	Q	28.7	Very low	34	Very low	173 Å²	173	122.4 Å²	122.4	81%	0.808	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-120.5	-23	176	-74.8	-176.5	-18.5	0	0	111.8	T66	T66-Q68 PolarHBondContact O-N 3.27Å
69	D	31.8	Very low	33.2	Very low	115 Å²	115	125.4 Å²	125.4	62%	0.615	66%	0.66	S	S	*	*	S	Bend	trans	-93.5	-7.7	-166.4	-70.2	-47.8	0	0	0	116.1	T66	T66-D69 PolarHBondContact O-N 3.16Å; T66-D69 PolarHBondContact OG1-OD2 2.65Å
70	V	30.8	Very low	32.5	Very low	106 Å²	106	130.8 Å²	130.8	64%	0.642	69%	0.686	S	S	*	*			trans	-144.3	75.7	-171.4	-163.8	0	0	0	0	112.8
71	Y	30.9	Very low	32	Very low	151 Å²	151	134.7 Å²	134.7	59%	0.592	70%	0.704	S	S	*	*			trans	-119	96	153.8	-77.3	-83.7	0	0	0	108.9	V67 I73	V67-Y71 HydrophobicContact CG1-CE2 4.38Å; Y71-I73 HydrophobicContact CD1-CD1 4.1Å
72	R	30.1	Very low	31.5	Very low	201 Å²	201	135.7 Å²	135.7	76%	0.758	70%	0.704	S	S	*	*			trans	-121.8	84.1	164.5	-168.1	176.9	169.4	-163.4	-3.8	107.4
73	I	32.4	Very low	30.9	Very low	131 Å²	131	138.4 Å²	138.4	67%	0.672	72%	0.721	S	S	*	*			trans	-102.7	105.8	173.7	-61	174.6	0	0	0	106	Y71	Y71-I73 HydrophobicContact CD1-CD1 4.1Å
74	G	33.9	Very low	30.8	Very low	57 Å²	57	139.7 Å²	139.7	59%	0.588	72%	0.719	S	S	*	*	T	Hydrogen-bonded Turn	trans	67.9	-174.4	179.6	0	0	0	0	0	114.2	E76	G74-E76 PolarHBondContact O-N 3.39Å
75	N	29.4	Very low	30.5	Very low	164 Å²	164	140.9 Å²	140.9	88%	0.877	73%	0.725	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.4	18.5	-171.4	-128.2	26.7	0	0	0	114
76	E	28.2	Very low	30.3	Very low	149 Å²	149	142.5 Å²	142.5	70%	0.696	73%	0.733	S	S	*	*			trans	-123.9	104.8	-177	-63	-168.4	168	0	0	109.8	G74	G74-E76 PolarHBondContact O-N 3.39Å
77	T	29	Very low	30.3	Very low	108 Å²	108	146.6 Å²	146.6	66%	0.663	75%	0.748	S	S	*	*			trans	-86.4	108.9	166.7	-53	0	0	0	0	107.7
78	K	29.8	Very low	30.2	Very low	185 Å²	185	149.2 Å²	149.2	80%	0.804	75%	0.752	S	S	*	*			trans	-102.5	115.9	163.1	-78.1	-173.9	178.2	177.6	0	108.5
79	L	26	Very low	30.3	Very low	160 Å²	160	147.2 Å²	147.2	84%	0.838	75%	0.748	S	S	*	*			trans	-72.4	133.6	164.3	-70.4	160.3	0	0	0	107.8
80	I	31.8	Very low	30.2	Very low	239 Å²	239	150.1 Å²	150.1	100%	1.226	76%	0.76	S	S	*	*			trans	-88.4	0	154.6	-45.6	176.5	0	0	0	106.2

Retrieved 80 of 80 residues in 117.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).