A0A5K4FBF2_SCHMA Loading...

Smp_206040

AlphaFold DB , UniProt , Accession A0A5K4FBF2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 109 aa.

						>A0A5K4FBF2_SCHMA|A0A5K4FBF2
MCALQLDILPKLEESAEGIAKHLDALLRSLTSTLNQMSSLTLDCTTVFLDSVDYACETVGACIKSTYVLMAKCEELSRSMSQLEPLKKEIEGLKRTLNKFEEALSTPLK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.4	Low	76.8	Confident	191 Å²	191	116.5 Å²	116.5	94%	0.941	63%	0.632	S	S	*	*				0	-41.4	0	-140	162.6	85.2	0	0	112.3	A3 Q5	M1-A3 PolarHBondContact O-N 3.05Å; M1-Q5 PolarHBondContact O-N 3.39Å
2	C	61.5	Low	78.2	Confident	109 Å²	109	116.3 Å²	116.3	74%	0.736	63%	0.628	S	S	*	*	H	α-helix	trans	-61.3	-36.9	-176.7	-64.6	0	0	0	0	116.9	Q5 L6	C2-Q5 PolarHBondContact O-N 3.22Å; C2-L6 PolarHBondContact O-N 3.3Å
3	A	62.3	Low	79.5	Confident	77 Å²	77	117.9 Å²	117.9	64%	0.636	63%	0.63	S	S	*	*	H	α-helix	trans	-71.5	-45.7	-175.2	0	0	0	0	0	113.1	M1 Q5 L6 D7	M1-A3 PolarHBondContact O-N 3.05Å; A3-Q5 PolarHBondContact O-N 3.41Å; A3-L6 PolarHBondContact O-N 3.46Å; A3-D7 PolarHBondContact O-N 3.49Å
4	L	65.6	Low	80.7	Confident	152 Å²	152	119.4 Å²	119.4	80%	0.796	63%	0.631	S	S	*	*	H	α-helix	trans	-62.5	-29.8	175.6	-90.4	143	0	0	0	112.9
5	Q	70.3	Confident	81.8	Confident	110 Å²	110	115.7 Å²	115.7	51%	0.514	62%	0.619	S	S	.	*	H	α-helix	trans	-78.4	-18.4	175	-70.5	-176.6	-77.8	0	0	113.4	M1 C2 A3 I8	M1-Q5 PolarHBondContact O-N 3.39Å; C2-Q5 PolarHBondContact O-N 3.22Å; A3-Q5 PolarHBondContact O-N 3.41Å; Q5-I8 WeakPolarHBondContact O-CG2 3.49Å
6	L	77.3	Confident	82.7	Confident	123 Å²	123	111.9 Å²	111.9	64%	0.644	61%	0.609	S	S	*	*	H	α-helix	trans	-83.3	-32.9	178.7	-158.7	71.5	0	0	0	111.7	C2 A3 P10	C2-L6 PolarHBondContact O-N 3.3Å; A3-L6 PolarHBondContact O-N 3.46Å; L6-P10 WeakPolarHBondContact O-CD 2.87Å
7	D	86.1	Confident	83.6	Confident	106 Å²	106	111.2 Å²	111.2	57%	0.567	60%	0.6	S	S	*	*	H	α-helix	trans	-78.2	-21.6	179.4	-71	-23	0	0	0	114.1	A3 P10 K11	A3-D7 PolarHBondContact O-N 3.49Å; D7-P10 WeakPolarHBondContact O-CD 3.36Å; D7-P10 WeakPolarHBondContact O-CG 3.43Å; D7-K11 WeakPolarHBondContact O-CG 3.33Å
8	I	91.3	Very high	84.4	Confident	105 Å²	105	106.4 Å²	106.4	54%	0.538	58%	0.581	S	S	.	*	H	α-helix	trans	-74.8	-34.8	178.7	-164.7	78.3	0	0	0	111.8	Q5 K11 L12	Q5-I8 WeakPolarHBondContact O-CG2 3.49Å; I8-K11 PolarHBondContact O-N 3.43Å; I8-L12 WeakPolarHBondContact O-CB 3.45Å; I8-L12 PolarHBondContact O-N 2.86Å
9	L	91.8	Very high	85.1	Confident	104 Å²	104	106.6 Å²	106.6	55%	0.545	58%	0.58	S	S	.	*	H	α-helix	trans	-61.2	-50.7	179.5	-69.8	178.1	0	0	0	113.7	K11 L12 E13	L9-K11 VanDerWaalsContact C-N 3.33Å; L9-K11 PolarHBondContact O-N 3.39Å; L9-L12 WeakPolarHBondContact O-CB 3.45Å; L9-L12 PolarHBondContact O-N 3.2Å; L9-E13 WeakPolarHBondContact O-CB 3.45Å; L9-E13 PolarHBondContact O-N 2.94Å
10	P	92.2	Very high	85.8	Confident	65 Å²	65	104.1 Å²	104.1	42%	0.422	58%	0.575	S	S	.	*	H	α-helix	trans	-66.9	-33.5	178.9	25.8	-34.6	0	0	0	112.2	L6 D7 E13 E14	L6-P10 WeakPolarHBondContact O-CD 2.87Å; D7-P10 WeakPolarHBondContact O-CD 3.36Å; D7-P10 WeakPolarHBondContact O-CG 3.43Å; P10-E13 PolarHBondContact O-N 2.63Å; P10-E14 VanDerWaalsContact O-CB 3.31Å; P10-E14 WeakPolarHBondContact O-CB 3.31Å; P10-E14 PolarHBondContact O-N 2.89Å
11	K	93.6	Very high	86.4	Confident	140 Å²	140	105.1 Å²	105.1	61%	0.609	57%	0.573	S	S	*	*	H	α-helix	trans	-66	-39	173.1	-71	-179.7	-179.9	179.1	0	112.1	D7 I8 L9 S15	D7-K11 WeakPolarHBondContact O-CG 3.33Å; I8-K11 PolarHBondContact O-N 3.43Å; L9-K11 VanDerWaalsContact C-N 3.33Å; L9-K11 PolarHBondContact O-N 3.39Å; K11-S15 VanDerWaalsContact O-CB 3.32Å; K11-S15 WeakPolarHBondContact O-CB 3.32Å; K11-S15 PolarHBondContact O-N 3.21Å
12	L	93.8	Very high	88.6	Confident	113 Å²	113	102.3 Å²	102.3	59%	0.592	56%	0.558	S	S	*	*	H	α-helix	trans	-66.9	-42.1	174.9	-179.4	62.2	0	0	0	111	I8 L9 S15 A16	I8-L12 WeakPolarHBondContact O-CB 3.45Å; I8-L12 PolarHBondContact O-N 2.86Å; L9-L12 WeakPolarHBondContact O-CB 3.45Å; L9-L12 PolarHBondContact O-N 3.2Å; L12-S15 PolarHBondContact O-N 3.47Å; L12-A16 VanDerWaalsContact O-CB 3.3Å; L12-A16 WeakPolarHBondContact O-CB 3.4Å; L12-A16 PolarHBondContact O-N 2.82Å
