A0A5K4FB01_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4FB01, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 76 aa.

						>A0A5K4FB01_SCHMA|A0A5K4FB01
MLTWSSVSCSCTPVITQSNTINNEAKLFFKKFILIHRFINVLRKFIVLELIRFFKHKGEVNNNKKLHAMSISLYLI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.5	Very low	54.5	Low	237 Å²	237	139.8 Å²	139.8	100%	1.167	81%	0.811	S	S	*	*				0	85.2	0	-168.8	166.9	157.5	0	0	107.1
2	L	53.8	Low	54.4	Low	167 Å²	167	137.7 Å²	137.7	87%	0.874	80%	0.801	S	S	*	*			trans	-86.2	118.6	-174.7	-74.6	167.1	0	0	0	109.1	W4	L2-W4 PolarHBondContact O-N 3.33Å
3	T	53.6	Low	54.6	Low	120 Å²	120	134.1 Å²	134.1	74%	0.736	79%	0.785	S	S	*	*			trans	-77.3	103.1	-179.4	47.7	0	0	0	0	109.8	S5	T3-S5 PolarHBondContact O-N 3.03Å
4	W	55.5	Low	54.9	Low	242 Å²	242	132.7 Å²	132.7	92%	0.917	78%	0.779	S	S	*	*			trans	-87.3	86.4	163.1	-75.6	6.5	0	0	0	108.2	L2 S6	L2-W4 PolarHBondContact O-N 3.33Å; W4-S6 PolarHBondContact O-N 3.32Å
5	S	56.9	Low	55	Low	108 Å²	108	131.9 Å²	131.9	76%	0.755	77%	0.768	S	S	*	*			trans	-67.3	102	164.9	-60.6	0	0	0	0	107.2	T3 V7	T3-S5 PolarHBondContact O-N 3.03Å; S5-V7 PolarHBondContact O-N 3.2Å
6	S	60	Low	55.2	Low	106 Å²	106	129.4 Å²	129.4	74%	0.741	76%	0.756	S	S	*	*			trans	-49.4	118.5	174.8	48.4	0	0	0	0	110.4	W4 S8	W4-S6 PolarHBondContact O-N 3.32Å; S6-S8 VanDerWaalsContact C-N 3.34Å; S6-S8 PolarHBondContact O-N 2.92Å
7	V	54.3	Low	55.4	Low	138 Å²	138	129.7 Å²	129.7	84%	0.836	75%	0.748	S	S	*	*			trans	-61.3	99.6	164.6	176.7	0	0	0	0	106.6	S5 C9	S5-V7 PolarHBondContact O-N 3.2Å; V7-C9 VanDerWaalsContact C-N 3.27Å; V7-C9 PolarHBondContact O-N 2.9Å
8	S	54.6	Low	55.6	Low	106 Å²	106	125.3 Å²	125.3	74%	0.741	73%	0.726	S	S	*	*			trans	-69.1	89.8	171.5	53	0	0	0	0	107.9	S6 S10	S6-S8 VanDerWaalsContact C-N 3.34Å; S6-S8 PolarHBondContact O-N 2.92Å; S8-S10 PolarHBondContact O-N 2.85Å
9	C	55.2	Low	56	Low	101 Å²	101	123.3 Å²	123.3	68%	0.682	71%	0.712	S	S	*	*			trans	-68.2	101.4	166.9	-161.1	0	0	0	0	106.8	V7 C11	V7-C9 VanDerWaalsContact C-N 3.27Å; V7-C9 PolarHBondContact O-N 2.9Å; C9-C11 PolarHBondContact O-N 3.07Å
10	S	54.3	Low	56.7	Low	110 Å²	110	120.9 Å²	120.9	77%	0.769	70%	0.7	S	S	*	*			trans	-72	74.4	176.1	42.4	0	0	0	0	109.8	S8 T12	S8-S10 PolarHBondContact O-N 2.85Å; S10-T12 PolarHBondContact O-N 2.92Å
11	C	51.4	Low	57.4	Low	103 Å²	103	119.7 Å²	119.7	70%	0.696	69%	0.69	S	S	*	*			trans	-74.9	60.1	176.4	-58.3	0	0	0	0	111.8	C9	C9-C11 PolarHBondContact O-N 3.07Å
12	T	54.3	Low	58.7	Low	114 Å²	114	112.4 Å²	112.4	70%	0.699	66%	0.655	S	S	*	*			trans	-150.2	96.6	169.2	51.8	0	0	0	0	112.4	S10	S10-T12 PolarHBondContact O-N 2.92Å
13	P	56.3	Low	60	Low	91 Å²	91	109.2 Å²	109.2	59%	0.591	64%	0.64	S	S	*	*			trans	-136	20.4	133.5	38.4	-27.5	0	0	0	114.3	T16	P13-T16 PolarHBondContact O-OG1 3.11Å; P13-T16 VanDerWaalsContact O-OG1 3.05Å
14	V	58.4	Low	61.4	Low	115 Å²	115	109.5 Å²	109.5	70%	0.697	63%	0.633	S	S	*	*	H	α-helix	trans	-69.9	-35.5	179.6	-176.9	0	0	0	0	111.9	Q17 S18	V14-Q17 PolarHBondContact O-N 2.85Å; V14-S18 PolarHBondContact O-N 3.33Å
15	I	56.9	Low	62.7	Low	121 Å²	121	100.8 Å²	100.8	62%	0.621	61%	0.612	S	S	*	*	H	α-helix	trans	-68.3	-40.5	-176.8	-57.2	176.9	0	0	0	111.3	Q17 S18 N19	I15-Q17 PolarHBondContact O-N 3.49Å; I15-S18 PolarHBondContact O-N 2.99Å; I15-S18 PolarHBondContact O-OG 3.34Å; I15-N19 PolarHBondContact O-N 3.29Å
16	T	58.3	Low	64.1	Low	92 Å²	92	102 Å²	102	56%	0.564	60%	0.603	S	S	*	*	H	α-helix	trans	-63.8	-41	178.5	31.9	0	0	0	0	111.7	P13 S18 N19 T20	P13-T16 PolarHBondContact O-OG1 3.11Å; P13-T16 VanDerWaalsContact O-OG1 3.05Å; T16-S18 PolarHBondContact O-N 3.26Å; T16-N19 PolarHBondContact O-N 2.98Å; T16-T20 PolarHBondContact O-N 3.47Å; T16-T20 PolarHBondContact O-OG1 3.44Å
17	Q	57.9	Low	65.3	Low	134 Å²	134	101.5 Å²	101.5	63%	0.626	59%	0.592	S	S	*	*	H	α-helix	trans	-65.1	-41	-179.1	-153.3	175.1	21.9	0	0	112.3	V14 I15 N19 T20 I21	V14-Q17 PolarHBondContact O-N 2.85Å; I15-Q17 PolarHBondContact O-N 3.49Å; Q17-N19 PolarHBondContact O-N 3.07Å; Q17-T20 PolarHBondContact O-N 2.92Å; Q17-I21 HydrophobicContact CG-CD1 4.2Å; Q17-I21 VanDerWaalsContact O-CG1 3.28Å; Q17-I21 WeakPolarHBondContact O-CG1 3.39Å; Q17-I21 PolarHBondContact O-N 3.05Å
18	S	60.1	Low	66.9	Low	51 Å²	51	101.8 Å²	101.8	36%	0.357	58%	0.582	S	S	.	*	H	α-helix	trans	-62.2	-41.1	177	72.7	0	0	0	0	112.7	V14 I15 T16 N22	V14-S18 PolarHBondContact O-N 3.33Å; I15-S18 PolarHBondContact O-N 2.99Å; I15-S18 PolarHBondContact O-OG 3.34Å; T16-S18 PolarHBondContact O-N 3.26Å; S18-N22 VanDerWaalsContact O-CB 3.3Å; S18-N22 WeakPolarHBondContact O-CB 3.41Å; S18-N22 PolarHBondContact O-N 3.46Å; S18-N22 PolarHBondContact O-ND2 3.35Å; S18-N22 VanDerWaalsContact O-ND2 3.11Å
