A0A5K4FB82_SCHMA Loading...

Peptidase S1 domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4FB82, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 75 aa.

						>A0A5K4FB82_SCHMA|A0A5K4FB82
MECKHSTTGNPICVQAAYVFGQITAPGDSGGPLLRSPQGPVLGVVSHGVTLSNRLDVLVEYASVARMLGFVSSNI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.6	Low	68.5	Low	162 Å²	162	92.6 Å²	92.6	80%	0.798	53%	0.526	S	S	*	.				0	129	0	-99.3	167.2	-178	0	0	107.4	Q15 L58	M1-Q15 HydrophobicContact CE-CB 4.15Å; M1-Q15 HydrophobicContact SD-CB 3.87Å; M1-L58 HydrophobicContact SD-CD2 4.39Å
2	E	64.6	Low	70	Confident	181 Å²	181	88.9 Å²	88.9	85%	0.846	50%	0.503	S	S	*	.			trans	-87.5	147.4	168.2	-72.8	-175.9	145.2	0	0	109.4	K4	E2-K4 PolarHBondContact O-N 3.12Å
3	C	69.2	Low	71.1	Confident	30 Å²	30	83.4 Å²	83.4	20%	0.203	47%	0.473	C	S	.	.			trans	-61.8	125.2	172.2	-56.1	0	0	0	0	108.8	H5 T7 C13	C3-H5 VanDerWaalsContact C-N 3.25Å; C3-H5 PolarHBondContact O-N 3.28Å; C3-T7 HydrophobicContact CB-CG2 4.14Å; C3-C13 WeakPolarHBondContact CA-SG 3.45Å; C3-C13 HydrophobicContact CB-CB 4.04Å; C3-C13 WeakPolarHBondContact CB-SG 3.46Å; C3-C13 WeakPolarHBondContact SG-CB 3.39Å; C3-C13 CovalentContact SG-SG 2.01Å; C3-C13 PolarHBondContact SG-SG 2.79Å
4	K	65.7	Low	71.9	Confident	122 Å²	122	81.6 Å²	81.6	53%	0.53	46%	0.464	S	S	.	.	S	Bend	trans	-72.2	-19.2	-176.5	-81.7	-177.9	169.1	178.7	0	113	E2 L51 D56 L58	E2-K4 PolarHBondContact O-N 3.12Å; K4-L51 HydrophobicContact CB-CD1 3.84Å; K4-D56 HydrophobicContact CD-CB 4.31Å; K4-D56 IonicContact NZ-OD1 2.69Å; K4-D56 PolarHBondContact NZ-OD1 2.85Å; K4-D56 IonicContact NZ-OD2 2.78Å; K4-D56 PolarHBondContact NZ-OD2 2.9Å; K4-L58 HydrophobicContact CB-CD1 3.87Å; K4-L58 HydrophobicContact CD-CD1 4.28Å; K4-L58 HydrophobicContact CG-CD1 3.87Å
5	H	66	Low	72.3	Confident	47 Å²	47	82.8 Å²	82.8	22%	0.218	47%	0.465	C	S	.	.	S	Bend	trans	-101.1	152.4	173.8	80.7	83.4	0	0	0	111.9	C3 T7 V49 E60	C3-H5 VanDerWaalsContact C-N 3.25Å; C3-H5 PolarHBondContact O-N 3.28Å; H5-T7 WeakPolarHBondContact CE1-CG2 3.4Å; H5-T7 VanDerWaalsContact ND1-CG2 3.31Å; H5-T7 WeakPolarHBondContact ND1-CG2 3.21Å; H5-T7 WeakPolarHBondContact O-CG2 3.39Å; H5-T7 PolarHBondContact O-N 3.12Å; H5-T7 VanDerWaalsContact O-N 3.15Å; H5-V49 VanDerWaalsContact NE2-CG2 3.34Å; H5-V49 WeakPolarHBondContact NE2-CG2 3.46Å; H5-E60 VanDerWaalsContact CD2-CD 3.41Å; H5-E60 IonicContact CD2-OE1 2.91Å; H5-E60 PolarHBondContact CD2-OE1 2.89Å; H5-E60 IonicContact CD2-OE2 3.75Å; H5-E60 IonicContact CE1-OE1 3.66Å; H5-E60 IonicContact CE1-OE2 3.19Å; H5-E60 PolarHBondContact CE1-OE2 3.32Å; H5-E60 IonicContact CG-OE1 3.69Å; H5-E60 IonicContact NE2-OE1 2.99Å; H5-E60 PolarHBondContact NE2-OE1 2.01Å; H5-E60 IonicContact NE2-OE2 2.89Å; H5-E60 PolarHBondContact NE2-OE2 2.99Å
6	S	65.4	Low	72.6	Confident	128 Å²	128	78.8 Å²	78.8	90%	0.895	45%	0.445	S	S	*	.			trans	-61.4	119.1	172.1	-170.4	0	0	0	0	108.4
7	T	64.3	Low	72.8	Confident	33 Å²	33	77.4 Å²	77.4	20%	0.202	45%	0.445	C	S	.	.			trans	-121.3	137.4	-176.7	46.7	0	0	0	0	109.2	C3 H5 P11 E60	C3-T7 HydrophobicContact CB-CG2 4.14Å; H5-T7 WeakPolarHBondContact CE1-CG2 3.4Å; H5-T7 VanDerWaalsContact ND1-CG2 3.31Å; H5-T7 WeakPolarHBondContact ND1-CG2 3.21Å; H5-T7 WeakPolarHBondContact O-CG2 3.39Å; H5-T7 PolarHBondContact O-N 3.12Å; H5-T7 VanDerWaalsContact O-N 3.15Å; T7-P11 HydrophobicContact CG2-CG 3.46Å; T7-P11 VanDerWaalsContact CG2-CG 3.46Å; T7-P11 WeakPolarHBondContact OG1-CD 3.45Å; T7-E60 WeakPolarHBondContact CG2-OE2 3.32Å
8	T	65.7	Low	73	Confident	149 Å²	149	77.8 Å²	77.8	91%	0.914	44%	0.439	S	S	*	.	S	Bend	trans	-82.8	132.4	166.6	32.8	0	0	0	0	109
9	G	71.2	Confident	73.2	Confident	52 Å²	52	77.3 Å²	77.3	54%	0.536	44%	0.438	S	S	.	.	S	Bend	trans	88	6.2	173	0	0	0	0	0	116.8	R66	G9-R66 WeakPolarHBondContact O-CD 3.31Å