13	E	95.4	Very high	90.3	Very high	138 Å²	138	101.7 Å²	101.7	65%	0.645	55%	0.546	S	S	*	.	H	α-helix	trans	-61.2	-48.8	174.8	-176.1	174.4	-167.9	0	0	111.7	L9 P10 S15 A16 E17	L9-E13 WeakPolarHBondContact O-CB 3.45Å; L9-E13 PolarHBondContact O-N 2.94Å; P10-E13 PolarHBondContact O-N 2.63Å; E13-S15 VanDerWaalsContact C-N 3.33Å; E13-S15 PolarHBondContact O-N 2.83Å; E13-A16 PolarHBondContact O-N 3.4Å; E13-E17 WeakPolarHBondContact O-CB 3.09Å; E13-E17 PolarHBondContact O-N 3.42Å
14	E	96.8	Very high	92.1	Very high	139 Å²	139	101.7 Å²	101.7	65%	0.65	54%	0.536	S	S	*	.	H	α-helix	trans	-58.9	-43.5	176.3	-177.4	-178.4	-169.9	0	0	111.6	P10 G18	P10-E14 VanDerWaalsContact O-CB 3.31Å; P10-E14 WeakPolarHBondContact O-CB 3.31Å; P10-E14 PolarHBondContact O-N 2.89Å; E14-G18 PolarHBondContact O-N 3.31Å
15	S	96.2	Very high	93.6	Very high	64 Å²	64	97.1 Å²	97.1	45%	0.448	52%	0.52	S	S	.	.	H	α-helix	trans	-64.7	-44.5	176	-174.5	0	0	0	0	111.9	K11 L12 E13 G18 I19	K11-S15 VanDerWaalsContact O-CB 3.32Å; K11-S15 WeakPolarHBondContact O-CB 3.32Å; K11-S15 PolarHBondContact O-N 3.21Å; L12-S15 PolarHBondContact O-N 3.47Å; E13-S15 VanDerWaalsContact C-N 3.33Å; E13-S15 PolarHBondContact O-N 2.83Å; S15-G18 PolarHBondContact O-N 2.85Å; S15-I19 VanDerWaalsContact O-CG1 3.28Å; S15-I19 WeakPolarHBondContact O-CG1 3.3Å; S15-I19 PolarHBondContact O-N 2.86Å
16	A	97.4	Very high	95	Very high	55 Å²	55	97.6 Å²	97.6	46%	0.455	53%	0.525	S	S	.	.	H	α-helix	trans	-63.9	-42.5	177.7	0	0	0	0	0	111.9	L12 E13 I19 A20	L12-A16 VanDerWaalsContact O-CB 3.3Å; L12-A16 WeakPolarHBondContact O-CB 3.4Å; L12-A16 PolarHBondContact O-N 2.82Å; E13-A16 PolarHBondContact O-N 3.4Å; A16-I19 PolarHBondContact O-N 3.42Å; A16-A20 WeakPolarHBondContact O-CB 3.35Å; A16-A20 PolarHBondContact O-N 3.43Å
17	E	97.9	Very high	96	Very high	100 Å²	100	95.9 Å²	95.9	47%	0.467	52%	0.517	S	S	.	.	H	α-helix	trans	-64.5	-41.9	174.7	-168.8	-172.5	173	0	0	111	E13 A20 K21	E13-E17 WeakPolarHBondContact O-CB 3.09Å; E13-E17 PolarHBondContact O-N 3.42Å; E17-A20 PolarHBondContact O-N 3.38Å; E17-K21 VanDerWaalsContact CD-NZ 3.33Å; E17-K21 HydrophobicContact CG-CD 4.36Å; E17-K21 WeakPolarHBondContact O-CB 3.49Å; E17-K21 WeakPolarHBondContact O-CG 3.28Å; E17-K21 PolarHBondContact O-N 2.77Å; E17-K21 WeakPolarHBondContact OE1-CE 3.32Å; E17-K21 IonicContact OE1-NZ 2.9Å; E17-K21 PolarHBondContact OE1-NZ 2.94Å
18	G	98.1	Very high	96.6	Very high	25 Å²	25	98.9 Å²	98.9	26%	0.258	52%	0.52	S	S	.	.	H	α-helix	trans	-57.9	-50.5	174	0	0	0	0	0	111.8	E14 S15 A20 K21 H22	E14-G18 PolarHBondContact O-N 3.31Å; S15-G18 PolarHBondContact O-N 2.85Å; G18-A20 PolarHBondContact O-N 2.9Å; G18-K21 PolarHBondContact O-N 3.43Å; G18-H22 PolarHBondContact O-N 3.35Å; G18-H22 VanDerWaalsContact O-N 3.07Å; G18-H22 PolarHBondContact O-ND1 2.87Å
19	I	97.8	Very high	96.9	Very high	109 Å²	109	97.2 Å²	97.2	56%	0.559	52%	0.518	S	S	*	.	H	α-helix	trans	-61.6	-44.7	177.3	-68.2	165.2	0	0	0	110.8	S15 A16 K21 H22 L23	S15-I19 VanDerWaalsContact O-CG1 3.28Å; S15-I19 WeakPolarHBondContact O-CG1 3.3Å; S15-I19 PolarHBondContact O-N 2.86Å; A16-I19 PolarHBondContact O-N 3.42Å; I19-K21 PolarHBondContact O-N 2.95Å; I19-H22 PolarHBondContact O-N 3.01Å; I19-L23 WeakPolarHBondContact O-CB 3.43Å; I19-L23 PolarHBondContact O-N 3.31Å
20	A	98.3	Very high	97.3	Very high	57 Å²	57	96.9 Å²	96.9	47%	0.471	52%	0.516	S	S	.	.	H	α-helix	trans	-60.3	-43.1	179.2	0	0	0	0	0	112.2	A16 E17 G18 L23 D24	A16-A20 WeakPolarHBondContact O-CB 3.35Å; A16-A20 PolarHBondContact O-N 3.43Å; E17-A20 PolarHBondContact O-N 3.38Å; G18-A20 PolarHBondContact O-N 2.9Å; A20-L23 PolarHBondContact O-N 3.46Å; A20-D24 PolarHBondContact O-N 3.29Å