19	N	63.5	Low	68.6	Low	87 Å²	87	103 Å²	103	47%	0.465	57%	0.574	S	S	.	*	H	α-helix	trans	-67.3	-39.3	177.7	-74.5	-16.7	0	0	0	111.8	I15 T16 Q17 N22 N23	I15-N19 PolarHBondContact O-N 3.29Å; T16-N19 PolarHBondContact O-N 2.98Å; Q17-N19 PolarHBondContact O-N 3.07Å; N19-N22 PolarHBondContact O-N 3.31Å; N19-N23 WeakPolarHBondContact O-CB 3.3Å; N19-N23 PolarHBondContact O-N 3.47Å; N19-N23 PolarHBondContact O-ND2 3.46Å
20	T	69.2	Low	70.3	Confident	74 Å²	74	105 Å²	105	45%	0.454	57%	0.571	S	S	.	*	H	α-helix	trans	-64.4	-48.3	176.5	-48	0	0	0	0	111.3	T16 Q17 N22 N23 E24	T16-T20 PolarHBondContact O-N 3.47Å; T16-T20 PolarHBondContact O-OG1 3.44Å; Q17-T20 PolarHBondContact O-N 2.92Å; T20-N22 VanDerWaalsContact C-N 3.33Å; T20-N22 PolarHBondContact O-N 3.39Å; T20-N23 PolarHBondContact O-N 3Å; T20-N23 VanDerWaalsContact O-N 3.11Å; T20-E24 WeakPolarHBondContact O-CG 3.37Å; T20-E24 PolarHBondContact O-N 3Å
21	I	71.3	Confident	72	Confident	96 Å²	96	105.4 Å²	105.4	49%	0.492	56%	0.559	S	S	.	*	H	α-helix	trans	-60.1	-44.2	177.8	-65	164.1	0	0	0	110.7	Q17 N23 E24 A25	Q17-I21 HydrophobicContact CG-CD1 4.2Å; Q17-I21 VanDerWaalsContact O-CG1 3.28Å; Q17-I21 WeakPolarHBondContact O-CG1 3.39Å; Q17-I21 PolarHBondContact O-N 3.05Å; I21-N23 VanDerWaalsContact C-N 3.28Å; I21-N23 PolarHBondContact O-N 2.93Å; I21-E24 PolarHBondContact O-N 3.08Å; I21-A25 WeakPolarHBondContact O-CB 3.43Å; I21-A25 PolarHBondContact O-N 3.48Å
22	N	77.1	Confident	74	Confident	84 Å²	84	105.7 Å²	105.7	45%	0.449	55%	0.549	S	S	.	.	H	α-helix	trans	-61.6	-36.6	177.4	-73.9	-24.5	0	0	0	112.2	S18 N19 T20 K26	S18-N22 VanDerWaalsContact O-CB 3.3Å; S18-N22 WeakPolarHBondContact O-CB 3.41Å; S18-N22 PolarHBondContact O-N 3.46Å; S18-N22 PolarHBondContact O-ND2 3.35Å; S18-N22 VanDerWaalsContact O-ND2 3.11Å; N19-N22 PolarHBondContact O-N 3.31Å; T20-N22 VanDerWaalsContact C-N 3.33Å; T20-N22 PolarHBondContact O-N 3.39Å; N22-K26 WeakPolarHBondContact O-CB 3.18Å; N22-K26 WeakPolarHBondContact O-CD 3.5Å; N22-K26 WeakPolarHBondContact O-CG 3.37Å; N22-K26 PolarHBondContact O-N 3.31Å; N22-K26 VanDerWaalsContact O-N 3.08Å
23	N	81.9	Confident	75.9	Confident	101 Å²	101	103.4 Å²	103.4	54%	0.54	53%	0.532	S	S	.	.	H	α-helix	trans	-72.9	-40.3	177.9	-72.1	-18.2	0	0	0	112.2	N19 T20 I21 K26 L27	N19-N23 WeakPolarHBondContact O-CB 3.3Å; N19-N23 PolarHBondContact O-N 3.47Å; N19-N23 PolarHBondContact O-ND2 3.46Å; T20-N23 PolarHBondContact O-N 3Å; T20-N23 VanDerWaalsContact O-N 3.11Å; I21-N23 VanDerWaalsContact C-N 3.28Å; I21-N23 PolarHBondContact O-N 2.93Å; N23-K26 PolarHBondContact O-N 2.91Å; N23-L27 WeakPolarHBondContact O-CB 3.28Å; N23-L27 PolarHBondContact O-N 3.47Å
24	E	81.4	Confident	77.7	Confident	126 Å²	126	104.6 Å²	104.6	59%	0.589	53%	0.533	S	S	*	.	H	α-helix	trans	-64.4	-44.9	175.3	-72.5	-178.3	-176.1	0	0	111.8	T20 I21 K26 L27 F28	T20-E24 WeakPolarHBondContact O-CG 3.37Å; T20-E24 PolarHBondContact O-N 3Å; I21-E24 PolarHBondContact O-N 3.08Å; E24-K26 PolarHBondContact O-N 3.46Å; E24-L27 WeakPolarHBondContact O-CB 3.31Å; E24-L27 PolarHBondContact O-N 2.92Å; E24-L27 VanDerWaalsContact O-N 3.16Å; E24-F28 PolarHBondContact O-N 3.42Å
25	A	83.8	Confident	79.3	Confident	58 Å²	58	103.9 Å²	103.9	48%	0.479	52%	0.524	S	S	.	.	H	α-helix	trans	-62.1	-42.4	175.7	0	0	0	0	0	111.8	I21 L27 F28 F29	I21-A25 WeakPolarHBondContact O-CB 3.43Å; I21-A25 PolarHBondContact O-N 3.48Å; A25-L27 VanDerWaalsContact C-N 3.33Å; A25-L27 PolarHBondContact O-N 3.11Å; A25-F28 PolarHBondContact O-N 2.94Å; A25-F29 WeakPolarHBondContact O-CB 3.42Å; A25-F29 PolarHBondContact O-N 3.34Å
26	K	85.3	Confident	81	Confident	133 Å²	133	102.7 Å²	102.7	58%	0.578	52%	0.516	S	S	*	.	H	α-helix	trans	-61.5	-40.2	173.4	-77.6	173.1	-171.9	177.2	0	112	N22 N23 E24 F29 K30	N22-K26 WeakPolarHBondContact O-CB 3.18Å; N22-K26 WeakPolarHBondContact O-CD 3.5Å; N22-K26 WeakPolarHBondContact O-CG 3.37Å; N22-K26 PolarHBondContact O-N 3.31Å; N22-K26 VanDerWaalsContact O-N 3.08Å; N23-K26 PolarHBondContact O-N 2.91Å; E24-K26 PolarHBondContact O-N 3.46Å; K26-F29 PolarHBondContact O-N 3.16Å; K26-K30 WeakPolarHBondContact O-CG 3.49Å; K26-K30 PolarHBondContact O-N 3.41Å