10	N	78.7	Confident	73.4	Confident	88 Å²	88	83.7 Å²	83.7	47%	0.471	46%	0.461	S	S	.	.			trans	52.1	71.1	176.4	-68.9	-44.9	0	0	0	113.8	R66	N10-R66 VanDerWaalsContact CB-NE 3.28Å; N10-R66 VanDerWaalsContact CB-NH1 3.29Å; N10-R66 PolarHBondContact ND2-NH1 3.28Å; N10-R66 WeakPolarHBondContact O-CD 3.25Å; N10-R66 PolarHBondContact O-NE 3.03Å
11	P	85.3	Confident	73.4	Confident	27 Å²	27	81.8 Å²	81.8	18%	0.175	46%	0.461	C	S	.	.			trans	-66.6	170.9	-179.6	27.2	-27.9	0	0	0	112.2	T7 E60 Y61	T7-P11 HydrophobicContact CG2-CG 3.46Å; T7-P11 VanDerWaalsContact CG2-CG 3.46Å; T7-P11 WeakPolarHBondContact OG1-CD 3.45Å; P11-E60 HydrophobicContact CB-CB 4.41Å; P11-Y61 CarbonylContact C-O 3.55Å; P11-Y61 WeakPolarHBondContact CA-O 3.11Å; P11-Y61 WeakPolarHBondContact CB-O 3.19Å
12	I	86.9	Confident	74.1	Confident	48 Å²	48	81 Å²	81	25%	0.246	46%	0.456	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.5	122	168.9	-60.9	168.1	0	0	0	107	V14 L33 L42 E60 Y61	I12-V14 HydrophobicContact CG2-CG2 4.17Å; I12-L33 HydrophobicContact CG2-CD2 4.15Å; I12-L42 HydrophobicContact CD1-CB 4.31Å; I12-L42 WeakPolarHBondContact CD1-O 3.06Å; I12-E60 WeakPolarHBondContact O-CA 3.49Å; I12-Y61 PolarHBondContact N-O 3.19Å; I12-Y61 PolarHBondContact O-N 2.91Å
13	C	83.6	Confident	74.5	Confident	17 Å²	17	74.6 Å²	74.6	12%	0.115	43%	0.426	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	124.5	178.1	-72.3	0	0	0	0	111.1	C3 L58 V59 E60	C3-C13 WeakPolarHBondContact CA-SG 3.45Å; C3-C13 HydrophobicContact CB-CB 4.04Å; C3-C13 WeakPolarHBondContact CB-SG 3.46Å; C3-C13 WeakPolarHBondContact SG-CB 3.39Å; C3-C13 CovalentContact SG-SG 2.01Å; C3-C13 PolarHBondContact SG-SG 2.79Å; C13-L58 HydrophobicContact CB-CD2 4.49Å; C13-V59 WeakPolarHBondContact CA-O 3.34Å; C13-E60 VanDerWaalsContact SG-CG 3.59Å; C13-E60 PolarHBondContact SG-OE1 2.96Å; C13-E60 VanDerWaalsContact SG-OE1 3.32Å
14	V	81.9	Confident	74.6	Confident	58 Å²	58	76.6 Å²	76.6	35%	0.352	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	129.7	-179.1	-175.4	0	0	0	0	108.3	I12 A16 L58 V59 Y61	I12-V14 HydrophobicContact CG2-CG2 4.17Å; V14-A16 PolarHBondContact O-N 2.87Å; V14-L58 WeakPolarHBondContact O-CA 3.09Å; V14-V59 PolarHBondContact N-O 3.19Å; V14-V59 PolarHBondContact O-N 3.01Å; V14-Y61 HydrophobicContact CB-CE2 4Å; V14-Y61 HydrophobicContact CG2-CD2 4.05Å; V14-Y61 HydrophobicContact CG2-CE2 3.68Å
15	Q	78.5	Confident	74.8	Confident	100 Å²	100	75.1 Å²	75.1	47%	0.467	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.9	121.4	172.5	-171	165.9	30.9	0	0	109.3	M1 L58	M1-Q15 HydrophobicContact CE-CB 4.15Å; M1-Q15 HydrophobicContact SD-CB 3.87Å; Q15-L58 HydrophobicContact CB-CD2 4.31Å
16	A	77.4	Confident	75.2	Confident	19 Å²	19	75.3 Å²	75.3	16%	0.157	45%	0.454	C	S	.	.	P	Polyproline II helix	trans	-94	147.4	177.4	0	0	0	0	0	110.8	V14 I23 V57 V59	V14-A16 PolarHBondContact O-N 2.87Å; A16-I23 HydrophobicContact CB-CG2 3.46Å; A16-I23 VanDerWaalsContact CB-CG2 3.46Å; A16-V57 HydrophobicContact CB-CG1 4.34Å; A16-V57 PolarHBondContact N-O 2.98Å; A16-V59 HydrophobicContact CB-CG2 3.69Å
17	A	76.7	Confident	76.1	Confident	54 Å²	54	71.3 Å²	71.3	45%	0.446	43%	0.433	S	S	.	.	P	Polyproline II helix	trans	-76.2	134	169.4	0	0	0	0	0	109.3	V19 T24	A17-V19 HydrophobicContact CB-CG2 4.05Å; A17-T24 HydrophobicContact CB-CG2 4.27Å; A17-T24 PolarHBondContact N-OG1 2.78Å; A17-T24 VanDerWaalsContact N-OG1 3.12Å; A17-T24 PolarHBondContact O-N 2.91Å; A17-T24 PolarHBondContact O-OG1 2.69Å
18	Y	75.5	Confident	77.2	Confident	85 Å²	85	76.4 Å²	76.4	33%	0.333	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.1	111.1	170.7	-169.4	-105.1	0	0	0	109	G21 Q22 I23 R54	Y18-G21 VanDerWaalsContact CE2-C 3.44Å; Y18-G21 VanDerWaalsContact CE2-O 3.25Å; Y18-G21 WeakPolarHBondContact CE2-O 3.37Å; Y18-G21 WeakPolarHBondContact OH-CA 3.44Å; Y18-G21 PolarHBondContact OH-O 3.38Å; Y18-Q22 WeakPolarHBondContact CA-O 3.39Å; Y18-I23 HydrophobicContact CD2-CG1 4.15Å; Y18-I23 HydrophobicContact CE2-CG1 4.48Å; Y18-R54 HydrophobicContact CE1-CB 4.45Å; Y18-R54 HydrophobicContact CE1-CG 4.15Å; Y18-R54 PolarHBondContact OH-NE 3.17Å
