A0A5K4FB66_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4FB66, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 78 aa.

						>A0A5K4FB66_SCHMA|A0A5K4FB66
MNSKYYLIIFMILLLSNKIESEEVGDSSENQKSKKPSDKAPIQAMFLPLAFPWANILVKLACKIKSWLSVTKFFGITS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.1	Very low	72.3	Confident	194 Å²	194	121.6 Å²	121.6	96%	0.956	59%	0.589	S	S	*	*				0	114.8	0	-83.5	158.1	77.1	0	108.9	S3 Y6	M1-S3 PolarHBondContact O-N 3.15Å; M1-Y6 HydrophobicContact CB-CE2 4.28Å
2	N	58.5	Low	73.3	Confident	109 Å²	109	119.8 Å²	119.8	58%	0.583	58%	0.582	S	S	*	*			trans	-62.8	130.8	-174.8	-64.9	-51	0	0	110.8	K4 Y5	N2-K4 PolarHBondContact O-N 3.36Å; N2-Y5 HydrophobicContact CB-CD2 3.96Å; N2-Y5 HydrophobicContact CB-CE2 4.04Å; N2-Y5 WeakPolarHBondContact O-CD2 3.5Å; N2-Y5 PolarHBondContact O-N 3.46Å
3	S	69.9	Low	73.8	Confident	90 Å²	90	118 Å²	118	63%	0.629	58%	0.576	S	S	*	*	H	α-helix	trans	-48.8	-27.1	179.4	52	0	0	0	113.9	M1 Y5 Y6 L7	M1-S3 PolarHBondContact O-N 3.15Å; S3-Y5 VanDerWaalsContact C-N 3.33Å; S3-Y5 PolarHBondContact O-N 3.43Å; S3-Y6 PolarHBondContact O-N 3.47Å; S3-L7 PolarHBondContact O-N 3.22Å
4	K	73.4	Confident	73.7	Confident	157 Å²	157	115.9 Å²	115.9	68%	0.683	57%	0.568	S	S	*	*	H	α-helix	trans	-56.9	-39.1	176.8	-59.6	-176.7	179.4	-178.2	113.5	N2 Y6 L7 I8	N2-K4 PolarHBondContact O-N 3.36Å; K4-Y6 VanDerWaalsContact C-N 3.32Å; K4-Y6 PolarHBondContact O-N 2.83Å; K4-L7 PolarHBondContact O-N 3.05Å; K4-I8 WeakPolarHBondContact O-CG1 3.41Å; K4-I8 PolarHBondContact O-N 2.85Å
5	Y	79.6	Confident	73.9	Confident	143 Å²	143	115.5 Å²	115.5	56%	0.561	57%	0.569	S	S	*	*	H	α-helix	trans	-67.1	-34.4	179.9	-67.5	-75.1	0	0	112.4	N2 S3 L7 I8 I9	N2-Y5 HydrophobicContact CB-CD2 3.96Å; N2-Y5 HydrophobicContact CB-CE2 4.04Å; N2-Y5 WeakPolarHBondContact O-CD2 3.5Å; N2-Y5 PolarHBondContact O-N 3.46Å; S3-Y5 VanDerWaalsContact C-N 3.33Å; S3-Y5 PolarHBondContact O-N 3.43Å; Y5-L7 VanDerWaalsContact C-N 3.32Å; Y5-L7 PolarHBondContact O-N 2.89Å; Y5-I8 PolarHBondContact O-N 3.49Å; Y5-I9 WeakPolarHBondContact O-CG1 3.47Å; Y5-I9 PolarHBondContact O-N 3.13Å
6	Y	75.5	Confident	74	Confident	134 Å²	134	112.1 Å²	112.1	53%	0.525	56%	0.56	S	S	.	*	H	α-helix	trans	-65.4	-37.1	177.3	-70.6	-79.3	0	0	112.1	M1 S3 K4 F10	M1-Y6 HydrophobicContact CB-CE2 4.28Å; S3-Y6 PolarHBondContact O-N 3.47Å; K4-Y6 VanDerWaalsContact C-N 3.32Å; K4-Y6 PolarHBondContact O-N 2.83Å; Y6-F10 WeakPolarHBondContact O-CB 3.41Å; Y6-F10 PolarHBondContact O-N 3.3Å
7	L	73.9	Confident	73.3	Confident	114 Å²	114	111.2 Å²	111.2	60%	0.597	56%	0.558	S	S	*	*	H	α-helix	trans	-66.4	-40.1	175.9	-68.2	175.5	0	0	111.5	S3 K4 Y5 F10 M11	S3-L7 PolarHBondContact O-N 3.22Å; K4-L7 PolarHBondContact O-N 3.05Å; Y5-L7 VanDerWaalsContact C-N 3.32Å; Y5-L7 PolarHBondContact O-N 2.89Å; L7-F10 PolarHBondContact O-N 2.98Å; L7-M11 WeakPolarHBondContact O-CB 3.33Å; L7-M11 VanDerWaalsContact O-CG 3.27Å; L7-M11 WeakPolarHBondContact O-CG 3.33Å; L7-M11 PolarHBondContact O-N 3.17Å
8	I	78.7	Confident	72.6	Confident	94 Å²	94	111.9 Å²	111.9	48%	0.482	56%	0.556	S	S	.	*	H	α-helix	trans	-64.2	-50	177.5	-65.2	165.8	0	0	110.5	K4 Y5 F10 M11 I12	K4-I8 WeakPolarHBondContact O-CG1 3.41Å; K4-I8 PolarHBondContact O-N 2.85Å; Y5-I8 PolarHBondContact O-N 3.49Å; I8-F10 VanDerWaalsContact C-N 3.28Å; I8-F10 PolarHBondContact O-N 3.3Å; I8-M11 PolarHBondContact O-N 2.75Å; I8-I12 HydrophobicContact CG2-CD1 3.86Å; I8-I12 VanDerWaalsContact O-CG1 3.31Å; I8-I12 WeakPolarHBondContact O-CG1 3.45Å; I8-I12 PolarHBondContact O-N 3.48Å
9	I	79.9	Confident	72.1	Confident	97 Å²	97	110.5 Å²	110.5	50%	0.497	55%	0.55	S	S	.	*	H	α-helix	trans	-60.4	-40.3	178	-66.2	165.7	0	0	110.8	Y5 I12 L13	Y5-I9 WeakPolarHBondContact O-CG1 3.47Å; Y5-I9 PolarHBondContact O-N 3.13Å; I9-I12 PolarHBondContact O-N 2.89Å; I9-L13 HydrophobicContact CG2-CD1 3.94Å; I9-L13 WeakPolarHBondContact O-CB 3.36Å; I9-L13 PolarHBondContact O-N 2.82Å