27	L	86.6	Confident	82.7	Confident	97 Å²	97	106.5 Å²	106.5	51%	0.508	52%	0.519	S	S	.	.	H	α-helix	trans	-66.5	-42.8	177.3	-174.1	66	0	0	0	111.2	N23 E24 A25 K30 K31	N23-L27 WeakPolarHBondContact O-CB 3.28Å; N23-L27 PolarHBondContact O-N 3.47Å; E24-L27 WeakPolarHBondContact O-CB 3.31Å; E24-L27 PolarHBondContact O-N 2.92Å; E24-L27 VanDerWaalsContact O-N 3.16Å; A25-L27 VanDerWaalsContact C-N 3.33Å; A25-L27 PolarHBondContact O-N 3.11Å; L27-K30 PolarHBondContact O-N 2.82Å; L27-K31 WeakPolarHBondContact O-CG 3.45Å; L27-K31 PolarHBondContact O-N 3.5Å
28	F	87.6	Confident	84.4	Confident	144 Å²	144	106.4 Å²	106.4	63%	0.632	52%	0.517	S	S	*	.	H	α-helix	trans	-60.3	-46.7	174.7	-176	-95.3	0	0	0	111.3	E24 A25 K30 K31 F32	E24-F28 PolarHBondContact O-N 3.42Å; A25-F28 PolarHBondContact O-N 2.94Å; F28-K30 VanDerWaalsContact C-N 3.35Å; F28-K30 PolarHBondContact O-N 3.18Å; F28-K31 PolarHBondContact O-N 3.42Å; F28-F32 WeakPolarHBondContact O-CB 3.4Å; F28-F32 PolarHBondContact O-N 3.38Å
29	F	89.3	Confident	85.9	Confident	130 Å²	130	108.4 Å²	108.4	57%	0.57	52%	0.523	S	S	*	.	H	α-helix	trans	-62.8	-40.5	178.8	-162.4	-103.7	0	0	0	112.2	A25 K26 F32 I33	A25-F29 WeakPolarHBondContact O-CB 3.42Å; A25-F29 PolarHBondContact O-N 3.34Å; K26-F29 PolarHBondContact O-N 3.16Å; F29-F32 PolarHBondContact O-N 2.9Å; F29-I33 HydrophobicContact CD1-CD1 3.53Å; F29-I33 HydrophobicContact CD1-CG1 4.27Å; F29-I33 HydrophobicContact CE1-CD1 3.48Å; F29-I33 VanDerWaalsContact CE1-CD1 3.48Å; F29-I33 HydrophobicContact CE1-CG1 4.18Å; F29-I33 HydrophobicContact CG-CD1 4.5Å; F29-I33 HydrophobicContact CZ-CD1 4.39Å; F29-I33 VanDerWaalsContact O-CG1 3.31Å; F29-I33 WeakPolarHBondContact O-CG1 3.48Å; F29-I33 PolarHBondContact O-N 3.22Å
30	K	90.6	Very high	87.3	Confident	143 Å²	143	107.2 Å²	107.2	62%	0.622	52%	0.517	S	S	*	.	H	α-helix	trans	-60.9	-45.2	172.9	-77	179.5	179.3	-177.2	0	112.1	K26 L27 F28 I33 L34	K26-K30 WeakPolarHBondContact O-CG 3.49Å; K26-K30 PolarHBondContact O-N 3.41Å; L27-K30 PolarHBondContact O-N 2.82Å; F28-K30 VanDerWaalsContact C-N 3.35Å; F28-K30 PolarHBondContact O-N 3.18Å; K30-I33 PolarHBondContact O-N 3.15Å; K30-L34 WeakPolarHBondContact O-CG 3.31Å; K30-L34 PolarHBondContact O-N 3.48Å; K30-L34 VanDerWaalsContact O-N 3.15Å
31	K	91.7	Very high	88.4	Confident	119 Å²	119	108.3 Å²	108.3	52%	0.517	52%	0.523	S	S	.	.	H	α-helix	trans	-62.8	-42.6	176	-73.5	179.7	178.7	-178.3	0	111.5	L27 F28 I33 L34 I35	L27-K31 WeakPolarHBondContact O-CG 3.45Å; L27-K31 PolarHBondContact O-N 3.5Å; F28-K31 PolarHBondContact O-N 3.42Å; K31-I33 PolarHBondContact O-N 3.2Å; K31-L34 WeakPolarHBondContact O-CB 3.42Å; K31-L34 PolarHBondContact O-N 3.36Å; K31-I35 WeakPolarHBondContact O-CG1 3.48Å; K31-I35 PolarHBondContact O-N 2.85Å
32	F	93.1	Very high	89.4	Confident	110 Å²	110	107.5 Å²	107.5	48%	0.482	52%	0.519	S	S	.	.	H	α-helix	trans	-60.7	-45	177.1	-178.2	-98.4	0	0	0	112	F28 F29 L34 I35 H36	F28-F32 WeakPolarHBondContact O-CB 3.4Å; F28-F32 PolarHBondContact O-N 3.38Å; F29-F32 PolarHBondContact O-N 2.9Å; F32-L34 VanDerWaalsContact C-N 3.31Å; F32-L34 PolarHBondContact O-N 3.33Å; F32-I35 PolarHBondContact O-N 2.85Å; F32-H36 VanDerWaalsContact O-CB 3.31Å; F32-H36 WeakPolarHBondContact O-CB 3.41Å; F32-H36 PolarHBondContact O-N 2.99Å
33	I	93.8	Very high	90.1	Very high	66 Å²	66	112.1 Å²	112.1	34%	0.338	53%	0.531	S	S	.	.	H	α-helix	trans	-59.9	-41.8	175.7	-69.7	164	0	0	0	111.4	F29 K30 K31 H36 R37	F29-I33 HydrophobicContact CD1-CD1 3.53Å; F29-I33 HydrophobicContact CD1-CG1 4.27Å; F29-I33 HydrophobicContact CE1-CD1 3.48Å; F29-I33 VanDerWaalsContact CE1-CD1 3.48Å; F29-I33 HydrophobicContact CE1-CG1 4.18Å; F29-I33 HydrophobicContact CG-CD1 4.5Å; F29-I33 HydrophobicContact CZ-CD1 4.39Å; F29-I33 VanDerWaalsContact O-CG1 3.31Å; F29-I33 WeakPolarHBondContact O-CG1 3.48Å; F29-I33 PolarHBondContact O-N 3.22Å; K30-I33 PolarHBondContact O-N 3.15Å; K31-I33 PolarHBondContact O-N 3.2Å; I33-H36 PolarHBondContact O-N 3.31Å; I33-R37 WeakPolarHBondContact O-CB 3.46Å; I33-R37 WeakPolarHBondContact O-CG 3.49Å; I33-R37 PolarHBondContact O-N 2.93Å
34	L	93	Very high	90.5	Very high	115 Å²	115	115.1 Å²	115.1	60%	0.602	54%	0.539	S	S	*	.	H	α-helix	trans	-63.3	-47.3	178.1	-75	166.7	0	0	0	111.6	K30 K31 F32 H36 R37 F38	K30-L34 WeakPolarHBondContact O-CG 3.31Å; K30-L34 PolarHBondContact O-N 3.48Å; K30-L34 VanDerWaalsContact O-N 3.15Å; K31-L34 WeakPolarHBondContact O-CB 3.42Å; K31-L34 PolarHBondContact O-N 3.36Å; F32-L34 VanDerWaalsContact C-N 3.31Å; F32-L34 PolarHBondContact O-N 3.33Å; L34-H36 VanDerWaalsContact C-N 3.33Å; L34-H36 PolarHBondContact O-N 3.39Å; L34-R37 PolarHBondContact O-N 3.04Å; L34-F38 WeakPolarHBondContact O-CB 3.48Å; L34-F38 PolarHBondContact O-N 2.9Å