21	K	98.5	Very high	97.6	Very high	126 Å²	126	97.4 Å²	97.4	55%	0.548	52%	0.518	S	S	.	.	H	α-helix	trans	-63.5	-44.1	175.9	-74.8	173.1	-178.5	166	0	112.5	E17 G18 I19 D24 A25	E17-K21 VanDerWaalsContact CD-NZ 3.33Å; E17-K21 HydrophobicContact CG-CD 4.36Å; E17-K21 WeakPolarHBondContact O-CB 3.49Å; E17-K21 WeakPolarHBondContact O-CG 3.28Å; E17-K21 PolarHBondContact O-N 2.77Å; E17-K21 WeakPolarHBondContact OE1-CE 3.32Å; E17-K21 IonicContact OE1-NZ 2.9Å; E17-K21 PolarHBondContact OE1-NZ 2.94Å; G18-K21 PolarHBondContact O-N 3.43Å; I19-K21 PolarHBondContact O-N 2.95Å; K21-D24 PolarHBondContact O-N 2.73Å; K21-A25 PolarHBondContact O-N 3.48Å
22	H	98.2	Very high	97.8	Very high	132 Å²	132	93.6 Å²	93.6	61%	0.611	51%	0.509	S	S	*	.	H	α-helix	trans	-65.4	-40.5	177	-73.1	94.2	0	0	0	111.7	G18 I19 A25 L26	G18-H22 PolarHBondContact O-N 3.35Å; G18-H22 VanDerWaalsContact O-N 3.07Å; G18-H22 PolarHBondContact O-ND1 2.87Å; I19-H22 PolarHBondContact O-N 3.01Å; H22-A25 PolarHBondContact O-N 3.46Å; H22-L26 WeakPolarHBondContact O-CG 3.28Å; H22-L26 PolarHBondContact O-N 2.89Å
23	L	98.4	Very high	98	Very high	96 Å²	96	91.4 Å²	91.4	50%	0.503	50%	0.5	S	S	.	.	H	α-helix	trans	-62.6	-45	176	-178.2	60.8	0	0	0	111.4	I19 A20 A25 L26 L27	I19-L23 WeakPolarHBondContact O-CB 3.43Å; I19-L23 PolarHBondContact O-N 3.31Å; A20-L23 PolarHBondContact O-N 3.46Å; L23-A25 PolarHBondContact O-N 3.4Å; L23-L26 PolarHBondContact O-N 2.88Å; L23-L27 HydrophobicContact CD1-CD1 4.22Å; L23-L27 HydrophobicContact CD1-CG 4.19Å; L23-L27 HydrophobicContact CG-CD1 4.01Å; L23-L27 HydrophobicContact CG-CG 4.42Å; L23-L27 WeakPolarHBondContact O-CB 3.37Å; L23-L27 VanDerWaalsContact O-CG 3.28Å; L23-L27 WeakPolarHBondContact O-CG 3.3Å; L23-L27 PolarHBondContact O-N 3.49Å
24	D	98.5	Very high	98.2	Very high	76 Å²	76	89.2 Å²	89.2	41%	0.406	49%	0.493	S	S	.	.	H	α-helix	trans	-59.6	-44.6	175.7	-172.4	62.3	0	0	0	111.6	A20 K21 L26 L27 R28	A20-D24 PolarHBondContact O-N 3.29Å; K21-D24 PolarHBondContact O-N 2.73Å; D24-L26 PolarHBondContact O-N 3.07Å; D24-L27 PolarHBondContact O-N 2.96Å; D24-R28 VanDerWaalsContact O-CG 3.3Å; D24-R28 WeakPolarHBondContact O-CG 3.32Å; D24-R28 PolarHBondContact O-N 3.37Å; D24-R28 IonicContact OD1-NE 3.18Å; D24-R28 IonicContact OD1-NH2 2.77Å; D24-R28 IonicContact OD2-CZ 2.63Å; D24-R28 VanDerWaalsContact OD2-CZ 3.25Å; D24-R28 IonicContact OD2-NE 3.67Å; D24-R28 PolarHBondContact OD2-NE 2.95Å; D24-R28 IonicContact OD2-NH2 3.88Å; D24-R28 PolarHBondContact OD2-NH2 2.73Å
25	A	98.5	Very high	98.3	Very high	57 Å²	57	87.7 Å²	87.7	47%	0.471	49%	0.489	S	S	.	.	H	α-helix	trans	-62	-43.5	176.9	0	0	0	0	0	112.6	K21 H22 L23 R28 S29	K21-A25 PolarHBondContact O-N 3.48Å; H22-A25 PolarHBondContact O-N 3.46Å; L23-A25 PolarHBondContact O-N 3.4Å; A25-R28 PolarHBondContact O-N 3.04Å; A25-S29 WeakPolarHBondContact O-CB 3.47Å; A25-S29 PolarHBondContact O-N 3.36Å
26	L	98.6	Very high	98.4	Very high	120 Å²	120	90.1 Å²	90.1	63%	0.628	49%	0.493	S	S	*	.	H	α-helix	trans	-64.7	-43.4	176.5	-73.9	174.4	0	0	0	111.8	H22 L23 D24 R28 S29 L30	H22-L26 WeakPolarHBondContact O-CG 3.28Å; H22-L26 PolarHBondContact O-N 2.89Å; L23-L26 PolarHBondContact O-N 2.88Å; D24-L26 PolarHBondContact O-N 3.07Å; L26-R28 VanDerWaalsContact C-N 3.35Å; L26-R28 PolarHBondContact O-N 3.48Å; L26-S29 PolarHBondContact O-N 3.29Å; L26-L30 VanDerWaalsContact O-CB 3.31Å; L26-L30 WeakPolarHBondContact O-CB 3.35Å; L26-L30 PolarHBondContact O-N 2.97Å
27	L	98.6	Very high	98.5	Very high	87 Å²	87	92.8 Å²	92.8	46%	0.455	50%	0.497	S	S	.	.	H	α-helix	trans	-63.3	-40.3	177.9	-72.9	173.3	0	0	0	111.8	L23 D24 T31	L23-L27 HydrophobicContact CD1-CD1 4.22Å; L23-L27 HydrophobicContact CD1-CG 4.19Å; L23-L27 HydrophobicContact CG-CD1 4.01Å; L23-L27 HydrophobicContact CG-CG 4.42Å; L23-L27 WeakPolarHBondContact O-CB 3.37Å; L23-L27 VanDerWaalsContact O-CG 3.28Å; L23-L27 WeakPolarHBondContact O-CG 3.3Å; L23-L27 PolarHBondContact O-N 3.49Å; D24-L27 PolarHBondContact O-N 2.96Å; L27-T31 VanDerWaalsContact O-CB 3.32Å; L27-T31 WeakPolarHBondContact O-CB 3.46Å; L27-T31 PolarHBondContact O-N 3.01Å; L27-T31 PolarHBondContact O-OG1 2.83Å