10	F	77.4	Confident	71.2	Confident	93 Å²	93	111.6 Å²	111.6	41%	0.408	55%	0.553	S	S	.	*	H	α-helix	trans	-64.2	-41.8	176.6	-179	-104.8	0	0	112.5	Y6 L7 I8 L13 L14	Y6-F10 WeakPolarHBondContact O-CB 3.41Å; Y6-F10 PolarHBondContact O-N 3.3Å; L7-F10 PolarHBondContact O-N 2.98Å; I8-F10 VanDerWaalsContact C-N 3.28Å; I8-F10 PolarHBondContact O-N 3.3Å; F10-L13 PolarHBondContact O-N 2.94Å; F10-L14 HydrophobicContact CD1-CD1 3.97Å; F10-L14 HydrophobicContact CD2-CD1 3.99Å; F10-L14 HydrophobicContact CE1-CD1 3.53Å; F10-L14 HydrophobicContact CE1-CD2 4.43Å; F10-L14 HydrophobicContact CE2-CD1 3.56Å; F10-L14 HydrophobicContact CG-CD1 4.18Å; F10-L14 HydrophobicContact CZ-CD1 3.31Å; F10-L14 WeakPolarHBondContact O-CD1 3.46Å; F10-L14 PolarHBondContact O-N 3.41Å
11	M	79.2	Confident	70.2	Confident	113 Å²	113	110.7 Å²	110.7	56%	0.557	56%	0.558	S	S	*	*	H	α-helix	trans	-65.6	-39.6	176	-73.3	-68.2	146.3	0	112	L7 I8 L14 L15	L7-M11 WeakPolarHBondContact O-CB 3.33Å; L7-M11 VanDerWaalsContact O-CG 3.27Å; L7-M11 WeakPolarHBondContact O-CG 3.33Å; L7-M11 PolarHBondContact O-N 3.17Å; I8-M11 PolarHBondContact O-N 2.75Å; M11-L14 PolarHBondContact O-N 2.86Å; M11-L15 WeakPolarHBondContact O-CB 3.24Å; M11-L15 PolarHBondContact O-N 3.49Å
12	I	84.4	Confident	70.3	Confident	99 Å²	99	107.6 Å²	107.6	51%	0.508	54%	0.541	S	S	.	.	H	α-helix	trans	-62.1	-47.9	174.7	-65.9	164.2	0	0	110.3	I8 I9 L14 L15 S16	I8-I12 HydrophobicContact CG2-CD1 3.86Å; I8-I12 VanDerWaalsContact O-CG1 3.31Å; I8-I12 WeakPolarHBondContact O-CG1 3.45Å; I8-I12 PolarHBondContact O-N 3.48Å; I9-I12 PolarHBondContact O-N 2.89Å; I12-L14 VanDerWaalsContact C-N 3.33Å; I12-L14 PolarHBondContact O-N 3.27Å; I12-L15 PolarHBondContact O-N 3.35Å; I12-S16 PolarHBondContact O-N 2.83Å; I12-S16 PolarHBondContact O-OG 2.9Å
13	L	79.5	Confident	69.7	Low	97 Å²	97	109.6 Å²	109.6	51%	0.508	55%	0.547	S	S	.	.	H	α-helix	trans	-60.1	-40.2	176.8	-86.3	156.7	0	0	112.7	I9 F10 N17	I9-L13 HydrophobicContact CG2-CD1 3.94Å; I9-L13 WeakPolarHBondContact O-CB 3.36Å; I9-L13 PolarHBondContact O-N 2.82Å; F10-L13 PolarHBondContact O-N 2.94Å; L13-N17 PolarHBondContact O-N 3.39Å; L13-N17 VanDerWaalsContact O-N 3.13Å; L13-N17 PolarHBondContact O-ND2 2.88Å
14	L	73	Confident	68.7	Low	88 Å²	88	110.7 Å²	110.7	46%	0.461	55%	0.55	S	S	.	*	H	α-helix	trans	-64.4	-43.5	175	-106.2	82.5	0	0	111.5	F10 M11 I12 N17 K18	F10-L14 HydrophobicContact CD1-CD1 3.97Å; F10-L14 HydrophobicContact CD2-CD1 3.99Å; F10-L14 HydrophobicContact CE1-CD1 3.53Å; F10-L14 HydrophobicContact CE1-CD2 4.43Å; F10-L14 HydrophobicContact CE2-CD1 3.56Å; F10-L14 HydrophobicContact CG-CD1 4.18Å; F10-L14 HydrophobicContact CZ-CD1 3.31Å; F10-L14 WeakPolarHBondContact O-CD1 3.46Å; F10-L14 PolarHBondContact O-N 3.41Å; M11-L14 PolarHBondContact O-N 2.86Å; I12-L14 VanDerWaalsContact C-N 3.33Å; I12-L14 PolarHBondContact O-N 3.27Å; L14-N17 PolarHBondContact O-N 3.16Å; L14-K18 PolarHBondContact O-N 3.45Å
15	L	77	Confident	67.2	Low	110 Å²	110	106 Å²	106	58%	0.576	55%	0.547	S	S	*	.	H	α-helix	trans	-67.5	-43.7	-178.2	-157.7	73	0	0	111.1	M11 I12 N17 K18 I19	M11-L15 WeakPolarHBondContact O-CB 3.24Å; M11-L15 PolarHBondContact O-N 3.49Å; I12-L15 PolarHBondContact O-N 3.35Å; L15-N17 PolarHBondContact O-N 2.95Å; L15-K18 PolarHBondContact O-N 3.26Å; L15-I19 HydrophobicContact CG-CD1 4.25Å; L15-I19 WeakPolarHBondContact O-CD1 3.46Å; L15-I19 VanDerWaalsContact O-CG1 3.26Å; L15-I19 WeakPolarHBondContact O-CG1 3.32Å; L15-I19 PolarHBondContact O-N 3.21Å
16	S	75.4	Confident	65.3	Low	62 Å²	62	106.1 Å²	106.1	43%	0.434	56%	0.557	S	S	.	*	H	α-helix	trans	-60.5	-43.7	175.7	-64.9	0	0	0	112.5	I12 K18 I19 E20	I12-S16 PolarHBondContact O-N 2.83Å; I12-S16 PolarHBondContact O-OG 2.9Å; S16-K18 VanDerWaalsContact C-N 3.3Å; S16-K18 PolarHBondContact O-N 2.83Å; S16-I19 PolarHBondContact O-N 3.44Å; S16-E20 PolarHBondContact O-N 2.81Å