19	V	76.8	Confident	78.3	Confident	69 Å²	69	73.5 Å²	73.5	42%	0.418	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	125.5	-174.5	-167.3	0	0	0	0	108.6	A17 G21 Q22 T24	A17-V19 HydrophobicContact CB-CG2 4.05Å; V19-G21 VanDerWaalsContact C-N 3.27Å; V19-G21 PolarHBondContact O-N 3.3Å; V19-G21 VanDerWaalsContact O-N 3.17Å; V19-Q22 PolarHBondContact N-O 2.99Å; V19-Q22 PolarHBondContact O-N 3.03Å; V19-Q22 VanDerWaalsContact O-O 3.11Å; V19-T24 HydrophobicContact CG2-CG2 4.46Å
20	F	78.3	Confident	79.3	Confident	204 Å²	204	73.5 Å²	73.5	90%	0.895	45%	0.445	S	S	*	.	T	Hydrogen-bonded Turn	trans	49.4	40.3	179.8	-60.5	-64.6	0	0	0	115.3	Q22	F20-Q22 PolarHBondContact O-N 3.02Å
21	G	72.7	Confident	79.9	Confident	45 Å²	45	70.1 Å²	70.1	46%	0.464	43%	0.43	S	S	.	.	T	Hydrogen-bonded Turn	trans	86.7	-8.6	177.7	0	0	0	0	0	114.4	Y18 V19	Y18-G21 VanDerWaalsContact CE2-C 3.44Å; Y18-G21 VanDerWaalsContact CE2-O 3.25Å; Y18-G21 WeakPolarHBondContact CE2-O 3.37Å; Y18-G21 WeakPolarHBondContact OH-CA 3.44Å; Y18-G21 PolarHBondContact OH-O 3.38Å; V19-G21 VanDerWaalsContact C-N 3.27Å; V19-G21 PolarHBondContact O-N 3.3Å; V19-G21 VanDerWaalsContact O-N 3.17Å
22	Q	71.4	Confident	80.3	Confident	146 Å²	146	72.8 Å²	72.8	68%	0.682	45%	0.448	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-110.7	146.6	-178.9	-67.7	-173.8	-52.2	0	0	111.4	Y18 V19 F20	Y18-Q22 WeakPolarHBondContact CA-O 3.39Å; V19-Q22 PolarHBondContact N-O 2.99Å; V19-Q22 PolarHBondContact O-N 3.03Å; V19-Q22 VanDerWaalsContact O-O 3.11Å; F20-Q22 PolarHBondContact O-N 3.02Å
23	I	73.6	Confident	80.5	Confident	46 Å²	46	72.2 Å²	72.2	24%	0.236	45%	0.445	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79	129.8	167	-55	169.4	0	0	0	105.4	A16 Y18 A25 T50 V57 V59	A16-I23 HydrophobicContact CB-CG2 3.46Å; A16-I23 VanDerWaalsContact CB-CG2 3.46Å; Y18-I23 HydrophobicContact CD2-CG1 4.15Å; Y18-I23 HydrophobicContact CE2-CG1 4.48Å; I23-A25 PolarHBondContact O-N 3.08Å; I23-T50 HydrophobicContact CD1-CG2 3.29Å; I23-V57 HydrophobicContact CB-CG1 4.43Å; I23-V57 HydrophobicContact CD1-CG1 3.43Å; I23-V57 VanDerWaalsContact CD1-CG1 3.43Å; I23-V57 HydrophobicContact CD1-CG2 4.48Å; I23-V57 HydrophobicContact CG1-CG1 3.74Å; I23-V57 HydrophobicContact CG1-CG2 4.47Å; I23-V57 HydrophobicContact CG2-CG1 3.83Å; I23-V59 HydrophobicContact CG2-CG2 4.12Å
24	T	71.7	Confident	80.9	Confident	72 Å²	72	74.6 Å²	74.6	44%	0.442	46%	0.456	S	S	.	.			trans	-50.2	114.8	172.6	22.7	0	0	0	0	108.2	A17 V19 P26	A17-T24 HydrophobicContact CB-CG2 4.27Å; A17-T24 PolarHBondContact N-OG1 2.78Å; A17-T24 VanDerWaalsContact N-OG1 3.12Å; A17-T24 PolarHBondContact O-N 2.91Å; A17-T24 PolarHBondContact O-OG1 2.69Å; V19-T24 HydrophobicContact CG2-CG2 4.46Å; T24-P26 WeakPolarHBondContact O-CD 3.4Å; T24-P26 VanDerWaalsContact O-N 3.11Å
25	A	68.9	Low	81.1	Confident	91 Å²	91	82.4 Å²	82.4	75%	0.752	48%	0.479	S	S	*	.			trans	-54.6	119.6	-164.3	0	0	0	0	0	109.2	I23 G27	I23-A25 PolarHBondContact O-N 3.08Å; A25-G27 PolarHBondContact O-N 3.02Å
26	P	75.8	Confident	81.7	Confident	50 Å²	50	80.2 Å²	80.2	33%	0.325	48%	0.475	S	S	.	.			trans	-71.7	1.6	-175.9	29	-35	0	0	0	113.6	T24 V45 V59	T24-P26 WeakPolarHBondContact O-CD 3.4Å; T24-P26 VanDerWaalsContact O-N 3.11Å; P26-V45 WeakPolarHBondContact O-CG2 3.43Å; P26-V59 HydrophobicContact CB-CB 4.24Å; P26-V59 HydrophobicContact CB-CG1 3.37Å; P26-V59 HydrophobicContact CB-CG2 3.97Å; P26-V59 HydrophobicContact CG-CG1 3.95Å; P26-V59 HydrophobicContact CG-CG2 4.26Å
27	G	83.6	Confident	82.2	Confident	45 Å²	45	84.6 Å²	84.6	46%	0.464	50%	0.502	S	S	.	.			trans	104.4	-171.9	-169.2	0	0	0	0	0	111.5	A25	A25-G27 PolarHBondContact O-N 3.02Å