28	R	98.7	Very high	98.5	Very high	169 Å²	169	91.7 Å²	91.7	64%	0.638	50%	0.501	S	S	*	.	H	α-helix	trans	-63.3	-44.4	173.4	-71.3	176.9	-167.2	-126.6	5.2	112.1	D24 A25 L26 T31 S32	D24-R28 VanDerWaalsContact O-CG 3.3Å; D24-R28 WeakPolarHBondContact O-CG 3.32Å; D24-R28 PolarHBondContact O-N 3.37Å; D24-R28 IonicContact OD1-NE 3.18Å; D24-R28 IonicContact OD1-NH2 2.77Å; D24-R28 IonicContact OD2-CZ 2.63Å; D24-R28 VanDerWaalsContact OD2-CZ 3.25Å; D24-R28 IonicContact OD2-NE 3.67Å; D24-R28 PolarHBondContact OD2-NE 2.95Å; D24-R28 IonicContact OD2-NH2 3.88Å; D24-R28 PolarHBondContact OD2-NH2 2.73Å; A25-R28 PolarHBondContact O-N 3.04Å; L26-R28 VanDerWaalsContact C-N 3.35Å; L26-R28 PolarHBondContact O-N 3.48Å; R28-T31 PolarHBondContact O-N 3.48Å; R28-S32 WeakPolarHBondContact O-CB 3.45Å; R28-S32 PolarHBondContact O-N 2.93Å
29	S	98.5	Very high	98.5	Very high	70 Å²	70	93.4 Å²	93.4	49%	0.49	51%	0.509	S	S	.	.	H	α-helix	trans	-63.5	-45.9	178.1	-175.9	0	0	0	0	112.1	A25 L26 T31 S32 T33	A25-S29 WeakPolarHBondContact O-CB 3.47Å; A25-S29 PolarHBondContact O-N 3.36Å; L26-S29 PolarHBondContact O-N 3.29Å; S29-T31 PolarHBondContact O-N 3.47Å; S29-S32 PolarHBondContact O-N 2.87Å; S29-T33 WeakPolarHBondContact O-CB 3.48Å; S29-T33 PolarHBondContact O-N 3.45Å; S29-T33 PolarHBondContact O-OG1 3.32Å
30	L	98.5	Very high	98.6	Very high	96 Å²	96	93.5 Å²	93.5	50%	0.503	51%	0.51	S	S	.	.	H	α-helix	trans	-60.3	-46.6	176.1	-178.3	64.2	0	0	0	111.1	L26 S32 T33 L34	L26-L30 VanDerWaalsContact O-CB 3.31Å; L26-L30 WeakPolarHBondContact O-CB 3.35Å; L26-L30 PolarHBondContact O-N 2.97Å; L30-S32 PolarHBondContact O-N 3.27Å; L30-T33 PolarHBondContact O-N 3Å; L30-L34 HydrophobicContact CD1-CD1 4.14Å; L30-L34 HydrophobicContact CD1-CG 4.19Å; L30-L34 HydrophobicContact CG-CD1 3.92Å; L30-L34 HydrophobicContact CG-CG 4.37Å; L30-L34 WeakPolarHBondContact O-CB 3.33Å; L30-L34 VanDerWaalsContact O-CG 3.31Å; L30-L34 WeakPolarHBondContact O-CG 3.31Å; L30-L34 PolarHBondContact O-N 2.93Å
31	T	98.7	Very high	98.6	Very high	77 Å²	77	94.6 Å²	94.6	47%	0.472	51%	0.511	S	S	.	.	H	α-helix	trans	-59.8	-45.6	177.6	-58.5	0	0	0	0	111.4	L27 R28 S29 T33 L34 N35	L27-T31 VanDerWaalsContact O-CB 3.32Å; L27-T31 WeakPolarHBondContact O-CB 3.46Å; L27-T31 PolarHBondContact O-N 3.01Å; L27-T31 PolarHBondContact O-OG1 2.83Å; R28-T31 PolarHBondContact O-N 3.48Å; S29-T31 PolarHBondContact O-N 3.47Å; T31-T33 PolarHBondContact O-N 3.49Å; T31-L34 PolarHBondContact O-N 3.43Å; T31-N35 WeakPolarHBondContact O-CB 3.41Å; T31-N35 VanDerWaalsContact O-CG 3.25Å; T31-N35 PolarHBondContact O-N 2.92Å; T31-N35 PolarHBondContact O-ND2 3.29Å
32	S	98.6	Very high	98.6	Very high	59 Å²	59	93.6 Å²	93.6	41%	0.413	51%	0.511	S	S	.	.	H	α-helix	trans	-60.1	-44.9	176.2	-176.1	0	0	0	0	112	R28 S29 L30 N35 Q36	R28-S32 WeakPolarHBondContact O-CB 3.45Å; R28-S32 PolarHBondContact O-N 2.93Å; S29-S32 PolarHBondContact O-N 2.87Å; L30-S32 PolarHBondContact O-N 3.27Å; S32-N35 PolarHBondContact O-N 3.38Å; S32-Q36 WeakPolarHBondContact O-CG 3.45Å; S32-Q36 PolarHBondContact O-N 3.24Å; S32-Q36 PolarHBondContact OG-NE2 2.93Å
33	T	98.6	Very high	98.6	Very high	68 Å²	68	91.4 Å²	91.4	42%	0.417	50%	0.503	S	S	.	.	H	α-helix	trans	-67.1	-43.2	-178.9	-55.7	0	0	0	0	111.8	S29 L30 T31 N35 Q36 M37	S29-T33 WeakPolarHBondContact O-CB 3.48Å; S29-T33 PolarHBondContact O-N 3.45Å; S29-T33 PolarHBondContact O-OG1 3.32Å; L30-T33 PolarHBondContact O-N 3Å; T31-T33 PolarHBondContact O-N 3.49Å; T33-N35 VanDerWaalsContact C-N 3.33Å; T33-N35 PolarHBondContact O-N 2.85Å; T33-Q36 PolarHBondContact O-N 3.25Å; T33-M37 WeakPolarHBondContact O-CB 3.31Å; T33-M37 PolarHBondContact O-N 3.41Å
34	L	98.7	Very high	98.6	Very high	92 Å²	92	91 Å²	91	48%	0.482	51%	0.508	S	S	.	.	H	α-helix	trans	-63.2	-39.6	176.4	-72.9	174.1	0	0	0	111.6	L30 T31 M37 S38	L30-L34 HydrophobicContact CD1-CD1 4.14Å; L30-L34 HydrophobicContact CD1-CG 4.19Å; L30-L34 HydrophobicContact CG-CD1 3.92Å; L30-L34 HydrophobicContact CG-CG 4.37Å; L30-L34 WeakPolarHBondContact O-CB 3.33Å; L30-L34 VanDerWaalsContact O-CG 3.31Å; L30-L34 WeakPolarHBondContact O-CG 3.31Å; L30-L34 PolarHBondContact O-N 2.93Å; T31-L34 PolarHBondContact O-N 3.43Å; L34-M37 PolarHBondContact O-N 3.48Å; L34-S38 WeakPolarHBondContact O-CB 3.42Å; L34-S38 PolarHBondContact O-N 3.37Å