17	N	61.5	Low	63.9	Low	97 Å²	97	104.5 Å²	104.5	52%	0.519	57%	0.565	S	S	.	*	H	α-helix	trans	-64.7	-34.2	175.7	-82.9	-67.7	0	0	112.7	L13 L14 L15 S21	L13-N17 PolarHBondContact O-N 3.39Å; L13-N17 VanDerWaalsContact O-N 3.13Å; L13-N17 PolarHBondContact O-ND2 2.88Å; L14-N17 PolarHBondContact O-N 3.16Å; L15-N17 PolarHBondContact O-N 2.95Å; N17-S21 PolarHBondContact O-N 3.42Å; N17-S21 VanDerWaalsContact O-N 3.12Å; N17-S21 PolarHBondContact O-OG 3.48Å; N17-S21 VanDerWaalsContact O-OG 3.07Å
18	K	61.6	Low	62.3	Low	123 Å²	123	104.1 Å²	104.1	54%	0.535	57%	0.572	S	S	.	*	H	α-helix	trans	-68.7	-43.3	175.7	-168.8	-176.5	179.2	-77	111	L14 L15 S16 S21 E22	L14-K18 PolarHBondContact O-N 3.45Å; L15-K18 PolarHBondContact O-N 3.26Å; S16-K18 VanDerWaalsContact C-N 3.3Å; S16-K18 PolarHBondContact O-N 2.83Å; K18-S21 PolarHBondContact O-N 2.86Å; K18-E22 IonicContact NZ-OE2 2.68Å; K18-E22 PolarHBondContact NZ-OE2 2.86Å; K18-E22 PolarHBondContact O-N 2.93Å
19	I	62.2	Low	60.4	Low	85 Å²	85	108 Å²	108	44%	0.436	59%	0.588	S	S	.	*	H	α-helix	trans	-61.1	-46.3	177.6	-66.1	159.6	0	0	110.1	L15 S16 S21 E22 E23	L15-I19 HydrophobicContact CG-CD1 4.25Å; L15-I19 WeakPolarHBondContact O-CD1 3.46Å; L15-I19 VanDerWaalsContact O-CG1 3.26Å; L15-I19 WeakPolarHBondContact O-CG1 3.32Å; L15-I19 PolarHBondContact O-N 3.21Å; S16-I19 PolarHBondContact O-N 3.44Å; I19-S21 VanDerWaalsContact C-N 3.27Å; I19-S21 PolarHBondContact O-N 3.47Å; I19-E22 PolarHBondContact O-N 3.32Å; I19-E23 HydrophobicContact CG2-CG 4.44Å; I19-E23 PolarHBondContact O-N 2.86Å
20	E	53.5	Low	58.3	Low	132 Å²	132	110.8 Å²	110.8	62%	0.617	60%	0.604	S	S	*	*	H	α-helix	trans	-62.8	-35.2	178.3	-156	177.3	148.1	0	111.9	S16 V24	S16-E20 PolarHBondContact O-N 2.81Å; E20-V24 WeakPolarHBondContact O-CB 3.43Å; E20-V24 WeakPolarHBondContact O-CG2 3.39Å; E20-V24 PolarHBondContact O-N 3.29Å
21	S	52.1	Low	56.4	Low	94 Å²	94	115.4 Å²	115.4	66%	0.657	63%	0.627	S	S	*	*	H	α-helix	trans	-72.7	-26.5	174	-63.7	0	0	0	113.9	N17 K18 I19	N17-S21 PolarHBondContact O-N 3.42Å; N17-S21 VanDerWaalsContact O-N 3.12Å; N17-S21 PolarHBondContact O-OG 3.48Å; N17-S21 VanDerWaalsContact O-OG 3.07Å; K18-S21 PolarHBondContact O-N 2.86Å; I19-S21 VanDerWaalsContact C-N 3.27Å; I19-S21 PolarHBondContact O-N 3.47Å
22	E	50.6	Low	54.5	Low	128 Å²	128	119.6 Å²	119.6	60%	0.598	64%	0.642	S	S	*	*	H	α-helix	trans	-84.6	-38.2	179.5	-141.3	168.7	120.1	0	111.1	K18 I19 G25	K18-E22 IonicContact NZ-OE2 2.68Å; K18-E22 PolarHBondContact NZ-OE2 2.86Å; K18-E22 PolarHBondContact O-N 2.93Å; I19-E22 PolarHBondContact O-N 3.32Å; E22-G25 PolarHBondContact O-N 3.19Å
23	E	45.1	Very low	52.5	Low	152 Å²	152	119.6 Å²	119.6	71%	0.71	65%	0.651	S	S	*	*	H	α-helix	trans	-69.9	-30.9	175.5	-76.8	-167.7	143.4	0	113.3	I19 G25	I19-E23 HydrophobicContact CG2-CG 4.44Å; I19-E23 PolarHBondContact O-N 2.86Å; E23-G25 PolarHBondContact O-N 2.95Å
24	V	48.3	Very low	50.5	Low	113 Å²	113	123.8 Å²	123.8	69%	0.685	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76	-12.7	174.1	178.1	0	0	0	111.8	E20	E20-V24 WeakPolarHBondContact O-CB 3.43Å; E20-V24 WeakPolarHBondContact O-CG2 3.39Å; E20-V24 PolarHBondContact O-N 3.29Å
25	G	43.5	Very low	48.6	Very low	59 Å²	59	128.8 Å²	128.8	61%	0.608	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.7	-21.2	179.5	0	0	0	0	115.3	E22 E23	E22-G25 PolarHBondContact O-N 3.19Å; E23-G25 PolarHBondContact O-N 2.95Å
26	D	38.8	Very low	46.9	Very low	145 Å²	145	129.7 Å²	129.7	78%	0.775	70%	0.695	S	S	*	*	S	Bend	trans	-111.9	12	-174.2	-123.7	-10.2	0	0	114.3	S28	D26-S28 PolarHBondContact O-N 3.02Å
27	S	45.4	Very low	45.4	Very low	100 Å²	100	131.9 Å²	131.9	70%	0.699	71%	0.711	S	S	*	*			trans	-80.8	59.1	160.2	-154	0	0	0	109.7	E29	S27-E29 PolarHBondContact O-N 3.47Å