28	D	86.8	Confident	82.9	Confident	139 Å²	139	90.4 Å²	90.4	74%	0.743	52%	0.52	S	S	*	.	S	Bend	trans	-87.6	146.9	-179.9	-59.4	-47.1	0	0	0	111.2	G30 G31 V45	D28-G30 PolarHBondContact O-N 3.24Å; D28-G31 WeakPolarHBondContact O-CA 3.05Å; D28-G31 PolarHBondContact O-N 3.49Å; D28-V45 WeakPolarHBondContact O-CB 3.21Å; D28-V45 WeakPolarHBondContact O-CG1 3.49Å
29	S	89.3	Confident	83.7	Confident	88 Å²	88	87.3 Å²	87.3	62%	0.615	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.8	127.2	176.5	-173.1	0	0	0	0	111.3	G31	S29-G31 VanDerWaalsContact C-N 3.29Å
30	G	91.6	Very high	84.4	Confident	52 Å²	52	88.5 Å²	88.5	54%	0.536	52%	0.523	S	S	.	.	T	Hydrogen-bonded Turn	trans	84.1	-5.1	-174.1	0	0	0	0	0	114.9	D28 V45	D28-G30 PolarHBondContact O-N 3.24Å; G30-V45 PolarHBondContact N-O 2.89Å
31	G	92.4	Very high	85.1	Confident	17 Å²	17	82 Å²	82	18%	0.175	50%	0.5	C	S	.	.			trans	-71.2	161	177	0	0	0	0	0	113.5	D28 S29 V44 V45	D28-G31 WeakPolarHBondContact O-CA 3.05Å; D28-G31 PolarHBondContact O-N 3.49Å; S29-G31 VanDerWaalsContact C-N 3.29Å; G31-V44 CarbonylContact O-C 3.59Å; G31-V44 WeakPolarHBondContact O-CA 3.3Å; G31-V45 WeakPolarHBondContact O-CG2 3.15Å; G31-V45 PolarHBondContact O-N 2.94Å
32	P	93.2	Very high	86.1	Confident	83 Å²	83	83.2 Å²	83.2	54%	0.539	50%	0.495	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.4	138.1	-177.6	33	-34.4	0	0	0	112.7	L34 V41	P32-L34 HydrophobicContact CB-CD2 3.93Å; P32-L34 HydrophobicContact CB-CG 4.07Å; P32-L34 HydrophobicContact CG-CD1 4.44Å; P32-L34 HydrophobicContact CG-CG 4.35Å; P32-V41 HydrophobicContact CB-CG1 3.96Å; P32-V41 HydrophobicContact CB-CG2 4.44Å
33	L	90.8	Very high	87.1	Confident	36 Å²	36	76.2 Å²	76.2	19%	0.188	46%	0.463	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.4	113.5	160.3	177.3	65.8	0	0	0	109	I12 L42 G43 Y61	I12-L33 HydrophobicContact CG2-CD2 4.15Å; L33-L42 PolarHBondContact O-N 2.92Å; L33-G43 PolarHBondContact N-O 3.3Å; L33-G43 PolarHBondContact O-N 2.86Å; L33-Y61 HydrophobicContact CB-CD1 3.7Å; L33-Y61 HydrophobicContact CB-CE1 3.93Å; L33-Y61 HydrophobicContact CB-CG 4.31Å; L33-Y61 HydrophobicContact CD1-CD1 4.47Å; L33-Y61 HydrophobicContact CD1-CE1 3.98Å; L33-Y61 HydrophobicContact CD2-CD1 3.95Å; L33-Y61 HydrophobicContact CD2-CD2 3.86Å; L33-Y61 HydrophobicContact CD2-CE1 4.21Å; L33-Y61 HydrophobicContact CD2-CE2 4.16Å; L33-Y61 HydrophobicContact CD2-CG 3.76Å; L33-Y61 HydrophobicContact CG-CD1 4.24Å; L33-Y61 HydrophobicContact CG-CE1 4.25Å
34	L	91.4	Very high	87.9	Confident	67 Å²	67	76.5 Å²	76.5	35%	0.351	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	146.7	-177.9	-55.2	179.2	0	0	0	111.1	P32 S36 V41	P32-L34 HydrophobicContact CB-CD2 3.93Å; P32-L34 HydrophobicContact CB-CG 4.07Å; P32-L34 HydrophobicContact CG-CD1 4.44Å; P32-L34 HydrophobicContact CG-CG 4.35Å; L34-S36 WeakPolarHBondContact CB-O 3.34Å; L34-V41 HydrophobicContact CD2-CB 4.3Å; L34-V41 HydrophobicContact CD2-CG2 3.93Å
35	R	87.2	Confident	88.8	Confident	222 Å²	222	73.6 Å²	73.6	84%	0.838	45%	0.449	S	S	*	.	S	Bend	trans	-77.4	-29.4	168.9	-166.2	177.3	-179.3	-165.6	-0.2	112.5	L42	R35-L42 HydrophobicContact CB-CD1 4.07Å
36	S	90.8	Very high	89.4	Confident	55 Å²	55	72.3 Å²	72.3	39%	0.385	43%	0.434	S	S	.	.	S	Bend	trans	-154	160.6	179.3	59.6	0	0	0	0	109.1	L34 Q38 G39	L34-S36 WeakPolarHBondContact CB-O 3.34Å; S36-Q38 PolarHBondContact O-N 3.35Å; S36-Q38 VanDerWaalsContact O-N 3.12Å; S36-G39 PolarHBondContact O-N 3.06Å; S36-G39 WeakPolarHBondContact OG-CA 3.13Å; S36-G39 PolarHBondContact OG-N 2.88Å
37	P	89	Confident	89.2	Confident	111 Å²	111	77.9 Å²	77.9	72%	0.721	46%	0.455	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.3	-31.9	-174.5	-28.1	36	0	0	0	115.2
38	Q	90.9	Very high	88.3	Confident	176 Å²	176	77.5 Å²	77.5	82%	0.822	45%	0.451	S	S	*	.	T	Hydrogen-bonded Turn	trans	-107.1	12.8	175.2	-55.4	86.5	4	0	0	113.2	S36	S36-Q38 PolarHBondContact O-N 3.35Å; S36-Q38 VanDerWaalsContact O-N 3.12Å