35	I	93	Very high	91	Very high	100 Å²	100	115.2 Å²	115.2	51%	0.513	54%	0.537	S	S	.	.	H	α-helix	trans	-61	-44.7	176.6	-68.3	159.9	0	0	0	110.4	K31 F32 R37 F38 I39	K31-I35 WeakPolarHBondContact O-CG1 3.48Å; K31-I35 PolarHBondContact O-N 2.85Å; F32-I35 PolarHBondContact O-N 2.85Å; I35-R37 PolarHBondContact O-N 3.26Å; I35-F38 WeakPolarHBondContact O-CB 3.42Å; I35-F38 PolarHBondContact O-N 3.05Å; I35-I39 HydrophobicContact CG2-CD1 3.74Å; I35-I39 HydrophobicContact CG2-CG1 4.35Å; I35-I39 WeakPolarHBondContact O-CG1 3.46Å; I35-I39 PolarHBondContact O-N 3.43Å
36	H	93.2	Very high	91.3	Very high	97 Å²	97	117 Å²	117	45%	0.449	54%	0.538	S	S	.	.	H	α-helix	trans	-62.7	-41	178.6	-175.5	-103.9	0	0	0	112.3	F32 I33 L34 N40	F32-H36 VanDerWaalsContact O-CB 3.31Å; F32-H36 WeakPolarHBondContact O-CB 3.41Å; F32-H36 PolarHBondContact O-N 2.99Å; I33-H36 PolarHBondContact O-N 3.31Å; L34-H36 VanDerWaalsContact C-N 3.33Å; L34-H36 PolarHBondContact O-N 3.39Å; H36-N40 PolarHBondContact CE1-ND2 3.15Å; H36-N40 PolarHBondContact ND1-ND2 3.45Å; H36-N40 WeakPolarHBondContact O-CB 3.32Å; H36-N40 PolarHBondContact O-N 3.17Å; H36-N40 PolarHBondContact O-ND2 3.21Å
37	R	92.4	Very high	91.5	Very high	171 Å²	171	114.3 Å²	114.3	65%	0.645	53%	0.532	S	S	*	.	H	α-helix	trans	-62.1	-44	172.5	-79.3	-178.4	174.1	-175.9	-1.3	111.7	I33 L34 I35 N40 V41	I33-R37 WeakPolarHBondContact O-CB 3.46Å; I33-R37 WeakPolarHBondContact O-CG 3.49Å; I33-R37 PolarHBondContact O-N 2.93Å; L34-R37 PolarHBondContact O-N 3.04Å; I35-R37 PolarHBondContact O-N 3.26Å; R37-N40 PolarHBondContact O-N 3.44Å; R37-V41 WeakPolarHBondContact O-CG2 3.48Å; R37-V41 PolarHBondContact O-N 3.3Å
38	F	93.8	Very high	91.5	Very high	133 Å²	133	113.9 Å²	113.9	58%	0.583	53%	0.53	S	S	*	.	H	α-helix	trans	-61.5	-47.2	178.6	-178.2	-105.2	0	0	0	112.1	L34 I35 N40 V41 L42	L34-F38 WeakPolarHBondContact O-CB 3.48Å; L34-F38 PolarHBondContact O-N 2.9Å; I35-F38 WeakPolarHBondContact O-CB 3.42Å; I35-F38 PolarHBondContact O-N 3.05Å; F38-N40 VanDerWaalsContact C-N 3.29Å; F38-N40 PolarHBondContact O-N 3.41Å; F38-V41 PolarHBondContact O-N 3.35Å; F38-V41 VanDerWaalsContact O-N 3.15Å; F38-L42 HydrophobicContact CD1-CD1 3.9Å; F38-L42 HydrophobicContact CD1-CG 4.48Å; F38-L42 HydrophobicContact CE1-CD1 3.4Å; F38-L42 HydrophobicContact CE1-CG 4.14Å; F38-L42 HydrophobicContact CZ-CD1 3.84Å; F38-L42 HydrophobicContact CZ-CD2 4.38Å; F38-L42 HydrophobicContact CZ-CG 4.2Å; F38-L42 PolarHBondContact O-N 3.47Å
39	I	93.3	Very high	91.3	Very high	93 Å²	93	110.7 Å²	110.7	48%	0.477	52%	0.517	S	S	.	.	H	α-helix	trans	-58.2	-42.2	175.5	-67.6	168.2	0	0	0	110.9	I35 V41 L42 R43	I35-I39 HydrophobicContact CG2-CD1 3.74Å; I35-I39 HydrophobicContact CG2-CG1 4.35Å; I35-I39 WeakPolarHBondContact O-CG1 3.46Å; I35-I39 PolarHBondContact O-N 3.43Å; I39-V41 VanDerWaalsContact C-N 3.35Å; I39-V41 PolarHBondContact O-N 3.32Å; I39-L42 PolarHBondContact O-N 2.99Å; I39-R43 WeakPolarHBondContact O-CB 3.43Å; I39-R43 PolarHBondContact O-N 3.16Å
40	N	91.5	Very high	91.1	Very high	62 Å²	62	108.7 Å²	108.7	33%	0.332	51%	0.512	S	S	.	.	H	α-helix	trans	-65.9	-34.7	178.5	-78.8	-25.1	0	0	0	113.3	H36 R37 F38 K44	H36-N40 PolarHBondContact CE1-ND2 3.15Å; H36-N40 PolarHBondContact ND1-ND2 3.45Å; H36-N40 WeakPolarHBondContact O-CB 3.32Å; H36-N40 PolarHBondContact O-N 3.17Å; H36-N40 PolarHBondContact O-ND2 3.21Å; R37-N40 PolarHBondContact O-N 3.44Å; F38-N40 VanDerWaalsContact C-N 3.29Å; F38-N40 PolarHBondContact O-N 3.41Å; N40-K44 WeakPolarHBondContact O-CG 3.31Å; N40-K44 PolarHBondContact O-N 3.01Å; N40-K44 VanDerWaalsContact O-N 3.16Å
41	V	92.5	Very high	90.9	Very high	97 Å²	97	107 Å²	107	59%	0.588	51%	0.509	S	S	*	.	H	α-helix	trans	-67	-46.3	173.9	173.2	0	0	0	0	110.5	R37 F38 I39 R43 K44 F45	R37-V41 WeakPolarHBondContact O-CG2 3.48Å; R37-V41 PolarHBondContact O-N 3.3Å; F38-V41 PolarHBondContact O-N 3.35Å; F38-V41 VanDerWaalsContact O-N 3.15Å; I39-V41 VanDerWaalsContact C-N 3.35Å; I39-V41 PolarHBondContact O-N 3.32Å; V41-R43 VanDerWaalsContact C-N 3.32Å; V41-R43 PolarHBondContact O-N 2.98Å; V41-K44 PolarHBondContact O-N 3.44Å; V41-F45 PolarHBondContact O-N 2.9Å