28	S	42.3	Very low	44.6	Very low	106 Å²	106	134 Å²	134	74%	0.741	72%	0.722	S	S	*	*			trans	-73.6	62.7	164.7	171.8	0	0	0	109.1	D26	D26-S28 PolarHBondContact O-N 3.02Å
29	E	37.5	Very low	43.8	Very low	175 Å²	175	137.4 Å²	137.4	82%	0.818	74%	0.737	S	S	*	*			trans	-123.9	134.2	159.7	-94.7	-167.7	139.3	0	109.9	S27	S27-E29 PolarHBondContact O-N 3.47Å
30	N	36.1	Very low	43.2	Very low	156 Å²	156	137.1 Å²	137.1	83%	0.834	75%	0.747	S	S	*	*			trans	85	55.1	171.8	-121.9	-0.3	0	0	116.9
31	Q	37.7	Very low	43	Very low	190 Å²	190	135.9 Å²	135.9	89%	0.888	75%	0.75	S	S	*	*			trans	-49.4	141.5	133.4	-80.9	-173.8	-4.7	0	109.6
32	K	38.4	Very low	43.2	Very low	200 Å²	200	137 Å²	137	87%	0.87	75%	0.748	S	S	*	*			trans	102.7	66.2	161.1	-150.7	175.7	-169.1	176.3	115.8
33	S	42	Very low	43.3	Very low	99 Å²	99	138.9 Å²	138.9	69%	0.692	76%	0.757	S	S	*	*			trans	-153.4	121.5	135.4	-150.6	0	0	0	113.1
34	K	39	Very low	43.8	Very low	185 Å²	185	134.7 Å²	134.7	80%	0.804	75%	0.748	S	S	*	*			trans	68.5	109.4	149.4	-75.2	169.8	175.6	172	118.7
35	K	33.7	Very low	44.1	Very low	193 Å²	193	136.8 Å²	136.8	84%	0.839	75%	0.752	S	S	*	*			trans	52.1	122.7	138.6	-80.3	-178	173.9	179.6	116.8	S37	K35-S37 VanDerWaalsContact C-N 3.26Å; K35-S37 PolarHBondContact O-N 2.93Å
36	P	40.5	Very low	44.7	Very low	130 Å²	130	140.4 Å²	140.4	84%	0.844	75%	0.751	S	S	*	*			trans	-68.6	90.2	169.9	31.5	-31.3	0	0	108	D38	P36-D38 PolarHBondContact O-N 3.47Å
37	S	43.2	Very low	45.5	Very low	108 Å²	108	139.3 Å²	139.3	76%	0.755	75%	0.745	S	S	*	*			trans	-72.4	115.4	156.8	179.2	0	0	0	105.4	K35 K39	K35-S37 VanDerWaalsContact C-N 3.26Å; K35-S37 PolarHBondContact O-N 2.93Å; S37-K39 PolarHBondContact O-N 3.38Å
38	D	45.9	Very low	46	Very low	140 Å²	140	138.9 Å²	138.9	75%	0.749	74%	0.74	S	S	*	*	S	Bend	trans	-37.8	136.3	171	-64.9	-60.1	0	0	111.5	P36	P36-D38 PolarHBondContact O-N 3.47Å
39	K	45	Very low	46.8	Very low	196 Å²	196	138.7 Å²	138.7	85%	0.852	73%	0.73	S	S	*	*			trans	93.2	65.5	-179.7	-48.3	163.2	-165.5	-173.9	114.2	S37	S37-K39 PolarHBondContact O-N 3.38Å
40	A	49.2	Very low	47.9	Very low	79 Å²	79	133.1 Å²	133.1	65%	0.653	71%	0.714	S	S	*	*			trans	-54.6	132.3	152.9	0	0	0	0	108.6	I42	A40-I42 PolarHBondContact O-N 3.28Å
41	P	48.9	Very low	49.2	Very low	105 Å²	105	133.7 Å²	133.7	68%	0.682	71%	0.709	S	S	*	*			trans	-73.5	75.8	-174.2	31.4	-35.9	0	0	110.5	Q43 A44	P41-Q43 PolarHBondContact O-N 2.9Å; P41-A44 PolarHBondContact O-N 3.26Å
42	I	56.2	Low	50.7	Low	119 Å²	119	127.6 Å²	127.6	61%	0.61	69%	0.686	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.4	-17.4	164.9	-67.1	167.3	0	0	110.7	A40 A44 M45 F46	A40-I42 PolarHBondContact O-N 3.28Å; I42-A44 PolarHBondContact O-N 3.4Å; I42-M45 PolarHBondContact O-N 3.49Å; I42-F46 HydrophobicContact CG2-CD2 4.24Å; I42-F46 HydrophobicContact CG2-CE2 3.71Å; I42-F46 WeakPolarHBondContact O-CD2 3.26Å
43	Q	53	Low	52.1	Low	167 Å²	167	126.1 Å²	126.1	78%	0.78	68%	0.675	S	S	*	*	H	α-helix	trans	-64.1	-21.4	178.4	-153.1	168.8	11.4	0	114.3	P41	P41-Q43 PolarHBondContact O-N 2.9Å
44	A	55.5	Low	53.5	Low	63 Å²	63	123.7 Å²	123.7	52%	0.521	66%	0.661	S	S	.	*	H	α-helix	trans	-75.5	-27.5	176.5	0	0	0	0	113.5	P41 I42 F46 P48	P41-A44 PolarHBondContact O-N 3.26Å; I42-A44 PolarHBondContact O-N 3.4Å; A44-F46 VanDerWaalsContact C-N 3.34Å; A44-F46 PolarHBondContact O-N 3.3Å; A44-P48 WeakPolarHBondContact O-CD 3.47Å
45	M	54.7	Low	55.1	Low	158 Å²	158	118.4 Å²	118.4	78%	0.778	64%	0.642	S	S	*	*	H	α-helix	trans	-76.8	-18.3	-178.6	-72.4	-174	175.6	0	113.7	I42 P48	I42-M45 PolarHBondContact O-N 3.49Å; M45-P48 WeakPolarHBondContact O-CD 3.23Å
46	F	55.5	Low	57.2	Low	134 Å²	134	114.1 Å²	114.1	59%	0.588	63%	0.627	S	S	*	*	H	α-helix	trans	-87.1	-21.6	-179.1	-77.1	-81.5	0	0	114.2	I42 A44 L49 A50	I42-F46 HydrophobicContact CG2-CD2 4.24Å; I42-F46 HydrophobicContact CG2-CE2 3.71Å; I42-F46 WeakPolarHBondContact O-CD2 3.26Å; A44-F46 VanDerWaalsContact C-N 3.34Å; A44-F46 PolarHBondContact O-N 3.3Å; F46-L49 PolarHBondContact O-N 3.15Å; F46-A50 PolarHBondContact O-N 3.4Å