35	N	98.7	Very high	98.6	Very high	106 Å²	106	91.1 Å²	91.1	57%	0.567	51%	0.512	S	S	*	.	H	α-helix	trans	-64.5	-42.3	175.3	-73.3	-22.1	0	0	0	111.9	T31 S32 T33 S38 S39	T31-N35 WeakPolarHBondContact O-CB 3.41Å; T31-N35 VanDerWaalsContact O-CG 3.25Å; T31-N35 PolarHBondContact O-N 2.92Å; T31-N35 PolarHBondContact O-ND2 3.29Å; S32-N35 PolarHBondContact O-N 3.38Å; T33-N35 VanDerWaalsContact C-N 3.33Å; T33-N35 PolarHBondContact O-N 2.85Å; N35-S38 PolarHBondContact O-N 2.86Å; N35-S39 PolarHBondContact O-N 2.9Å
36	Q	98.7	Very high	98.6	Very high	116 Å²	116	91.4 Å²	91.4	54%	0.542	51%	0.507	S	S	.	.	H	α-helix	trans	-62.8	-44.9	174.9	-70	171.9	37.3	0	0	111.7	S32 T33 S38 S39 L40	S32-Q36 WeakPolarHBondContact O-CG 3.45Å; S32-Q36 PolarHBondContact O-N 3.24Å; S32-Q36 PolarHBondContact OG-NE2 2.93Å; T33-Q36 PolarHBondContact O-N 3.25Å; Q36-S38 VanDerWaalsContact C-N 3.34Å; Q36-S38 PolarHBondContact O-N 2.95Å; Q36-S39 WeakPolarHBondContact O-CB 3.34Å; Q36-S39 PolarHBondContact O-N 3.36Å; Q36-L40 WeakPolarHBondContact O-CG 3.41Å; Q36-L40 PolarHBondContact O-N 3.23Å
37	M	98.6	Very high	98.7	Very high	111 Å²	111	90 Å²	90	55%	0.547	50%	0.504	S	S	.	.	H	α-helix	trans	-64	-39.1	177.9	-170.9	-178.4	-68.9	0	0	112	T33 L34 L40 T41	T33-M37 WeakPolarHBondContact O-CB 3.31Å; T33-M37 PolarHBondContact O-N 3.41Å; L34-M37 PolarHBondContact O-N 3.48Å; M37-L40 PolarHBondContact O-N 3.03Å; M37-T41 WeakPolarHBondContact O-CB 3.41Å; M37-T41 PolarHBondContact O-N 3.13Å; M37-T41 PolarHBondContact O-OG1 3.27Å
38	S	98.6	Very high	98.7	Very high	77 Å²	77	92.9 Å²	92.9	54%	0.538	51%	0.513	S	S	.	.	H	α-helix	trans	-65.3	-40.6	174.3	-171.3	0	0	0	0	111.6	L34 N35 Q36 T41 L42	L34-S38 WeakPolarHBondContact O-CB 3.42Å; L34-S38 PolarHBondContact O-N 3.37Å; N35-S38 PolarHBondContact O-N 2.86Å; Q36-S38 VanDerWaalsContact C-N 3.34Å; Q36-S38 PolarHBondContact O-N 2.95Å; S38-T41 PolarHBondContact O-N 2.79Å; S38-L42 PolarHBondContact O-N 3.48Å
39	S	98.7	Very high	98.7	Very high	60 Å²	60	89.6 Å²	89.6	42%	0.42	51%	0.507	S	S	.	.	H	α-helix	trans	-61.9	-48.6	175	-168.7	0	0	0	0	111.2	N35 Q36 T41 L42 D43	N35-S39 PolarHBondContact O-N 2.9Å; Q36-S39 WeakPolarHBondContact O-CB 3.34Å; Q36-S39 PolarHBondContact O-N 3.36Å; S39-T41 VanDerWaalsContact C-N 3.27Å; S39-T41 PolarHBondContact O-N 3.47Å; S39-L42 WeakPolarHBondContact O-CB 3.49Å; S39-L42 PolarHBondContact O-N 2.93Å; S39-L42 VanDerWaalsContact O-N 3.13Å; S39-D43 VanDerWaalsContact O-CG 3.24Å; S39-D43 PolarHBondContact O-N 3.21Å
40	L	98.7	Very high	98.7	Very high	111 Å²	111	90.8 Å²	90.8	58%	0.581	51%	0.508	S	S	*	.	H	α-helix	trans	-61.3	-37.5	177.1	-71.1	173.1	0	0	0	112.2	Q36 M37 D43 C44	Q36-L40 WeakPolarHBondContact O-CG 3.41Å; Q36-L40 PolarHBondContact O-N 3.23Å; M37-L40 PolarHBondContact O-N 3.03Å; L40-D43 PolarHBondContact O-N 2.77Å; L40-C44 WeakPolarHBondContact O-CB 3.42Å; L40-C44 PolarHBondContact O-N 2.93Å; L40-C44 PolarHBondContact O-SG 3.47Å; L40-C44 VanDerWaalsContact O-SG 3.35Å
41	T	98.6	Very high	98.7	Very high	80 Å²	80	89.3 Å²	89.3	49%	0.491	51%	0.506	S	S	.	.	H	α-helix	trans	-63.8	-45.5	175.3	-58.3	0	0	0	0	110.6	M37 S38 S39 D43 C44 T45	M37-T41 WeakPolarHBondContact O-CB 3.41Å; M37-T41 PolarHBondContact O-N 3.13Å; M37-T41 PolarHBondContact O-OG1 3.27Å; S38-T41 PolarHBondContact O-N 2.79Å; S39-T41 VanDerWaalsContact C-N 3.27Å; S39-T41 PolarHBondContact O-N 3.47Å; T41-D43 PolarHBondContact O-N 2.81Å; T41-C44 PolarHBondContact O-N 2.9Å; T41-T45 WeakPolarHBondContact O-CG2 3.37Å; T41-T45 PolarHBondContact O-N 3.46Å; T41-T45 PolarHBondContact O-OG1 2.92Å