42	L	92.1	Very high	90.5	Very high	79 Å²	79	108.3 Å²	108.3	41%	0.414	51%	0.51	S	S	.	.	H	α-helix	trans	-59.8	-42.7	176.5	-71.2	178.3	0	0	0	112.1	F38 I39 K44 F45 I46	F38-L42 HydrophobicContact CD1-CD1 3.9Å; F38-L42 HydrophobicContact CD1-CG 4.48Å; F38-L42 HydrophobicContact CE1-CD1 3.4Å; F38-L42 HydrophobicContact CE1-CG 4.14Å; F38-L42 HydrophobicContact CZ-CD1 3.84Å; F38-L42 HydrophobicContact CZ-CD2 4.38Å; F38-L42 HydrophobicContact CZ-CG 4.2Å; F38-L42 PolarHBondContact O-N 3.47Å; I39-L42 PolarHBondContact O-N 2.99Å; L42-K44 VanDerWaalsContact C-N 3.33Å; L42-K44 PolarHBondContact O-N 3.43Å; L42-F45 WeakPolarHBondContact O-CB 3.47Å; L42-F45 PolarHBondContact O-N 2.9Å; L42-F45 VanDerWaalsContact O-N 3.16Å; L42-I46 WeakPolarHBondContact O-CG1 3.27Å; L42-I46 PolarHBondContact O-N 3.02Å
43	R	91.4	Very high	90	Very high	181 Å²	181	108.2 Å²	108.2	68%	0.683	51%	0.51	S	S	*	.	H	α-helix	trans	-59.3	-44.4	176.8	-172.6	179.1	179.6	-162.7	0.4	111.6	I39 V41 F45 I46 V47	I39-R43 WeakPolarHBondContact O-CB 3.43Å; I39-R43 PolarHBondContact O-N 3.16Å; V41-R43 VanDerWaalsContact C-N 3.32Å; V41-R43 PolarHBondContact O-N 2.98Å; R43-F45 VanDerWaalsContact C-N 3.33Å; R43-I46 PolarHBondContact O-N 3.43Å; R43-V47 VanDerWaalsContact O-CG2 3.31Å; R43-V47 WeakPolarHBondContact O-CG2 3.36Å; R43-V47 PolarHBondContact O-N 3.11Å; R43-V47 VanDerWaalsContact O-N 3.11Å
44	K	91.1	Very high	89.4	Confident	163 Å²	163	111.7 Å²	111.7	71%	0.709	52%	0.523	S	S	*	.	H	α-helix	trans	-62.3	-41.6	175.8	-74	-179.3	178.8	-173.9	0	111.8	N40 V41 L42 V47 L48	N40-K44 WeakPolarHBondContact O-CG 3.31Å; N40-K44 PolarHBondContact O-N 3.01Å; N40-K44 VanDerWaalsContact O-N 3.16Å; V41-K44 PolarHBondContact O-N 3.44Å; L42-K44 VanDerWaalsContact C-N 3.33Å; L42-K44 PolarHBondContact O-N 3.43Å; K44-V47 PolarHBondContact O-N 3.46Å; K44-L48 PolarHBondContact O-N 3.38Å
45	F	91.7	Very high	88.9	Confident	128 Å²	128	113.4 Å²	113.4	56%	0.561	53%	0.525	S	S	*	.	H	α-helix	trans	-61.1	-47.9	177.9	-176	-98.2	0	0	0	112	V41 L42 R43 V47 L48 E49	V41-F45 PolarHBondContact O-N 2.9Å; L42-F45 WeakPolarHBondContact O-CB 3.47Å; L42-F45 PolarHBondContact O-N 2.9Å; L42-F45 VanDerWaalsContact O-N 3.16Å; R43-F45 VanDerWaalsContact C-N 3.33Å; F45-V47 PolarHBondContact O-N 3.41Å; F45-L48 PolarHBondContact O-N 3.01Å; F45-E49 HydrophobicContact CD1-CG 4.49Å; F45-E49 HydrophobicContact CE1-CG 4Å; F45-E49 HydrophobicContact CZ-CG 4.02Å; F45-E49 PolarHBondContact O-N 3.43Å
46	I	89.7	Confident	88.2	Confident	97 Å²	97	114.3 Å²	114.3	50%	0.497	53%	0.527	S	S	.	.	H	α-helix	trans	-61.1	-44	178.7	-66.5	165.1	0	0	0	111.2	L42 R43 L48 E49 L50	L42-I46 WeakPolarHBondContact O-CG1 3.27Å; L42-I46 PolarHBondContact O-N 3.02Å; R43-I46 PolarHBondContact O-N 3.43Å; I46-L48 VanDerWaalsContact C-N 3.31Å; I46-L48 PolarHBondContact O-N 2.98Å; I46-E49 PolarHBondContact O-N 3.2Å; I46-L50 HydrophobicContact CG2-CD1 3.96Å; I46-L50 HydrophobicContact CG2-CG 4.4Å; I46-L50 WeakPolarHBondContact O-CB 3.33Å; I46-L50 WeakPolarHBondContact O-CG 3.48Å; I46-L50 PolarHBondContact O-N 2.9Å
47	V	89.7	Confident	87.3	Confident	75 Å²	75	115.5 Å²	115.5	46%	0.455	53%	0.531	S	S	.	.	H	α-helix	trans	-61.8	-41.3	178	171.8	0	0	0	0	111	R43 K44 F45 L50 I51	R43-V47 VanDerWaalsContact O-CG2 3.31Å; R43-V47 WeakPolarHBondContact O-CG2 3.36Å; R43-V47 PolarHBondContact O-N 3.11Å; R43-V47 VanDerWaalsContact O-N 3.11Å; K44-V47 PolarHBondContact O-N 3.46Å; F45-V47 PolarHBondContact O-N 3.41Å; V47-L50 PolarHBondContact O-N 2.94Å; V47-I51 HydrophobicContact CG1-CD1 3.9Å; V47-I51 VanDerWaalsContact O-CG1 3.27Å; V47-I51 WeakPolarHBondContact O-CG1 3.31Å; V47-I51 PolarHBondContact O-N 3.16Å
48	L	86.7	Confident	86.4	Confident	88 Å²	88	108.8 Å²	108.8	46%	0.461	52%	0.515	S	S	.	.	H	α-helix	trans	-65.1	-43.9	179.1	-157.8	103.3	0	0	0	112	K44 F45 I46 I51 R52	K44-L48 PolarHBondContact O-N 3.38Å; F45-L48 PolarHBondContact O-N 3.01Å; I46-L48 VanDerWaalsContact C-N 3.31Å; I46-L48 PolarHBondContact O-N 2.98Å; L48-I51 PolarHBondContact O-N 3.33Å; L48-R52 WeakPolarHBondContact O-CG 3.44Å; L48-R52 PolarHBondContact O-N 3.06Å
49	E	84.7	Confident	85.5	Confident	78 Å²	78	107.6 Å²	107.6	36%	0.364	51%	0.512	S	S	.	.	H	α-helix	trans	-65.8	-38.8	177.1	-80.2	-60.2	126.7	0	0	112.1	F45 I46 I51 R52 F53	F45-E49 HydrophobicContact CD1-CG 4.49Å; F45-E49 HydrophobicContact CE1-CG 4Å; F45-E49 HydrophobicContact CZ-CG 4.02Å; F45-E49 PolarHBondContact O-N 3.43Å; I46-E49 PolarHBondContact O-N 3.2Å; E49-I51 PolarHBondContact O-N 2.84Å; E49-R52 PolarHBondContact O-N 2.88Å; E49-R52 IonicContact OE1-CZ 3.89Å; E49-R52 IonicContact OE1-NH1 2.9Å; E49-R52 PolarHBondContact OE1-NH1 2.87Å; E49-F53 WeakPolarHBondContact O-CB 3.45Å; E49-F53 PolarHBondContact O-N 2.93Å