47	L	55.5	Low	59.1	Low	123 Å²	123	113.4 Å²	113.4	64%	0.644	62%	0.615	S	S	*	*	H	α-helix	trans	-58.5	-48.5	177.9	-81.4	143.8	0	0	113.5	L49 A50 F51	L47-L49 PolarHBondContact O-N 3.34Å; L47-A50 PolarHBondContact O-N 3.43Å; L47-F51 PolarHBondContact O-N 3.25Å
48	P	56.2	Low	60.8	Low	91 Å²	91	112.5 Å²	112.5	59%	0.591	61%	0.605	S	S	*	*	H	α-helix	trans	-71.3	-17.8	178.9	27.9	-35.2	0	0	113.2	A44 M45 P52	A44-P48 WeakPolarHBondContact O-CD 3.47Å; M45-P48 WeakPolarHBondContact O-CD 3.23Å; P48-P52 WeakPolarHBondContact O-CD 3.37Å; P48-P52 WeakPolarHBondContact O-CG 3.31Å
49	L	59.5	Low	62.4	Low	101 Å²	101	111.7 Å²	111.7	53%	0.529	60%	0.595	S	S	.	*	H	α-helix	trans	-82.4	-35	176.3	-147.2	75.8	0	0	111.8	F46 L47 P52 W53	F46-L49 PolarHBondContact O-N 3.15Å; L47-L49 PolarHBondContact O-N 3.34Å; L49-P52 WeakPolarHBondContact O-CD 3.3Å; L49-P52 WeakPolarHBondContact O-CG 3.31Å; L49-W53 VanDerWaalsContact O-CD1 3.31Å
50	A	60.8	Low	64.1	Low	59 Å²	59	106.9 Å²	106.9	49%	0.488	58%	0.578	S	S	.	*	H	α-helix	trans	-73.9	-33.1	178.8	0	0	0	0	113.1	F46 L47 W53 A54	F46-A50 PolarHBondContact O-N 3.4Å; L47-A50 PolarHBondContact O-N 3.43Å; A50-W53 WeakPolarHBondContact O-CB 3.3Å; A50-W53 PolarHBondContact O-N 3.23Å; A50-A54 PolarHBondContact O-N 3.29Å
51	F	62.3	Low	65.6	Low	168 Å²	168	105.9 Å²	105.9	74%	0.737	57%	0.57	S	S	*	*	H	α-helix	trans	-63.3	-46	-177.3	-149.7	-101.1	0	0	115.1	L47 W53 A54 N55	L47-F51 PolarHBondContact O-N 3.25Å; F51-W53 VanDerWaalsContact C-N 3.26Å; F51-W53 PolarHBondContact O-N 2.91Å; F51-A54 PolarHBondContact O-N 3.41Å; F51-N55 PolarHBondContact O-N 2.96Å; F51-N55 VanDerWaalsContact O-N 3.15Å
52	P	69.3	Low	67.1	Low	61 Å²	61	104.7 Å²	104.7	40%	0.396	56%	0.563	S	S	.	*	H	α-helix	trans	-65.1	-33.2	174.4	24	-32.3	0	0	111.4	P48 L49 N55 I56	P48-P52 WeakPolarHBondContact O-CD 3.37Å; P48-P52 WeakPolarHBondContact O-CG 3.31Å; L49-P52 WeakPolarHBondContact O-CD 3.3Å; L49-P52 WeakPolarHBondContact O-CG 3.31Å; P52-N55 PolarHBondContact O-N 2.97Å; P52-I56 WeakPolarHBondContact O-CD1 3.41Å; P52-I56 VanDerWaalsContact O-CG1 3.26Å; P52-I56 WeakPolarHBondContact O-CG1 3.5Å; P52-I56 PolarHBondContact O-N 3.38Å
53	W	68.7	Low	68.2	Low	169 Å²	169	106.6 Å²	106.6	64%	0.64	57%	0.567	S	S	*	*	H	α-helix	trans	-67.3	-41.7	177.1	-71.3	24.4	0	0	111.4	L49 A50 F51 N55 I56 L57	L49-W53 VanDerWaalsContact O-CD1 3.31Å; A50-W53 WeakPolarHBondContact O-CB 3.3Å; A50-W53 PolarHBondContact O-N 3.23Å; F51-W53 VanDerWaalsContact C-N 3.26Å; F51-W53 PolarHBondContact O-N 2.91Å; W53-N55 VanDerWaalsContact C-N 3.31Å; W53-N55 PolarHBondContact O-N 3.26Å; W53-I56 PolarHBondContact O-N 3.06Å; W53-L57 WeakPolarHBondContact O-CB 3.26Å; W53-L57 VanDerWaalsContact O-CG 3.3Å; W53-L57 WeakPolarHBondContact O-CG 3.37Å; W53-L57 PolarHBondContact O-N 3.31Å
54	A	70.7	Confident	69.5	Low	49 Å²	49	102.8 Å²	102.8	41%	0.405	55%	0.551	S	S	.	*	H	α-helix	trans	-58.4	-42.8	173	0	0	0	0	111.5	A50 F51 I56 L57 V58	A50-A54 PolarHBondContact O-N 3.29Å; F51-A54 PolarHBondContact O-N 3.41Å; A54-I56 PolarHBondContact O-N 3.46Å; A54-L57 PolarHBondContact O-N 3.3Å; A54-V58 VanDerWaalsContact O-CG2 3.3Å; A54-V58 WeakPolarHBondContact O-CG2 3.44Å; A54-V58 PolarHBondContact O-N 3.24Å
55	N	72.7	Confident	70.6	Confident	74 Å²	74	107.5 Å²	107.5	40%	0.396	56%	0.56	S	S	.	*	H	α-helix	trans	-65.8	-38.2	176.8	-166.4	12.8	0	0	112.4	F51 P52 W53 V58 K59	F51-N55 PolarHBondContact O-N 2.96Å; F51-N55 VanDerWaalsContact O-N 3.15Å; P52-N55 PolarHBondContact O-N 2.97Å; W53-N55 VanDerWaalsContact C-N 3.31Å; W53-N55 PolarHBondContact O-N 3.26Å; N55-V58 PolarHBondContact O-N 3.39Å; N55-K59 WeakPolarHBondContact O-CB 3.48Å; N55-K59 WeakPolarHBondContact O-CG 3.3Å; N55-K59 PolarHBondContact O-N 2.95Å