39	G	91	Very high	86.8	Confident	19 Å²	19	74.3 Å²	74.3	20%	0.196	44%	0.437	C	S	.	.	S	Bend	trans	-77.9	169.8	-177.9	0	0	0	0	0	113.2	S36	S36-G39 PolarHBondContact O-N 3.06Å; S36-G39 WeakPolarHBondContact OG-CA 3.13Å; S36-G39 PolarHBondContact OG-N 2.88Å
40	P	91.9	Very high	85.2	Confident	95 Å²	95	74.5 Å²	74.5	62%	0.617	44%	0.435	S	S	*	.			trans	-64.3	148.9	174.4	28.7	-35	0	0	0	111.3	L42	P40-L42 HydrophobicContact CG-CD2 4.26Å; P40-L42 PolarHBondContact O-N 2.85Å
41	V	93.6	Very high	83.4	Confident	68 Å²	68	75.2 Å²	75.2	41%	0.412	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.1	112.4	171.7	-169.3	0	0	0	0	108.9	P32 L34 G43 V64	P32-V41 HydrophobicContact CB-CG1 3.96Å; P32-V41 HydrophobicContact CB-CG2 4.44Å; L34-V41 HydrophobicContact CD2-CB 4.3Å; L34-V41 HydrophobicContact CD2-CG2 3.93Å; V41-G43 WeakPolarHBondContact CG1-O 3.16Å; V41-V64 HydrophobicContact CB-CG2 4.43Å; V41-V64 HydrophobicContact CG1-CG2 3.86Å; V41-V64 WeakPolarHBondContact O-CB 3.44Å
42	L	92.8	Very high	81.7	Confident	69 Å²	69	80.7 Å²	80.7	36%	0.361	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.3	-41.6	-179.1	-59.5	-176.1	0	0	0	111.3	I12 L33 R35 P40 V64	I12-L42 HydrophobicContact CD1-CB 4.31Å; I12-L42 WeakPolarHBondContact CD1-O 3.06Å; L33-L42 PolarHBondContact O-N 2.92Å; R35-L42 HydrophobicContact CB-CD1 4.07Å; P40-L42 HydrophobicContact CG-CD2 4.26Å; P40-L42 PolarHBondContact O-N 2.85Å; L42-V64 PolarHBondContact O-N 2.86Å
43	G	92	Very high	79.9	Confident	0 Å²	0	81.8 Å²	81.8	0%	0	46%	0.463	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149	171.1	-178.3	0	0	0	0	0	112.2	L33 V41 A62	L33-G43 PolarHBondContact N-O 3.3Å; L33-G43 PolarHBondContact O-N 2.86Å; V41-G43 WeakPolarHBondContact CG1-O 3.16Å; G43-A62 CarbonylContact C-O 3.49Å; G43-A62 WeakPolarHBondContact CA-O 2.96Å
44	V	92.3	Very high	78.3	Confident	52 Å²	52	88.1 Å²	88.1	32%	0.315	48%	0.484	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.9	129.1	174.2	-179.2	0	0	0	0	107.8	G31 S46 Y61 A62 V64	G31-V44 CarbonylContact O-C 3.59Å; G31-V44 WeakPolarHBondContact O-CA 3.3Å; V44-S46 PolarHBondContact O-N 2.81Å; V44-Y61 CarbonylContact O-C 3.47Å; V44-Y61 VanDerWaalsContact O-CA 3.3Å; V44-Y61 WeakPolarHBondContact O-CA 3.46Å; V44-A62 HydrophobicContact CB-CB 4.44Å; V44-A62 PolarHBondContact N-O 2.93Å; V44-A62 PolarHBondContact O-N 3.25Å; V44-V64 HydrophobicContact CG2-CG2 3.89Å
45	V	89.6	Confident	76.8	Confident	11 Å²	11	91.9 Å²	91.9	7%	0.067	50%	0.504	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-56.4	125.5	176.6	179.3	0	0	0	0	108.3	P26 D28 G30 G31 Y61	P26-V45 WeakPolarHBondContact O-CG2 3.43Å; D28-V45 WeakPolarHBondContact O-CB 3.21Å; D28-V45 WeakPolarHBondContact O-CG1 3.49Å; G30-V45 PolarHBondContact N-O 2.89Å; G31-V45 WeakPolarHBondContact O-CG2 3.15Å; G31-V45 PolarHBondContact O-N 2.94Å; V45-Y61 HydrophobicContact CB-CD1 4.38Å; V45-Y61 HydrophobicContact CB-CE1 4.45Å; V45-Y61 HydrophobicContact CG2-CD1 3.97Å; V45-Y61 HydrophobicContact CG2-CE1 3.71Å
46	S	82.5	Confident	75.8	Confident	64 Å²	64	83.9 Å²	83.9	45%	0.448	48%	0.478	S	S	.	.			trans	-124.5	172.6	174.2	-159.5	0	0	0	0	109.9	V44 G48	V44-S46 PolarHBondContact O-N 2.81Å; S46-G48 PolarHBondContact O-N 2.92Å
47	H	71.6	Confident	74.8	Confident	166 Å²	166	81.6 Å²	81.6	77%	0.769	46%	0.462	S	S	*	.			trans	-64.7	111.1	171.1	-78.8	107.7	0	0	0	109
48	G	63.5	Low	74.2	Confident	37 Å²	37	77.1 Å²	77.1	38%	0.381	43%	0.431	S	S	.	.			trans	-76.8	147.3	172.1	0	0	0	0	0	111.5	S46	S46-G48 PolarHBondContact O-N 2.92Å
49	V	56.2	Low	73.7	Confident	72 Å²	72	69.2 Å²	69.2	44%	0.436	40%	0.395	S	S	.	.			trans	-83.5	114.1	168.1	178.6	0	0	0	0	108.6	H5 L51	H5-V49 VanDerWaalsContact NE2-CG2 3.34Å; H5-V49 WeakPolarHBondContact NE2-CG2 3.46Å; V49-L51 HydrophobicContact CG1-CD2 4.38Å; V49-L51 PolarHBondContact O-N 3.04Å
50	T	55.4	Low	73.3	Confident	93 Å²	93	69.1 Å²	69.1	57%	0.571	39%	0.39	S	S	*	.			trans	-76.8	103.2	169.8	48	0	0	0	0	109.7	I23	I23-T50 HydrophobicContact CD1-CG2 3.29Å