42	L	98.8	Very high	98.7	Very high	106 Å²	106	88.5 Å²	88.5	56%	0.555	50%	0.501	S	S	*	.	H	α-helix	trans	-59.7	-46.4	176.4	-179.8	62.8	0	0	0	111.5	S38 S39 C44 T45 T46	S38-L42 PolarHBondContact O-N 3.48Å; S39-L42 WeakPolarHBondContact O-CB 3.49Å; S39-L42 PolarHBondContact O-N 2.93Å; S39-L42 VanDerWaalsContact O-N 3.13Å; L42-C44 PolarHBondContact O-N 3.34Å; L42-T45 WeakPolarHBondContact CA-OG1 3.43Å; L42-T45 PolarHBondContact O-N 3.35Å; L42-T45 PolarHBondContact O-OG1 3.46Å; L42-T46 WeakPolarHBondContact O-CB 3.37Å; L42-T46 PolarHBondContact O-N 2.95Å; L42-T46 PolarHBondContact O-OG1 3.21Å
43	D	98.8	Very high	98.7	Very high	85 Å²	85	89.7 Å²	89.7	46%	0.455	50%	0.502	S	S	.	.	H	α-helix	trans	-59.9	-47.5	177.8	-64.2	-22.2	0	0	0	111	S39 L40 T41 T45 T46 V47	S39-D43 VanDerWaalsContact O-CG 3.24Å; S39-D43 PolarHBondContact O-N 3.21Å; L40-D43 PolarHBondContact O-N 2.77Å; T41-D43 PolarHBondContact O-N 2.81Å; D43-T45 PolarHBondContact O-N 3.35Å; D43-T46 WeakPolarHBondContact O-CB 3.33Å; D43-T46 PolarHBondContact O-N 2.95Å; D43-V47 WeakPolarHBondContact O-CG2 3.49Å; D43-V47 PolarHBondContact O-N 2.96Å
44	C	98.6	Very high	98.7	Very high	89 Å²	89	94.1 Å²	94.1	60%	0.601	51%	0.513	S	S	*	.	H	α-helix	trans	-60.2	-44	176.2	-77.7	0	0	0	0	112.5	L40 T41 L42 T46 V47 F48	L40-C44 WeakPolarHBondContact O-CB 3.42Å; L40-C44 PolarHBondContact O-N 2.93Å; L40-C44 PolarHBondContact O-SG 3.47Å; L40-C44 VanDerWaalsContact O-SG 3.35Å; T41-C44 PolarHBondContact O-N 2.9Å; L42-C44 PolarHBondContact O-N 3.34Å; C44-T46 VanDerWaalsContact C-N 3.29Å; C44-T46 PolarHBondContact O-N 3.17Å; C44-V47 PolarHBondContact O-N 3.45Å; C44-F48 WeakPolarHBondContact O-CB 3.39Å; C44-F48 PolarHBondContact O-N 2.91Å
45	T	98.6	Very high	98.7	Very high	78 Å²	78	92 Å²	92	48%	0.479	51%	0.509	S	S	.	.	H	α-helix	trans	-65	-34.9	177.7	54.1	0	0	0	0	112.3	T41 L42 D43 L49	T41-T45 WeakPolarHBondContact O-CG2 3.37Å; T41-T45 PolarHBondContact O-N 3.46Å; T41-T45 PolarHBondContact O-OG1 2.92Å; L42-T45 WeakPolarHBondContact CA-OG1 3.43Å; L42-T45 PolarHBondContact O-N 3.35Å; L42-T45 PolarHBondContact O-OG1 3.46Å; D43-T45 PolarHBondContact O-N 3.35Å; T45-L49 WeakPolarHBondContact O-CB 3.47Å; T45-L49 PolarHBondContact O-N 3.5Å
46	T	98.7	Very high	98.7	Very high	62 Å²	62	90.9 Å²	90.9	38%	0.38	51%	0.508	S	S	.	.	H	α-helix	trans	-67.2	-50.2	177	-55.1	0	0	0	0	110.4	L42 D43 C44 F48 L49 D50	L42-T46 WeakPolarHBondContact O-CB 3.37Å; L42-T46 PolarHBondContact O-N 2.95Å; L42-T46 PolarHBondContact O-OG1 3.21Å; D43-T46 WeakPolarHBondContact O-CB 3.33Å; D43-T46 PolarHBondContact O-N 2.95Å; C44-T46 VanDerWaalsContact C-N 3.29Å; C44-T46 PolarHBondContact O-N 3.17Å; T46-F48 VanDerWaalsContact C-N 3.28Å; T46-F48 PolarHBondContact O-N 3.33Å; T46-L49 PolarHBondContact O-N 3.44Å; T46-D50 VanDerWaalsContact O-CG 3.31Å; T46-D50 PolarHBondContact O-N 2.9Å
47	V	98.8	Very high	98.7	Very high	92 Å²	92	92.1 Å²	92.1	56%	0.558	51%	0.514	S	S	*	.	H	α-helix	trans	-60.6	-39.5	177	173	0	0	0	0	111.5	D43 C44 S51	D43-V47 WeakPolarHBondContact O-CG2 3.49Å; D43-V47 PolarHBondContact O-N 2.96Å; C44-V47 PolarHBondContact O-N 3.45Å; V47-S51 VanDerWaalsContact O-CB 3.27Å; V47-S51 WeakPolarHBondContact O-CB 3.43Å; V47-S51 PolarHBondContact O-N 3.18Å; V47-S51 PolarHBondContact O-OG 2.93Å
48	F	98.6	Very high	98.7	Very high	147 Å²	147	90 Å²	90	65%	0.645	51%	0.507	S	S	*	.	H	α-helix	trans	-63.7	-46	176.5	-178.1	-101.6	0	0	0	111.7	C44 T46 S51 V52	C44-F48 WeakPolarHBondContact O-CB 3.39Å; C44-F48 PolarHBondContact O-N 2.91Å; T46-F48 VanDerWaalsContact C-N 3.28Å; T46-F48 PolarHBondContact O-N 3.33Å; F48-S51 PolarHBondContact O-N 3.38Å; F48-V52 HydrophobicContact CD1-CG2 4.35Å; F48-V52 HydrophobicContact CE1-CG2 3.95Å; F48-V52 HydrophobicContact CE2-CG2 4.23Å; F48-V52 HydrophobicContact CZ-CG2 3.88Å; F48-V52 WeakPolarHBondContact O-CG2 3.46Å; F48-V52 PolarHBondContact O-N 2.91Å