56	I	78.2	Confident	71.8	Confident	102 Å²	102	103.6 Å²	103.6	52%	0.523	55%	0.548	S	S	.	.	H	α-helix	trans	-63	-44.5	173.9	-69.3	157.2	0	0	110.3	P52 W53 A54 K59 L60	P52-I56 WeakPolarHBondContact O-CD1 3.41Å; P52-I56 VanDerWaalsContact O-CG1 3.26Å; P52-I56 WeakPolarHBondContact O-CG1 3.5Å; P52-I56 PolarHBondContact O-N 3.38Å; W53-I56 PolarHBondContact O-N 3.06Å; A54-I56 PolarHBondContact O-N 3.46Å; I56-K59 PolarHBondContact O-N 3.18Å; I56-L60 WeakPolarHBondContact O-CB 3.49Å; I56-L60 PolarHBondContact O-N 2.95Å
57	L	80.1	Confident	72.7	Confident	116 Å²	116	105.9 Å²	105.9	61%	0.607	55%	0.553	S	S	*	*	H	α-helix	trans	-64.1	-42.8	177.4	-70.8	171.9	0	0	112.1	W53 A54 L60 A61	W53-L57 WeakPolarHBondContact O-CB 3.26Å; W53-L57 VanDerWaalsContact O-CG 3.3Å; W53-L57 WeakPolarHBondContact O-CG 3.37Å; W53-L57 PolarHBondContact O-N 3.31Å; A54-L57 PolarHBondContact O-N 3.3Å; L57-L60 PolarHBondContact O-N 3.41Å; L57-A61 VanDerWaalsContact O-CB 3.31Å; L57-A61 WeakPolarHBondContact O-CB 3.39Å; L57-A61 PolarHBondContact O-N 2.97Å
58	V	79	Confident	73.5	Confident	88 Å²	88	104.2 Å²	104.2	53%	0.533	54%	0.544	S	S	.	.	H	α-helix	trans	-62.9	-44	175.3	171.5	0	0	0	110.6	A54 N55 L60 A61 C62	A54-V58 VanDerWaalsContact O-CG2 3.3Å; A54-V58 WeakPolarHBondContact O-CG2 3.44Å; A54-V58 PolarHBondContact O-N 3.24Å; N55-V58 PolarHBondContact O-N 3.39Å; V58-L60 VanDerWaalsContact C-N 3.34Å; V58-L60 PolarHBondContact O-N 3.36Å; V58-A61 PolarHBondContact O-N 2.94Å; V58-C62 WeakPolarHBondContact O-CB 3.37Å; V58-C62 PolarHBondContact O-N 3.47Å; V58-C62 PolarHBondContact O-SG 3.13Å
59	K	79.8	Confident	74.1	Confident	123 Å²	123	103 Å²	103	54%	0.535	54%	0.537	S	S	.	.	H	α-helix	trans	-62	-40.8	174.8	-77.5	178.6	-178.6	174.7	112.2	N55 I56 C62 K63	N55-K59 WeakPolarHBondContact O-CB 3.48Å; N55-K59 WeakPolarHBondContact O-CG 3.3Å; N55-K59 PolarHBondContact O-N 2.95Å; I56-K59 PolarHBondContact O-N 3.18Å; K59-C62 PolarHBondContact O-N 3.26Å; K59-K63 PolarHBondContact O-N 3.48Å
60	L	81.1	Confident	74.4	Confident	96 Å²	96	101.4 Å²	101.4	50%	0.503	53%	0.532	S	S	.	.	H	α-helix	trans	-65.4	-47.2	177.7	-146.9	84.6	0	0	110.6	I56 L57 V58 C62 K63 I64	I56-L60 WeakPolarHBondContact O-CB 3.49Å; I56-L60 PolarHBondContact O-N 2.95Å; L57-L60 PolarHBondContact O-N 3.41Å; V58-L60 VanDerWaalsContact C-N 3.34Å; V58-L60 PolarHBondContact O-N 3.36Å; L60-C62 VanDerWaalsContact C-N 3.33Å; L60-C62 PolarHBondContact O-N 2.84Å; L60-K63 PolarHBondContact O-N 3.49Å; L60-K63 VanDerWaalsContact O-N 3.16Å; L60-I64 HydrophobicContact CD2-CD1 4.23Å; L60-I64 HydrophobicContact CG-CD1 4.22Å; L60-I64 WeakPolarHBondContact O-CD1 3.19Å; L60-I64 VanDerWaalsContact O-CG1 3.23Å; L60-I64 WeakPolarHBondContact O-CG1 3.36Å; L60-I64 PolarHBondContact O-N 2.87Å
61	A	80.9	Confident	74.7	Confident	58 Å²	58	100.3 Å²	100.3	48%	0.479	52%	0.519	S	S	.	.	H	α-helix	trans	-60.6	-41.1	176.7	0	0	0	0	111.8	L57 V58 I64 K65	L57-A61 VanDerWaalsContact O-CB 3.31Å; L57-A61 WeakPolarHBondContact O-CB 3.39Å; L57-A61 PolarHBondContact O-N 2.97Å; V58-A61 PolarHBondContact O-N 2.94Å; A61-I64 PolarHBondContact O-N 2.97Å; A61-K65 VanDerWaalsContact O-CB 3.3Å; A61-K65 WeakPolarHBondContact O-CB 3.27Å; A61-K65 PolarHBondContact O-N 3.36Å
62	C	79.4	Confident	74.6	Confident	79 Å²	79	99.3 Å²	99.3	53%	0.534	51%	0.514	S	S	.	.	H	α-helix	trans	-64.1	-42.1	173.8	-74.7	0	0	0	112.3	V58 K59 L60 S66	V58-C62 WeakPolarHBondContact O-CB 3.37Å; V58-C62 PolarHBondContact O-N 3.47Å; V58-C62 PolarHBondContact O-SG 3.13Å; K59-C62 PolarHBondContact O-N 3.26Å; L60-C62 VanDerWaalsContact C-N 3.33Å; L60-C62 PolarHBondContact O-N 2.84Å; C62-S66 VanDerWaalsContact O-CB 3.26Å; C62-S66 WeakPolarHBondContact O-CB 3.47Å; C62-S66 PolarHBondContact O-N 3.17Å