51	L	54	Low	73.1	Confident	66 Å²	66	65.5 Å²	65.5	35%	0.346	36%	0.364	S	S	.	.			trans	-67.7	134.8	170.4	-66.2	171.5	0	0	0	109.3	K4 V49 N53	K4-L51 HydrophobicContact CB-CD1 3.84Å; V49-L51 HydrophobicContact CG1-CD2 4.38Å; V49-L51 PolarHBondContact O-N 3.04Å; L51-N53 PolarHBondContact O-N 3.35Å
52	S	55.7	Low	72.9	Confident	132 Å²	132	64.2 Å²	64.2	92%	0.923	36%	0.36	S	S	*	.	S	Bend	trans	-60.1	-8.9	-170.7	-47.7	0	0	0	0	115.3
53	N	56.9	Low	72.8	Confident	107 Å²	107	61.5 Å²	61.5	57%	0.572	35%	0.347	S	S	*	.	S	Bend	trans	-96.5	104.2	176.9	-154.1	-2.5	0	0	0	110.3	L51 L55 D56	L51-N53 PolarHBondContact O-N 3.35Å; N53-L55 PolarHBondContact O-N 3.29Å; N53-D56 PolarHBondContact O-N 2.84Å; N53-D56 VanDerWaalsContact O-N 3.08Å
54	R	56.4	Low	72.8	Confident	168 Å²	168	63.1 Å²	63.1	63%	0.634	36%	0.357	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.5	-18.4	-169.8	-76.6	-177.7	166.9	131.4	1	116.1	Y18	Y18-R54 HydrophobicContact CE1-CB 4.45Å; Y18-R54 HydrophobicContact CE1-CG 4.15Å; Y18-R54 PolarHBondContact OH-NE 3.17Å
55	L	59.6	Low	72.8	Confident	146 Å²	146	64.1 Å²	64.1	76%	0.764	37%	0.371	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.7	-13.8	-177.6	-65.6	173.1	0	0	0	113.8	N53	N53-L55 PolarHBondContact O-N 3.29Å
56	D	66.6	Low	72.7	Confident	54 Å²	54	70.7 Å²	70.7	29%	0.289	39%	0.394	S	S	.	.			trans	-121.3	35.1	-173.1	-79.1	-44.9	0	0	0	112.5	K4 N53 L58	K4-D56 HydrophobicContact CD-CB 4.31Å; K4-D56 IonicContact NZ-OD1 2.69Å; K4-D56 PolarHBondContact NZ-OD1 2.85Å; K4-D56 IonicContact NZ-OD2 2.78Å; K4-D56 PolarHBondContact NZ-OD2 2.9Å; N53-D56 PolarHBondContact O-N 2.84Å; N53-D56 VanDerWaalsContact O-N 3.08Å; D56-L58 PolarHBondContact O-N 3.06Å
57	V	69.8	Low	73.1	Confident	8 Å²	8	71.5 Å²	71.5	5%	0.048	39%	0.392	C	S	.	.			trans	-68.7	111.8	176.6	-177.9	0	0	0	0	109.2	A16 I23	A16-V57 HydrophobicContact CB-CG1 4.34Å; A16-V57 PolarHBondContact N-O 2.98Å; I23-V57 HydrophobicContact CB-CG1 4.43Å; I23-V57 HydrophobicContact CD1-CG1 3.43Å; I23-V57 VanDerWaalsContact CD1-CG1 3.43Å; I23-V57 HydrophobicContact CD1-CG2 4.48Å; I23-V57 HydrophobicContact CG1-CG1 3.74Å; I23-V57 HydrophobicContact CG1-CG2 4.47Å; I23-V57 HydrophobicContact CG2-CG1 3.83Å
58	L	75.5	Confident	74	Confident	17 Å²	17	68.1 Å²	68.1	9%	0.089	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.2	133.7	168.6	-67	168.5	0	0	0	108.4	M1 K4 C13 V14 Q15 D56	M1-L58 HydrophobicContact SD-CD2 4.39Å; K4-L58 HydrophobicContact CB-CD1 3.87Å; K4-L58 HydrophobicContact CD-CD1 4.28Å; K4-L58 HydrophobicContact CG-CD1 3.87Å; C13-L58 HydrophobicContact CB-CD2 4.49Å; V14-L58 WeakPolarHBondContact O-CA 3.09Å; Q15-L58 HydrophobicContact CB-CD2 4.31Å; D56-L58 PolarHBondContact O-N 3.06Å
59	V	79.9	Confident	75.4	Confident	10 Å²	10	68.7 Å²	68.7	6%	0.061	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.3	131.3	164.9	176	0	0	0	0	107.4	C13 V14 A16 I23 P26 Y61	C13-V59 WeakPolarHBondContact CA-O 3.34Å; V14-V59 PolarHBondContact N-O 3.19Å; V14-V59 PolarHBondContact O-N 3.01Å; A16-V59 HydrophobicContact CB-CG2 3.69Å; I23-V59 HydrophobicContact CG2-CG2 4.12Å; P26-V59 HydrophobicContact CB-CB 4.24Å; P26-V59 HydrophobicContact CB-CG1 3.37Å; P26-V59 HydrophobicContact CB-CG2 3.97Å; P26-V59 HydrophobicContact CG-CG1 3.95Å; P26-V59 HydrophobicContact CG-CG2 4.26Å; V59-Y61 HydrophobicContact CB-CE2 3.93Å; V59-Y61 HydrophobicContact CG1-CD2 4.07Å; V59-Y61 HydrophobicContact CG1-CE1 4.31Å; V59-Y61 HydrophobicContact CG1-CE2 3.38Å
60	E	83	Confident	77.2	Confident	17 Å²	17	71.7 Å²	71.7	8%	0.079	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.4	135.2	179.3	-49.8	-152.9	153.8	0	0	111.2	H5 T7 P11 I12 C13	H5-E60 VanDerWaalsContact CD2-CD 3.41Å; H5-E60 IonicContact CD2-OE1 2.91Å; H5-E60 PolarHBondContact CD2-OE1 2.89Å; H5-E60 IonicContact CD2-OE2 3.75Å; H5-E60 IonicContact CE1-OE1 3.66Å; H5-E60 IonicContact CE1-OE2 3.19Å; H5-E60 PolarHBondContact CE1-OE2 3.32Å; H5-E60 IonicContact CG-OE1 3.69Å; H5-E60 IonicContact NE2-OE1 2.99Å; H5-E60 PolarHBondContact NE2-OE1 2.01Å; H5-E60 IonicContact NE2-OE2 2.89Å; H5-E60 PolarHBondContact NE2-OE2 2.99Å; T7-E60 WeakPolarHBondContact CG2-OE2 3.32Å; P11-E60 HydrophobicContact CB-CB 4.41Å; I12-E60 WeakPolarHBondContact O-CA 3.49Å; C13-E60 VanDerWaalsContact SG-CG 3.59Å; C13-E60 PolarHBondContact SG-OE1 2.96Å; C13-E60 VanDerWaalsContact SG-OE1 3.32Å