50	L	84.9	Confident	84.4	Confident	88 Å²	88	105.9 Å²	105.9	46%	0.461	51%	0.505	S	S	.	.	H	α-helix	trans	-61.9	-44.8	173	-74.3	171.4	0	0	0	111.6	I46 V47 R52 F53 F54	I46-L50 HydrophobicContact CG2-CD1 3.96Å; I46-L50 HydrophobicContact CG2-CG 4.4Å; I46-L50 WeakPolarHBondContact O-CB 3.33Å; I46-L50 WeakPolarHBondContact O-CG 3.48Å; I46-L50 PolarHBondContact O-N 2.9Å; V47-L50 PolarHBondContact O-N 2.94Å; L50-R52 VanDerWaalsContact C-N 3.32Å; L50-R52 PolarHBondContact O-N 3.46Å; L50-F53 PolarHBondContact O-N 2.87Å; L50-F54 WeakPolarHBondContact O-CD2 3.13Å; L50-F54 PolarHBondContact O-N 3.24Å
51	I	85.2	Confident	83.6	Confident	107 Å²	107	108 Å²	108	55%	0.549	52%	0.517	S	S	.	.	H	α-helix	trans	-60.1	-43.9	176.5	-69	165.1	0	0	0	110.6	V47 L48 E49 F54 K55	V47-I51 HydrophobicContact CG1-CD1 3.9Å; V47-I51 VanDerWaalsContact O-CG1 3.27Å; V47-I51 WeakPolarHBondContact O-CG1 3.31Å; V47-I51 PolarHBondContact O-N 3.16Å; L48-I51 PolarHBondContact O-N 3.33Å; E49-I51 PolarHBondContact O-N 2.84Å; I51-F54 PolarHBondContact O-N 3.43Å; I51-K55 VanDerWaalsContact O-CB 3.31Å; I51-K55 WeakPolarHBondContact O-CB 3.4Å; I51-K55 PolarHBondContact O-N 3.29Å
52	R	84	Confident	82.6	Confident	147 Å²	147	108 Å²	108	56%	0.555	51%	0.513	S	S	*	.	H	α-helix	trans	-61.4	-45.1	175.6	-75.9	175.7	172.8	176.8	-5.7	111.9	L48 E49 L50 K55 H56	L48-R52 WeakPolarHBondContact O-CG 3.44Å; L48-R52 PolarHBondContact O-N 3.06Å; E49-R52 PolarHBondContact O-N 2.88Å; E49-R52 IonicContact OE1-CZ 3.89Å; E49-R52 IonicContact OE1-NH1 2.9Å; E49-R52 PolarHBondContact OE1-NH1 2.87Å; L50-R52 VanDerWaalsContact C-N 3.32Å; L50-R52 PolarHBondContact O-N 3.46Å; R52-K55 PolarHBondContact O-N 3.36Å; R52-H56 WeakPolarHBondContact O-CB 3.34Å; R52-H56 PolarHBondContact O-N 3.5Å
53	F	82.9	Confident	81.7	Confident	108 Å²	108	108.6 Å²	108.6	47%	0.474	52%	0.517	S	S	.	.	H	α-helix	trans	-62.9	-44	179	-174.7	-100.7	0	0	0	112.1	E49 L50 H56 K57	E49-F53 WeakPolarHBondContact O-CB 3.45Å; E49-F53 PolarHBondContact O-N 2.93Å; L50-F53 PolarHBondContact O-N 2.87Å; F53-H56 PolarHBondContact O-N 3.45Å; F53-K57 HydrophobicContact CD1-CD 4.27Å; F53-K57 HydrophobicContact CE1-CD 3.65Å; F53-K57 VanDerWaalsContact CE1-CE 3.43Å; F53-K57 HydrophobicContact CE1-CG 4.26Å; F53-K57 HydrophobicContact CZ-CD 4.02Å; F53-K57 HydrophobicContact CZ-CG 4.43Å; F53-K57 WeakPolarHBondContact O-CB 3.34Å; F53-K57 PolarHBondContact O-N 2.84Å
54	F	80.8	Confident	80.9	Confident	138 Å²	138	106.8 Å²	106.8	61%	0.605	51%	0.514	S	S	*	.	H	α-helix	trans	-67.1	-40.7	175.8	-79.9	-65.6	0	0	0	112.3	L50 I51 K57 G58	L50-F54 WeakPolarHBondContact O-CD2 3.13Å; L50-F54 PolarHBondContact O-N 3.24Å; I51-F54 PolarHBondContact O-N 3.43Å; F54-K57 PolarHBondContact O-N 2.87Å; F54-G58 PolarHBondContact O-N 3.37Å
55	K	82.5	Confident	80.2	Confident	151 Å²	151	105.2 Å²	105.2	66%	0.657	51%	0.507	S	S	*	.	H	α-helix	trans	-61	-46.9	175	-172.8	178.7	178.4	-176	0	111	I51 R52 G58 E59	I51-K55 VanDerWaalsContact O-CB 3.31Å; I51-K55 WeakPolarHBondContact O-CB 3.4Å; I51-K55 PolarHBondContact O-N 3.29Å; R52-K55 PolarHBondContact O-N 3.36Å; K55-G58 PolarHBondContact O-N 2.89Å; K55-E59 WeakPolarHBondContact O-CB 3.44Å; K55-E59 PolarHBondContact O-N 2.9Å
56	H	78.3	Confident	79.2	Confident	120 Å²	120	104.3 Å²	104.3	56%	0.556	51%	0.508	S	S	*	.	H	α-helix	trans	-63.4	-42.9	177.3	-173.1	-86.8	0	0	0	111.9	R52 F53 G58 E59 V60	R52-H56 WeakPolarHBondContact O-CB 3.34Å; R52-H56 PolarHBondContact O-N 3.5Å; F53-H56 PolarHBondContact O-N 3.45Å; H56-G58 VanDerWaalsContact C-N 3.35Å; H56-G58 PolarHBondContact O-N 3.35Å; H56-E59 PolarHBondContact O-N 3.47Å; H56-V60 WeakPolarHBondContact O-CB 3.27Å; H56-V60 VanDerWaalsContact O-CG2 3.27Å; H56-V60 WeakPolarHBondContact O-CG2 3.48Å; H56-V60 PolarHBondContact O-N 3.25Å
57	K	74.5	Confident	78.4	Confident	121 Å²	121	105.5 Å²	105.5	53%	0.526	51%	0.511	S	S	.	.	H	α-helix	trans	-62.3	-40.9	173.7	-86.9	-165.8	168.7	-178.7	0	112.6	F53 F54 N61	F53-K57 HydrophobicContact CD1-CD 4.27Å; F53-K57 HydrophobicContact CE1-CD 3.65Å; F53-K57 VanDerWaalsContact CE1-CE 3.43Å; F53-K57 HydrophobicContact CE1-CG 4.26Å; F53-K57 HydrophobicContact CZ-CD 4.02Å; F53-K57 HydrophobicContact CZ-CG 4.43Å; F53-K57 WeakPolarHBondContact O-CB 3.34Å; F53-K57 PolarHBondContact O-N 2.84Å; F54-K57 PolarHBondContact O-N 2.87Å; K57-N61 VanDerWaalsContact O-CB 3.3Å; K57-N61 WeakPolarHBondContact O-CB 3.3Å; K57-N61 PolarHBondContact O-N 3.48Å