63	K	79.3	Confident	74.2	Confident	160 Å²	160	105.2 Å²	105.2	70%	0.696	53%	0.534	S	S	*	.	H	α-helix	trans	-64.1	-45	174.9	-83	-169.9	175.3	-169.1	112	K59 L60 S66 W67	K59-K63 PolarHBondContact O-N 3.48Å; L60-K63 PolarHBondContact O-N 3.49Å; L60-K63 VanDerWaalsContact O-N 3.16Å; K63-S66 PolarHBondContact O-N 3.18Å; K63-W67 VanDerWaalsContact O-CB 3.31Å; K63-W67 WeakPolarHBondContact O-CB 3.47Å; K63-W67 PolarHBondContact O-N 2.93Å
64	I	80.9	Confident	73.9	Confident	87 Å²	87	104.5 Å²	104.5	45%	0.446	54%	0.536	S	S	.	.	H	α-helix	trans	-62.7	-45.9	178	-65.6	160.1	0	0	109.8	L60 A61 S66 W67 L68	L60-I64 HydrophobicContact CD2-CD1 4.23Å; L60-I64 HydrophobicContact CG-CD1 4.22Å; L60-I64 WeakPolarHBondContact O-CD1 3.19Å; L60-I64 VanDerWaalsContact O-CG1 3.23Å; L60-I64 WeakPolarHBondContact O-CG1 3.36Å; L60-I64 PolarHBondContact O-N 2.87Å; A61-I64 PolarHBondContact O-N 2.97Å; I64-S66 PolarHBondContact O-N 3.06Å; I64-W67 PolarHBondContact O-N 3.4Å; I64-L68 HydrophobicContact CG2-CD1 4.2Å; I64-L68 WeakPolarHBondContact O-CB 2.86Å; I64-L68 PolarHBondContact O-N 2.76Å
65	K	77.8	Confident	73.4	Confident	162 Å²	162	104.5 Å²	104.5	70%	0.704	54%	0.541	S	S	*	.	H	α-helix	trans	-62.4	-42.8	176.8	-173.4	178.8	-179.7	-179.5	112.1	A61 L68 S69	A61-K65 VanDerWaalsContact O-CB 3.3Å; A61-K65 WeakPolarHBondContact O-CB 3.27Å; A61-K65 PolarHBondContact O-N 3.36Å; K65-L68 PolarHBondContact O-N 3.07Å; K65-S69 WeakPolarHBondContact O-CB 3.33Å; K65-S69 PolarHBondContact O-N 3.2Å
66	S	79.5	Confident	72.6	Confident	76 Å²	76	107.1 Å²	107.1	53%	0.531	55%	0.553	S	S	.	*	H	α-helix	trans	-60.5	-47.3	174.9	-174.1	0	0	0	110.7	C62 K63 I64 L68 S69 V70	C62-S66 VanDerWaalsContact O-CB 3.26Å; C62-S66 WeakPolarHBondContact O-CB 3.47Å; C62-S66 PolarHBondContact O-N 3.17Å; K63-S66 PolarHBondContact O-N 3.18Å; I64-S66 PolarHBondContact O-N 3.06Å; S66-L68 PolarHBondContact O-N 3.12Å; S66-S69 WeakPolarHBondContact O-CB 3.39Å; S66-S69 PolarHBondContact O-N 3.41Å; S66-V70 WeakPolarHBondContact O-CG2 3.31Å; S66-V70 PolarHBondContact O-N 3.06Å
67	W	76	Confident	71.3	Confident	182 Å²	182	107.8 Å²	107.8	69%	0.689	56%	0.562	S	S	*	*	H	α-helix	trans	-66.5	-37.9	178.1	-165	46	0	0	112.8	K63 I64 S69 V70 T71	K63-W67 VanDerWaalsContact O-CB 3.31Å; K63-W67 WeakPolarHBondContact O-CB 3.47Å; K63-W67 PolarHBondContact O-N 2.93Å; I64-W67 PolarHBondContact O-N 3.4Å; W67-S69 VanDerWaalsContact C-N 3.32Å; W67-S69 PolarHBondContact O-N 2.68Å; W67-V70 PolarHBondContact O-N 3.18Å; W67-T71 WeakPolarHBondContact O-CB 3.4Å; W67-T71 WeakPolarHBondContact O-CG2 3.43Å; W67-T71 PolarHBondContact O-N 3.25Å; W67-T71 PolarHBondContact O-OG1 2.97Å
68	L	71	Confident	69.6	Low	88 Å²	88	110.7 Å²	110.7	46%	0.461	59%	0.592	S	S	.	*	H	α-helix	trans	-63	-40.2	172.8	-124.4	94.7	0	0	111.5	I64 K65 S66 T71 K72	I64-L68 HydrophobicContact CG2-CD1 4.2Å; I64-L68 WeakPolarHBondContact O-CB 2.86Å; I64-L68 PolarHBondContact O-N 2.76Å; K65-L68 PolarHBondContact O-N 3.07Å; S66-L68 PolarHBondContact O-N 3.12Å; L68-T71 VanDerWaalsContact CA-OG1 3.24Å; L68-T71 WeakPolarHBondContact CA-OG1 3.43Å; L68-T71 PolarHBondContact O-OG1 3Å; L68-T71 VanDerWaalsContact O-OG1 3.05Å; L68-K72 WeakPolarHBondContact O-CB 3.49Å; L68-K72 WeakPolarHBondContact O-CG 3.47Å; L68-K72 PolarHBondContact O-N 3.31Å
69	S	69.2	Low	69.1	Low	64 Å²	64	111.9 Å²	111.9	45%	0.448	60%	0.595	S	S	.	*	H	α-helix	trans	-65.5	-42	176.7	-165.5	0	0	0	110.9	K65 S66 W67 F73	K65-S69 WeakPolarHBondContact O-CB 3.33Å; K65-S69 PolarHBondContact O-N 3.2Å; S66-S69 WeakPolarHBondContact O-CB 3.39Å; S66-S69 PolarHBondContact O-N 3.41Å; W67-S69 VanDerWaalsContact C-N 3.32Å; W67-S69 PolarHBondContact O-N 2.68Å; S69-F73 WeakPolarHBondContact O-CB 3.39Å; S69-F73 WeakPolarHBondContact O-CD2 3.49Å; S69-F73 PolarHBondContact O-N 3.33Å