61	Y	87.9	Confident	78.9	Confident	18 Å²	18	70.7 Å²	70.7	7%	0.071	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	139.1	176.6	-55.4	-103.7	0	0	0	108.9	P11 I12 V14 L33 V44 V45 V59 S63	P11-Y61 CarbonylContact C-O 3.55Å; P11-Y61 WeakPolarHBondContact CA-O 3.11Å; P11-Y61 WeakPolarHBondContact CB-O 3.19Å; I12-Y61 PolarHBondContact N-O 3.19Å; I12-Y61 PolarHBondContact O-N 2.91Å; V14-Y61 HydrophobicContact CB-CE2 4Å; V14-Y61 HydrophobicContact CG2-CD2 4.05Å; V14-Y61 HydrophobicContact CG2-CE2 3.68Å; L33-Y61 HydrophobicContact CB-CD1 3.7Å; L33-Y61 HydrophobicContact CB-CE1 3.93Å; L33-Y61 HydrophobicContact CB-CG 4.31Å; L33-Y61 HydrophobicContact CD1-CD1 4.47Å; L33-Y61 HydrophobicContact CD1-CE1 3.98Å; L33-Y61 HydrophobicContact CD2-CD1 3.95Å; L33-Y61 HydrophobicContact CD2-CD2 3.86Å; L33-Y61 HydrophobicContact CD2-CE1 4.21Å; L33-Y61 HydrophobicContact CD2-CE2 4.16Å; L33-Y61 HydrophobicContact CD2-CG 3.76Å; L33-Y61 HydrophobicContact CG-CD1 4.24Å; L33-Y61 HydrophobicContact CG-CE1 4.25Å; V44-Y61 CarbonylContact O-C 3.47Å; V44-Y61 VanDerWaalsContact O-CA 3.3Å; V44-Y61 WeakPolarHBondContact O-CA 3.46Å; V45-Y61 HydrophobicContact CB-CD1 4.38Å; V45-Y61 HydrophobicContact CB-CE1 4.45Å; V45-Y61 HydrophobicContact CG2-CD1 3.97Å; V45-Y61 HydrophobicContact CG2-CE1 3.71Å; V59-Y61 HydrophobicContact CB-CE2 3.93Å; V59-Y61 HydrophobicContact CG1-CD2 4.07Å; V59-Y61 HydrophobicContact CG1-CE1 4.31Å; V59-Y61 HydrophobicContact CG1-CE2 3.38Å; Y61-S63 PolarHBondContact O-N 3.15Å
62	A	89.4	Confident	80.8	Confident	41 Å²	41	70.7 Å²	70.7	34%	0.339	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.2	126.5	170.3	0	0	0	0	0	108.9	G43 V44 V64	G43-A62 CarbonylContact C-O 3.49Å; G43-A62 WeakPolarHBondContact CA-O 2.96Å; V44-A62 HydrophobicContact CB-CB 4.44Å; V44-A62 PolarHBondContact N-O 2.93Å; V44-A62 PolarHBondContact O-N 3.25Å; A62-V64 PolarHBondContact O-N 3.4Å
63	S	91	Very high	82.8	Confident	12 Å²	12	69 Å²	69	8%	0.084	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.2	116.7	-177.7	-177.5	0	0	0	0	111.3	Y61 A65 R66 M67	Y61-S63 PolarHBondContact O-N 3.15Å; S63-A65 VanDerWaalsContact C-N 3.34Å; S63-R66 PolarHBondContact O-N 2.94Å; S63-M67 PolarHBondContact O-N 3.2Å
64	V	92.3	Very high	84.6	Confident	35 Å²	35	69.2 Å²	69.2	21%	0.212	38%	0.381	C	S	.	.	H	α-helix	trans	-65.2	-40.7	176.5	172	0	0	0	0	110.8	V41 L42 V44 A62 R66 M67 L68	V41-V64 HydrophobicContact CB-CG2 4.43Å; V41-V64 HydrophobicContact CG1-CG2 3.86Å; V41-V64 WeakPolarHBondContact O-CB 3.44Å; L42-V64 PolarHBondContact O-N 2.86Å; V44-V64 HydrophobicContact CG2-CG2 3.89Å; A62-V64 PolarHBondContact O-N 3.4Å; V64-R66 PolarHBondContact O-N 2.93Å; V64-M67 CarbonylContact O-C 3.57Å; V64-M67 PolarHBondContact O-N 3.33Å; V64-L68 HydrophobicContact CG1-CD1 4.25Å; V64-L68 PolarHBondContact O-N 3Å
65	A	91.4	Very high	86.1	Confident	73 Å²	73	70.2 Å²	70.2	60%	0.603	40%	0.397	S	S	*	.	H	α-helix	trans	-57.5	-34.7	178.5	0	0	0	0	0	112.9	S63	S63-A65 VanDerWaalsContact C-N 3.34Å
66	R	89.2	Confident	87.4	Confident	149 Å²	149	66.4 Å²	66.4	56%	0.562	38%	0.378	S	S	*	.	H	α-helix	trans	-79.2	-26	177.8	-65.1	-176.4	-176.6	-103.6	8.2	113.3	G9 N10 S63 V64	G9-R66 WeakPolarHBondContact O-CD 3.31Å; N10-R66 VanDerWaalsContact CB-NE 3.28Å; N10-R66 VanDerWaalsContact CB-NH1 3.29Å; N10-R66 PolarHBondContact ND2-NH1 3.28Å; N10-R66 WeakPolarHBondContact O-CD 3.25Å; N10-R66 PolarHBondContact O-NE 3.03Å; S63-R66 PolarHBondContact O-N 2.94Å; V64-R66 PolarHBondContact O-N 2.93Å