58	G	73.7	Confident	77.7	Confident	31 Å²	31	104.6 Å²	104.6	32%	0.32	51%	0.511	S	S	.	.	H	α-helix	trans	-62.9	-43.9	175.8	0	0	0	0	0	112.1	F54 K55 H56 N61 N62	F54-G58 PolarHBondContact O-N 3.37Å; K55-G58 PolarHBondContact O-N 2.89Å; H56-G58 VanDerWaalsContact C-N 3.35Å; H56-G58 PolarHBondContact O-N 3.35Å; G58-N61 PolarHBondContact O-N 3.48Å; G58-N62 WeakPolarHBondContact O-CB 3.41Å; G58-N62 PolarHBondContact O-N 3.34Å; G58-N62 PolarHBondContact O-ND2 3.46Å; G58-N62 PolarHBondContact O-OD1 2.88Å
59	E	73.4	Confident	77	Confident	108 Å²	108	105.4 Å²	105.4	51%	0.505	51%	0.514	S	S	.	.	H	α-helix	trans	-63.8	-46.5	176.6	-170.5	171.5	178.1	0	0	112.2	K55 H56 N61 N62 N63	K55-E59 WeakPolarHBondContact O-CB 3.44Å; K55-E59 PolarHBondContact O-N 2.9Å; H56-E59 PolarHBondContact O-N 3.47Å; E59-N61 VanDerWaalsContact C-N 3.32Å; E59-N61 PolarHBondContact O-N 2.9Å; E59-N62 PolarHBondContact O-N 2.94Å; E59-N63 WeakPolarHBondContact O-CB 3.46Å; E59-N63 VanDerWaalsContact O-CG 3.25Å; E59-N63 PolarHBondContact O-N 3.4Å
60	V	71.6	Confident	76.5	Confident	57 Å²	57	104 Å²	104	35%	0.345	51%	0.513	S	S	.	.	H	α-helix	trans	-61.2	-40.8	174.7	172.5	0	0	0	0	111.4	H56 N63 K64	H56-V60 WeakPolarHBondContact O-CB 3.27Å; H56-V60 VanDerWaalsContact O-CG2 3.27Å; H56-V60 WeakPolarHBondContact O-CG2 3.48Å; H56-V60 PolarHBondContact O-N 3.25Å; V60-N63 PolarHBondContact O-N 3.04Å; V60-K64 HydrophobicContact CG1-CD 4.43Å; V60-K64 WeakPolarHBondContact O-CG 3.41Å; V60-K64 PolarHBondContact O-N 3.28Å
61	N	73.4	Confident	76.1	Confident	106 Å²	106	103.7 Å²	103.7	57%	0.567	51%	0.511	S	S	*	.	H	α-helix	trans	-67.3	-40.5	178.4	-166.9	48	0	0	0	111.9	K57 G58 E59 K64 K65	K57-N61 VanDerWaalsContact O-CB 3.3Å; K57-N61 WeakPolarHBondContact O-CB 3.3Å; K57-N61 PolarHBondContact O-N 3.48Å; G58-N61 PolarHBondContact O-N 3.48Å; E59-N61 VanDerWaalsContact C-N 3.32Å; E59-N61 PolarHBondContact O-N 2.9Å; N61-K64 PolarHBondContact O-N 3.03Å; N61-K65 PolarHBondContact O-N 3.41Å
62	N	72.3	Confident	75.5	Confident	97 Å²	97	101.6 Å²	101.6	52%	0.519	51%	0.506	S	S	.	.	H	α-helix	trans	-65.3	-42.7	176.3	-71	-12.1	0	0	0	111.5	G58 E59 K64 K65 L66	G58-N62 WeakPolarHBondContact O-CB 3.41Å; G58-N62 PolarHBondContact O-N 3.34Å; G58-N62 PolarHBondContact O-ND2 3.46Å; G58-N62 PolarHBondContact O-OD1 2.88Å; E59-N62 PolarHBondContact O-N 2.94Å; N62-K64 VanDerWaalsContact C-N 3.35Å; N62-K64 PolarHBondContact O-N 2.91Å; N62-K65 PolarHBondContact O-N 3.5Å; N62-L66 WeakPolarHBondContact O-CG 3.31Å; N62-L66 PolarHBondContact O-N 3.18Å
63	N	73.8	Confident	75	Confident	92 Å²	92	101.1 Å²	101.1	49%	0.492	51%	0.513	S	S	.	.	H	α-helix	trans	-63.5	-39.7	177.1	-69.9	-10.5	0	0	0	111.9	E59 V60 L66 H67	E59-N63 WeakPolarHBondContact O-CB 3.46Å; E59-N63 VanDerWaalsContact O-CG 3.25Å; E59-N63 PolarHBondContact O-N 3.4Å; V60-N63 PolarHBondContact O-N 3.04Å; N63-L66 PolarHBondContact O-N 3.48Å; N63-H67 WeakPolarHBondContact O-CB 3.36Å; N63-H67 PolarHBondContact O-N 3.23Å
64	K	74.5	Confident	74.6	Confident	142 Å²	142	105.7 Å²	105.7	62%	0.617	53%	0.529	S	S	*	.	H	α-helix	trans	-62.8	-40.8	173.2	-74.6	-179.9	-179.7	-173.1	0	112.2	V60 N61 N62 H67 A68	V60-K64 HydrophobicContact CG1-CD 4.43Å; V60-K64 WeakPolarHBondContact O-CG 3.41Å; V60-K64 PolarHBondContact O-N 3.28Å; N61-K64 PolarHBondContact O-N 3.03Å; N62-K64 VanDerWaalsContact C-N 3.35Å; N62-K64 PolarHBondContact O-N 2.91Å; K64-H67 PolarHBondContact O-N 2.9Å; K64-A68 WeakPolarHBondContact O-CB 3.44Å; K64-A68 PolarHBondContact O-N 3.47Å
65	K	75.3	Confident	74.2	Confident	131 Å²	131	106 Å²	106	57%	0.57	54%	0.536	S	S	*	.	H	α-helix	trans	-66.7	-41.8	177.4	-170.2	176.9	178.8	-179.4	0	111.9	N61 N62 A68 M69	N61-K65 PolarHBondContact O-N 3.41Å; N62-K65 PolarHBondContact O-N 3.5Å; K65-A68 PolarHBondContact O-N 3.32Å; K65-M69 WeakPolarHBondContact O-CG 3.39Å; K65-M69 PolarHBondContact O-N 3.44Å
66	L	71.6	Confident	73.4	Confident	109 Å²	109	108.3 Å²	108.3	57%	0.571	55%	0.553	S	S	*	*	H	α-helix	trans	-63.1	-42.8	174.8	-72.8	173.8	0	0	0	111.6	N62 N63 A68 M69 S70	N62-L66 WeakPolarHBondContact O-CG 3.31Å; N62-L66 PolarHBondContact O-N 3.18Å; N63-L66 PolarHBondContact O-N 3.48Å; L66-A68 VanDerWaalsContact C-N 3.33Å; L66-A68 PolarHBondContact O-N 2.97Å; L66-M69 PolarHBondContact O-N 2.93Å; L66-S70 PolarHBondContact O-N 3.33Å; L66-S70 PolarHBondContact O-OG 2.8Å