70	V	66.2	Low	68.6	Low	69 Å²	69	111.3 Å²	111.3	42%	0.418	60%	0.599	S	S	.	*	H	α-helix	trans	-66.5	-44.5	176.7	174.6	0	0	0	110.9	S66 W67 F73 F74	S66-V70 WeakPolarHBondContact O-CG2 3.31Å; S66-V70 PolarHBondContact O-N 3.06Å; W67-V70 PolarHBondContact O-N 3.18Å; V70-F73 CarbonylContact O-C 3.58Å; V70-F73 WeakPolarHBondContact O-CB 3.26Å; V70-F73 PolarHBondContact O-N 3.25Å; V70-F73 VanDerWaalsContact O-N 3.17Å; V70-F74 HydrophobicContact CG1-CD2 3.79Å; V70-F74 HydrophobicContact CG1-CE2 4.1Å; V70-F74 WeakPolarHBondContact O-CB 3.19Å; V70-F74 WeakPolarHBondContact O-CD2 3.49Å; V70-F74 PolarHBondContact O-N 3.47Å
71	T	66.8	Low	67.9	Low	36 Å²	36	112.1 Å²	112.1	22%	0.221	60%	0.604	C	S	.	*	H	α-helix	trans	-67.6	-35.8	178.7	48.1	0	0	0	112.8	W67 L68 F74 G75 I76	W67-T71 WeakPolarHBondContact O-CB 3.4Å; W67-T71 WeakPolarHBondContact O-CG2 3.43Å; W67-T71 PolarHBondContact O-N 3.25Å; W67-T71 PolarHBondContact O-OG1 2.97Å; L68-T71 VanDerWaalsContact CA-OG1 3.24Å; L68-T71 WeakPolarHBondContact CA-OG1 3.43Å; L68-T71 PolarHBondContact O-OG1 3Å; L68-T71 VanDerWaalsContact O-OG1 3.05Å; T71-F74 CarbonylContact O-C 3.55Å; T71-F74 PolarHBondContact O-N 3.4Å; T71-G75 PolarHBondContact O-N 3.17Å; T71-G75 VanDerWaalsContact O-N 3.13Å; T71-I76 PolarHBondContact O-N 2.95Å
72	K	59.5	Low	67.1	Low	146 Å²	146	115.3 Å²	115.3	64%	0.635	61%	0.611	S	S	*	*	H	α-helix	trans	-62.2	-42.9	168.1	-79.1	-174.6	177.7	177.5	111.9	L68 F74 G75	L68-K72 WeakPolarHBondContact O-CB 3.49Å; L68-K72 WeakPolarHBondContact O-CG 3.47Å; L68-K72 PolarHBondContact O-N 3.31Å; K72-F74 VanDerWaalsContact C-N 3.3Å; K72-F74 PolarHBondContact O-N 3.26Å; K72-G75 PolarHBondContact O-N 3.41Å
73	F	62	Low	66.3	Low	185 Å²	185	117.6 Å²	117.6	81%	0.811	62%	0.616	S	S	*	*	H	α-helix	trans	-63.5	-36	174.3	-104.3	-82.9	0	0	112.6	S69 V70 G75	S69-F73 WeakPolarHBondContact O-CB 3.39Å; S69-F73 WeakPolarHBondContact O-CD2 3.49Å; S69-F73 PolarHBondContact O-N 3.33Å; V70-F73 CarbonylContact O-C 3.58Å; V70-F73 WeakPolarHBondContact O-CB 3.26Å; V70-F73 PolarHBondContact O-N 3.25Å; V70-F73 VanDerWaalsContact O-N 3.17Å; F73-G75 VanDerWaalsContact C-N 3.26Å; F73-G75 PolarHBondContact O-N 2.88Å
74	F	61.9	Low	65.5	Low	155 Å²	155	114.7 Å²	114.7	68%	0.68	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.8	1.6	177.1	-91.2	-83.9	0	0	114.1	V70 T71 K72 I76	V70-F74 HydrophobicContact CG1-CD2 3.79Å; V70-F74 HydrophobicContact CG1-CE2 4.1Å; V70-F74 WeakPolarHBondContact O-CB 3.19Å; V70-F74 WeakPolarHBondContact O-CD2 3.49Å; V70-F74 PolarHBondContact O-N 3.47Å; T71-F74 CarbonylContact O-C 3.55Å; T71-F74 PolarHBondContact O-N 3.4Å; K72-F74 VanDerWaalsContact C-N 3.3Å; K72-F74 PolarHBondContact O-N 3.26Å; F74-I76 HydrophobicContact CB-CD1 4.22Å; F74-I76 HydrophobicContact CB-CG1 4.34Å; F74-I76 PolarHBondContact O-N 2.96Å; F74-I76 VanDerWaalsContact O-N 3.15Å
75	G	59.9	Low	64.4	Low	49 Å²	49	116.7 Å²	116.7	51%	0.505	62%	0.622	S	S	.	*	T	Hydrogen-bonded Turn	trans	62.2	24.1	171.3	0	0	0	0	114.9	T71 K72 F73 T77	T71-G75 PolarHBondContact O-N 3.17Å; T71-G75 VanDerWaalsContact O-N 3.13Å; K72-G75 PolarHBondContact O-N 3.41Å; F73-G75 VanDerWaalsContact C-N 3.26Å; F73-G75 PolarHBondContact O-N 2.88Å; G75-T77 PolarHBondContact O-N 2.77Å
76	I	55.4	Low	63.3	Low	129 Å²	129	113.2 Å²	113.2	66%	0.662	62%	0.616	S	S	*	*			trans	-77.9	-7.6	-177.7	-64.9	169.7	0	0	112.1	T71 F74	T71-I76 PolarHBondContact O-N 2.95Å; F74-I76 HydrophobicContact CB-CD1 4.22Å; F74-I76 HydrophobicContact CB-CG1 4.34Å; F74-I76 PolarHBondContact O-N 2.96Å; F74-I76 VanDerWaalsContact O-N 3.15Å
77	T	52.9	Low	62	Low	116 Å²	116	116.3 Å²	116.3	71%	0.712	62%	0.623	S	S	*	*			trans	-100.7	73.7	165.9	60.4	0	0	0	109.4	G75	G75-T77 PolarHBondContact O-N 2.77Å
78	S	43	Very low	60.7	Low	177 Å²	177	110.4 Å²	110.4	100%	1.238	62%	0.617	S	S	*	*			trans	-88.3	0	150.3	-177.8	0	0	0	109.7

Retrieved 78 of 78 residues in 117.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).