67	M	90.7	Very high	88.5	Confident	81 Å²	81	67.1 Å²	67.1	40%	0.399	38%	0.383	S	S	.	.	H	α-helix	trans	-91.9	-1.9	176.8	-116.6	60.1	80.3	0	0	113.5	S63 V64 G69 F70 V71	S63-M67 PolarHBondContact O-N 3.2Å; V64-M67 CarbonylContact O-C 3.57Å; V64-M67 PolarHBondContact O-N 3.33Å; M67-G69 VanDerWaalsContact C-N 3.29Å; M67-G69 PolarHBondContact O-N 2.87Å; M67-F70 HydrophobicContact CG-CB 4.43Å; M67-F70 HydrophobicContact CG-CD1 4.38Å; M67-F70 WeakPolarHBondContact O-CB 3.5Å; M67-F70 PolarHBondContact O-N 3.05Å; M67-V71 HydrophobicContact CB-CG2 4.43Å; M67-V71 WeakPolarHBondContact O-CG2 3.29Å; M67-V71 PolarHBondContact O-N 3.5Å
68	L	90.5	Very high	89.6	Confident	94 Å²	94	70.3 Å²	70.3	49%	0.492	40%	0.402	S	S	.	.	H	α-helix	trans	-58.5	-39.1	-170.3	-137.9	120.5	0	0	0	112.9	V64 V71 S72	V64-L68 HydrophobicContact CG1-CD1 4.25Å; V64-L68 PolarHBondContact O-N 3Å; L68-V71 PolarHBondContact O-N 2.7Å; L68-S72 VanDerWaalsContact O-CB 3.29Å; L68-S72 WeakPolarHBondContact O-CB 3.43Å; L68-S72 PolarHBondContact O-N 2.76Å; L68-S72 PolarHBondContact O-OG 3.41Å
69	G	93.1	Very high	90.4	Very high	50 Å²	50	73.5 Å²	73.5	52%	0.515	42%	0.42	S	S	.	.	H	α-helix	trans	-67.6	-39.5	176.2	0	0	0	0	0	113.1	M67 S73	M67-G69 VanDerWaalsContact C-N 3.29Å; M67-G69 PolarHBondContact O-N 2.87Å; G69-S73 WeakPolarHBondContact O-CB 3.44Å; G69-S73 PolarHBondContact O-N 3.39Å; G69-S73 VanDerWaalsContact O-N 3.17Å; G69-S73 PolarHBondContact O-OG 3.47Å
70	F	92.3	Very high	91.1	Very high	135 Å²	135	77.4 Å²	77.4	59%	0.592	44%	0.443	S	S	*	.	H	α-helix	trans	-64.5	-48.6	173.9	170.4	-97	0	0	0	110.6	M67 S72 S73 N74	M67-F70 HydrophobicContact CG-CB 4.43Å; M67-F70 HydrophobicContact CG-CD1 4.38Å; M67-F70 WeakPolarHBondContact O-CB 3.5Å; M67-F70 PolarHBondContact O-N 3.05Å; F70-S72 PolarHBondContact O-N 3.21Å; F70-S73 PolarHBondContact O-N 3.21Å; F70-N74 WeakPolarHBondContact CE2-ND2 3.45Å; F70-N74 PolarHBondContact O-N 3.17Å; F70-N74 PolarHBondContact O-ND2 3.18Å
71	V	92.3	Very high	91.6	Very high	71 Å²	71	81.5 Å²	81.5	43%	0.43	47%	0.467	S	S	.	.	H	α-helix	trans	-59.1	-48.9	178.5	174.1	0	0	0	0	110.5	M67 L68 S73 N74 I75	M67-V71 HydrophobicContact CB-CG2 4.43Å; M67-V71 WeakPolarHBondContact O-CG2 3.29Å; M67-V71 PolarHBondContact O-N 3.5Å; L68-V71 PolarHBondContact O-N 2.7Å; V71-S73 PolarHBondContact O-N 2.87Å; V71-N74 PolarHBondContact O-N 3.01Å; V71-I75 HydrophobicContact CG1-CG2 4.49Å; V71-I75 PolarHBondContact O-N 2.81Å
72	S	94.3	Very high	91.9	Very high	66 Å²	66	86 Å²	86	46%	0.462	50%	0.495	S	S	.	.	H	α-helix	trans	-63.4	-24.6	-178.7	-54.7	0	0	0	0	113.4	L68 F70 I75	L68-S72 VanDerWaalsContact O-CB 3.29Å; L68-S72 WeakPolarHBondContact O-CB 3.43Å; L68-S72 PolarHBondContact O-N 2.76Å; L68-S72 PolarHBondContact O-OG 3.41Å; F70-S72 PolarHBondContact O-N 3.21Å; S72-I75 WeakPolarHBondContact O-CG1 3.48Å
73	S	96.5	Very high	92.1	Very high	97 Å²	97	89.5 Å²	89.5	68%	0.678	51%	0.507	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.3	-6.5	178.1	-54.7	0	0	0	0	113.8	G69 F70 V71	G69-S73 WeakPolarHBondContact O-CB 3.44Å; G69-S73 PolarHBondContact O-N 3.39Å; G69-S73 VanDerWaalsContact O-N 3.17Å; G69-S73 PolarHBondContact O-OG 3.47Å; F70-S73 PolarHBondContact O-N 3.21Å; V71-S73 PolarHBondContact O-N 2.87Å
74	N	94.9	Very high	92.2	Very high	111 Å²	111	95.9 Å²	95.9	59%	0.594	54%	0.542	S	S	*	.			trans	-124.6	17	-175.5	-71.3	-89.2	0	0	0	112.8	F70 V71	F70-N74 WeakPolarHBondContact CE2-ND2 3.45Å; F70-N74 PolarHBondContact O-N 3.17Å; F70-N74 PolarHBondContact O-ND2 3.18Å; V71-N74 PolarHBondContact O-N 3.01Å
75	I	88.6	Confident	92.1	Very high	189 Å²	189	101.5 Å²	101.5	97%	0.969	57%	0.572	S	S	*	*			trans	-106.7	0	168.9	58.1	169.2	0	0	0	109.7	V71 S72	V71-I75 HydrophobicContact CG1-CG2 4.49Å; V71-I75 PolarHBondContact O-N 2.81Å; S72-I75 WeakPolarHBondContact O-CG1 3.48Å

Retrieved 75 of 75 residues in 155.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).