49	L	98.7	Very high	98.7	Very high	100 Å²	100	90.2 Å²	90.2	52%	0.524	51%	0.505	S	S	.	.	H	α-helix	trans	-59.3	-51.4	176.8	-176.1	66.5	0	0	0	111.1	T45 T46 S51 V52 D53	T45-L49 WeakPolarHBondContact O-CB 3.47Å; T45-L49 PolarHBondContact O-N 3.5Å; T46-L49 PolarHBondContact O-N 3.44Å; L49-S51 VanDerWaalsContact C-N 3.27Å; L49-S51 PolarHBondContact O-N 2.93Å; L49-V52 PolarHBondContact O-N 3.49Å; L49-V52 VanDerWaalsContact O-N 3.13Å; L49-D53 PolarHBondContact O-N 2.99Å
50	D	98.7	Very high	98.7	Very high	94 Å²	94	88.6 Å²	88.6	50%	0.503	50%	0.498	S	S	.	.	H	α-helix	trans	-59.1	-39.5	178.9	-67.4	-16	0	0	0	112	T46 D53 Y54	T46-D50 VanDerWaalsContact O-CG 3.31Å; T46-D50 PolarHBondContact O-N 2.9Å; D50-D53 PolarHBondContact O-N 3.3Å; D50-Y54 VanDerWaalsContact O-CB 3.3Å; D50-Y54 WeakPolarHBondContact O-CB 3.27Å; D50-Y54 PolarHBondContact O-N 3.45Å
51	S	98.7	Very high	98.7	Very high	66 Å²	66	85.8 Å²	85.8	46%	0.462	49%	0.491	S	S	.	.	H	α-helix	trans	-67.2	-39.4	178.3	-61.3	0	0	0	0	112.2	V47 F48 L49 A55	V47-S51 VanDerWaalsContact O-CB 3.27Å; V47-S51 WeakPolarHBondContact O-CB 3.43Å; V47-S51 PolarHBondContact O-N 3.18Å; V47-S51 PolarHBondContact O-OG 2.93Å; F48-S51 PolarHBondContact O-N 3.38Å; L49-S51 VanDerWaalsContact C-N 3.27Å; L49-S51 PolarHBondContact O-N 2.93Å; S51-A55 VanDerWaalsContact O-CB 3.29Å; S51-A55 WeakPolarHBondContact O-CB 3.3Å; S51-A55 PolarHBondContact O-N 3.41Å
52	V	98.8	Very high	98.7	Very high	60 Å²	60	85.6 Å²	85.6	36%	0.364	49%	0.492	S	S	.	.	H	α-helix	trans	-67.1	-45.9	176.1	169.1	0	0	0	0	110.3	F48 L49 A55 C56	F48-V52 HydrophobicContact CD1-CG2 4.35Å; F48-V52 HydrophobicContact CE1-CG2 3.95Å; F48-V52 HydrophobicContact CE2-CG2 4.23Å; F48-V52 HydrophobicContact CZ-CG2 3.88Å; F48-V52 WeakPolarHBondContact O-CG2 3.46Å; F48-V52 PolarHBondContact O-N 2.91Å; L49-V52 PolarHBondContact O-N 3.49Å; L49-V52 VanDerWaalsContact O-N 3.13Å; V52-A55 PolarHBondContact O-N 3.13Å; V52-C56 WeakPolarHBondContact O-CB 3.47Å; V52-C56 PolarHBondContact O-N 2.89Å; V52-C56 PolarHBondContact O-SG 2.88Å; V52-C56 VanDerWaalsContact O-SG 3.41Å
53	D	98.7	Very high	98.7	Very high	83 Å²	83	84.7 Å²	84.7	44%	0.444	49%	0.487	S	S	.	.	H	α-helix	trans	-60.7	-48.1	178.3	-75.6	-14.1	0	0	0	111.1	L49 D50 A55 C56 E57	L49-D53 PolarHBondContact O-N 2.99Å; D50-D53 PolarHBondContact O-N 3.3Å; D53-A55 VanDerWaalsContact C-N 3.33Å; D53-A55 PolarHBondContact O-N 3.35Å; D53-C56 WeakPolarHBondContact O-CB 3.34Å; D53-C56 PolarHBondContact O-N 2.95Å; D53-E57 WeakPolarHBondContact O-CG 3.35Å; D53-E57 PolarHBondContact O-N 2.7Å
54	Y	98.7	Very high	98.7	Very high	161 Å²	161	88 Å²	88	63%	0.631	50%	0.497	S	S	*	.	H	α-helix	trans	-59.1	-41.9	175.4	176.9	-99.1	0	0	0	112.7	D50 E57 T58	D50-Y54 VanDerWaalsContact O-CB 3.3Å; D50-Y54 WeakPolarHBondContact O-CB 3.27Å; D50-Y54 PolarHBondContact O-N 3.45Å; Y54-E57 PolarHBondContact O-N 2.84Å; Y54-T58 WeakPolarHBondContact O-CB 3.27Å; Y54-T58 PolarHBondContact O-N 2.95Å; Y54-T58 PolarHBondContact O-OG1 3.01Å
55	A	98.6	Very high	98.7	Very high	49 Å²	49	87.3 Å²	87.3	41%	0.405	49%	0.493	S	S	.	.	H	α-helix	trans	-63.8	-43	176.6	0	0	0	0	0	111.4	S51 V52 D53 T58 V59	S51-A55 VanDerWaalsContact O-CB 3.29Å; S51-A55 WeakPolarHBondContact O-CB 3.3Å; S51-A55 PolarHBondContact O-N 3.41Å; V52-A55 PolarHBondContact O-N 3.13Å; D53-A55 VanDerWaalsContact C-N 3.33Å; D53-A55 PolarHBondContact O-N 3.35Å; A55-T58 PolarHBondContact O-N 2.89Å; A55-V59 WeakPolarHBondContact O-CB 3.29Å; A55-V59 VanDerWaalsContact O-CG2 3.27Å; A55-V59 WeakPolarHBondContact O-CG2 3.46Å; A55-V59 PolarHBondContact O-N 2.87Å
56	C	98.7	Very high	98.7	Very high	82 Å²	82	87.5 Å²	87.5	55%	0.554	50%	0.495	S	S	*	.	H	α-helix	trans	-62.6	-43.9	176.3	-77	0	0	0	0	112.2	V52 D53 G60	V52-C56 WeakPolarHBondContact O-CB 3.47Å; V52-C56 PolarHBondContact O-N 2.89Å; V52-C56 PolarHBondContact O-SG 2.88Å; V52-C56 VanDerWaalsContact O-SG 3.41Å; D53-C56 WeakPolarHBondContact O-CB 3.34Å; D53-C56 PolarHBondContact O-N 2.95Å; C56-G60 PolarHBondContact O-N 3.24Å