67	H	72.1	Confident	73.2	Confident	121 Å²	121	107.7 Å²	107.7	56%	0.56	55%	0.553	S	S	*	*	H	α-helix	trans	-64.1	-37.9	175.9	-166.7	-87.6	0	0	0	112.3	N63 K64 S70 I71	N63-H67 WeakPolarHBondContact O-CB 3.36Å; N63-H67 PolarHBondContact O-N 3.23Å; K64-H67 PolarHBondContact O-N 2.9Å; H67-S70 WeakPolarHBondContact CA-OG 3.38Å; H67-S70 PolarHBondContact O-N 3.42Å; H67-S70 PolarHBondContact O-OG 2.91Å; H67-I71 VanDerWaalsContact CE1-CD1 3.42Å; H67-I71 WeakPolarHBondContact CE1-CD1 3.31Å; H67-I71 VanDerWaalsContact ND1-CD1 3.31Å; H67-I71 WeakPolarHBondContact ND1-CD1 3.42Å; H67-I71 VanDerWaalsContact O-CG1 3.27Å; H67-I71 WeakPolarHBondContact O-CG1 3.48Å; H67-I71 PolarHBondContact O-N 3.01Å
68	A	75.3	Confident	73.1	Confident	56 Å²	56	107 Å²	107	46%	0.463	56%	0.555	S	S	.	*	H	α-helix	trans	-67.2	-39.1	173.4	0	0	0	0	0	112.3	K64 K65 L66 S72	K64-A68 WeakPolarHBondContact O-CB 3.44Å; K64-A68 PolarHBondContact O-N 3.47Å; K65-A68 PolarHBondContact O-N 3.32Å; L66-A68 VanDerWaalsContact C-N 3.33Å; L66-A68 PolarHBondContact O-N 2.97Å; A68-S72 PolarHBondContact O-N 3.21Å; A68-S72 VanDerWaalsContact O-N 3.07Å; A68-S72 PolarHBondContact O-OG 3.44Å
69	M	73.3	Confident	73.1	Confident	105 Å²	105	111.2 Å²	111.2	52%	0.517	57%	0.568	S	S	.	*	H	α-helix	trans	-66.3	-39.6	173.9	-77.9	178.3	164.8	0	0	112.2	K65 L66 S72 L73	K65-M69 WeakPolarHBondContact O-CG 3.39Å; K65-M69 PolarHBondContact O-N 3.44Å; L66-M69 PolarHBondContact O-N 2.93Å; M69-S72 VanDerWaalsContact CA-OG 3.31Å; M69-S72 WeakPolarHBondContact CA-OG 3.47Å; M69-S72 PolarHBondContact O-N 2.96Å; M69-S72 PolarHBondContact O-OG 3.43Å; M69-L73 PolarHBondContact O-N 3.07Å
70	S	73.4	Confident	73	Confident	49 Å²	49	111.4 Å²	111.4	34%	0.343	57%	0.572	S	S	.	*	H	α-helix	trans	-67.6	-42.8	176.9	62.1	0	0	0	0	111.6	L66 H67 S72 L73 Y74	L66-S70 PolarHBondContact O-N 3.33Å; L66-S70 PolarHBondContact O-OG 2.8Å; H67-S70 WeakPolarHBondContact CA-OG 3.38Å; H67-S70 PolarHBondContact O-N 3.42Å; H67-S70 PolarHBondContact O-OG 2.91Å; S70-S72 VanDerWaalsContact C-N 3.32Å; S70-S72 PolarHBondContact O-N 2.81Å; S70-L73 PolarHBondContact O-N 3.25Å; S70-Y74 VanDerWaalsContact O-CD2 3.23Å; S70-Y74 WeakPolarHBondContact O-CD2 3.27Å; S70-Y74 PolarHBondContact O-N 3.19Å
71	I	75.7	Confident	73.1	Confident	82 Å²	82	114.8 Å²	114.8	42%	0.421	59%	0.586	S	S	.	*	H	α-helix	trans	-60	-43.6	175.6	-69.3	165.3	0	0	0	111	H67 L73 Y74 L75	H67-I71 VanDerWaalsContact CE1-CD1 3.42Å; H67-I71 WeakPolarHBondContact CE1-CD1 3.31Å; H67-I71 VanDerWaalsContact ND1-CD1 3.31Å; H67-I71 WeakPolarHBondContact ND1-CD1 3.42Å; H67-I71 VanDerWaalsContact O-CG1 3.27Å; H67-I71 WeakPolarHBondContact O-CG1 3.48Å; H67-I71 PolarHBondContact O-N 3.01Å; I71-L73 VanDerWaalsContact C-N 3.31Å; I71-L73 PolarHBondContact O-N 3.05Å; I71-Y74 PolarHBondContact O-N 3.02Å; I71-L75 HydrophobicContact CG2-CD1 3.88Å; I71-L75 WeakPolarHBondContact O-CG 3.23Å; I71-L75 PolarHBondContact O-N 3.45Å
72	S	74	Confident	73.1	Confident	63 Å²	63	115.4 Å²	115.4	44%	0.441	59%	0.587	S	S	.	*	H	α-helix	trans	-67.2	-30.9	178.4	42.7	0	0	0	0	113	A68 M69 S70	A68-S72 PolarHBondContact O-N 3.21Å; A68-S72 VanDerWaalsContact O-N 3.07Å; A68-S72 PolarHBondContact O-OG 3.44Å; M69-S72 VanDerWaalsContact CA-OG 3.31Å; M69-S72 WeakPolarHBondContact CA-OG 3.47Å; M69-S72 PolarHBondContact O-N 2.96Å; M69-S72 PolarHBondContact O-OG 3.43Å; S70-S72 VanDerWaalsContact C-N 3.32Å; S70-S72 PolarHBondContact O-N 2.81Å
73	L	72.9	Confident	73.2	Confident	136 Å²	136	116.7 Å²	116.7	71%	0.712	59%	0.592	S	S	*	*	H	α-helix	trans	-70.4	-32.7	173	-150.7	91.9	0	0	0	112.8	M69 S70 I71	M69-L73 PolarHBondContact O-N 3.07Å; S70-L73 PolarHBondContact O-N 3.25Å; I71-L73 VanDerWaalsContact C-N 3.31Å; I71-L73 PolarHBondContact O-N 3.05Å
74	Y	73.7	Confident	73.1	Confident	204 Å²	204	118.6 Å²	118.6	80%	0.8	60%	0.599	S	S	*	*	H	α-helix	trans	-77.5	-18.1	177.2	-87	-72.4	0	0	0	114	S70 I71	S70-Y74 VanDerWaalsContact O-CD2 3.23Å; S70-Y74 WeakPolarHBondContact O-CD2 3.27Å; S70-Y74 PolarHBondContact O-N 3.19Å; I71-Y74 PolarHBondContact O-N 3.02Å
75	L	73.1	Confident	73	Confident	145 Å²	145	116.7 Å²	116.7	76%	0.759	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.4	-4.3	179.8	-77.3	169.7	0	0	0	113.8	I71	I71-L75 HydrophobicContact CG2-CD1 3.88Å; I71-L75 WeakPolarHBondContact O-CG 3.23Å; I71-L75 PolarHBondContact O-N 3.45Å
76	I	65.8	Low	72.8	Confident	199 Å²	199	115.4 Å²	115.4	100%	1.021	60%	0.601	S	S	*	*			trans	-96.5	0	171.9	-65.4	170.8	0	0	0	108.3

Retrieved 76 of 76 residues in 85.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).