57	E	98.7	Very high	98.7	Very high	142 Å²	142	92.3 Å²	92.3	66%	0.664	51%	0.507	S	S	*	.	H	α-helix	trans	-61.6	-46.8	175.2	-72.7	-173.4	167.7	0	0	111.8	D53 Y54 G60 A61	D53-E57 WeakPolarHBondContact O-CG 3.35Å; D53-E57 PolarHBondContact O-N 2.7Å; Y54-E57 PolarHBondContact O-N 2.84Å; E57-G60 PolarHBondContact O-N 3.18Å; E57-A61 WeakPolarHBondContact O-CB 3.36Å; E57-A61 PolarHBondContact O-N 3.39Å
58	T	98.8	Very high	98.7	Very high	65 Å²	65	92 Å²	92	40%	0.399	51%	0.505	S	S	.	.	H	α-helix	trans	-61.7	-46.7	179.4	-60.8	0	0	0	0	111.3	Y54 A55 A61 C62	Y54-T58 WeakPolarHBondContact O-CB 3.27Å; Y54-T58 PolarHBondContact O-N 2.95Å; Y54-T58 PolarHBondContact O-OG1 3.01Å; A55-T58 PolarHBondContact O-N 2.89Å; T58-A61 PolarHBondContact O-N 3.38Å; T58-C62 WeakPolarHBondContact O-CB 3.39Å; T58-C62 PolarHBondContact O-N 3.38Å
59	V	98.8	Very high	98.7	Very high	83 Å²	83	90 Å²	90	50%	0.503	50%	0.5	S	S	.	.	H	α-helix	trans	-64.6	-42.2	176.8	170.7	0	0	0	0	110.7	A55 A61 C62 I63	A55-V59 WeakPolarHBondContact O-CB 3.29Å; A55-V59 VanDerWaalsContact O-CG2 3.27Å; A55-V59 WeakPolarHBondContact O-CG2 3.46Å; A55-V59 PolarHBondContact O-N 2.87Å; V59-A61 VanDerWaalsContact C-N 3.33Å; V59-A61 PolarHBondContact O-N 3.09Å; V59-C62 WeakPolarHBondContact O-CB 3.45Å; V59-C62 PolarHBondContact O-N 3.45Å; V59-I63 HydrophobicContact CG1-CD1 3.95Å; V59-I63 HydrophobicContact CG1-CG1 4.45Å; V59-I63 WeakPolarHBondContact O-CG1 3.36Å; V59-I63 PolarHBondContact O-N 2.92Å
60	G	98.7	Very high	98.7	Very high	26 Å²	26	91.6 Å²	91.6	27%	0.268	51%	0.507	S	S	.	.	H	α-helix	trans	-59.4	-41.5	175.3	0	0	0	0	0	112.9	C56 E57 K64	C56-G60 PolarHBondContact O-N 3.24Å; E57-G60 PolarHBondContact O-N 3.18Å; G60-K64 WeakPolarHBondContact O-CG 3.44Å; G60-K64 PolarHBondContact O-N 3.28Å
61	A	98.8	Very high	98.7	Very high	51 Å²	51	89.8 Å²	89.8	42%	0.421	51%	0.505	S	S	.	.	H	α-helix	trans	-66.9	-38.9	174.5	0	0	0	0	0	112.3	E57 T58 V59 K64 S65	E57-A61 WeakPolarHBondContact O-CB 3.36Å; E57-A61 PolarHBondContact O-N 3.39Å; T58-A61 PolarHBondContact O-N 3.38Å; V59-A61 VanDerWaalsContact C-N 3.33Å; V59-A61 PolarHBondContact O-N 3.09Å; A61-K64 PolarHBondContact O-N 3.17Å; A61-S65 WeakPolarHBondContact O-CB 3.4Å; A61-S65 PolarHBondContact O-N 2.84Å; A61-S65 PolarHBondContact O-OG 2.97Å
62	C	98.6	Very high	98.7	Very high	76 Å²	76	92.8 Å²	92.8	51%	0.514	51%	0.51	S	S	.	.	H	α-helix	trans	-61	-49.7	175.5	-173.9	0	0	0	0	111	T58 V59 K64 S65 T66	T58-C62 WeakPolarHBondContact O-CB 3.39Å; T58-C62 PolarHBondContact O-N 3.38Å; V59-C62 WeakPolarHBondContact O-CB 3.45Å; V59-C62 PolarHBondContact O-N 3.45Å; C62-K64 PolarHBondContact O-N 2.93Å; C62-S65 CarbonylContact O-C 3.59Å; C62-S65 WeakPolarHBondContact O-CB 3.43Å; C62-S65 PolarHBondContact O-N 3.42Å; C62-S65 VanDerWaalsContact O-N 3.09Å; C62-T66 PolarHBondContact O-N 3.32Å; C62-T66 PolarHBondContact O-OG1 3.3Å; C62-T66 VanDerWaalsContact O-OG1 3.07Å
63	I	98.8	Very high	98.7	Very high	87 Å²	87	93.3 Å²	93.3	45%	0.446	52%	0.515	S	S	.	.	H	α-helix	trans	-56.4	-49	177.7	-68.7	166.7	0	0	0	111	V59 S65 T66 Y67	V59-I63 HydrophobicContact CG1-CD1 3.95Å; V59-I63 HydrophobicContact CG1-CG1 4.45Å; V59-I63 WeakPolarHBondContact O-CG1 3.36Å; V59-I63 PolarHBondContact O-N 2.92Å; I63-S65 VanDerWaalsContact C-N 3.3Å; I63-S65 PolarHBondContact O-N 3.33Å; I63-T66 WeakPolarHBondContact O-CB 3.28Å; I63-T66 PolarHBondContact O-N 3.06Å; I63-Y67 HydrophobicContact CG2-CD2 3.8Å; I63-Y67 HydrophobicContact CG2-CE2 3.62Å; I63-Y67 VanDerWaalsContact O-CD2 3.28Å; I63-Y67 WeakPolarHBondContact O-CD2 3.42Å; I63-Y67 PolarHBondContact O-N 3.02Å
64	K	98.7	Very high	98.7	Very high	154 Å²	154	94.9 Å²	94.9	67%	0.67	52%	0.52	S	S	*	.	H	α-helix	trans	-57.2	-45.1	176.8	-70.8	172.4	-173	174.9	0	111.4	G60 A61 C62 T66 Y67 V68	G60-K64 WeakPolarHBondContact O-CG 3.44Å; G60-K64 PolarHBondContact O-N 3.28Å; A61-K64 PolarHBondContact O-N 3.17Å; C62-K64 PolarHBondContact O-N 2.93Å; K64-T66 VanDerWaalsContact C-N 3.35Å; K64-T66 PolarHBondContact O-N 3.04Å; K64-Y67 PolarHBondContact O-N 3.49Å; K64-V68 WeakPolarHBondContact O-CG2 3.45Å; K64-V68 PolarHBondContact O-N 3.07Å
65	S	98.8	Very high	98.7	Very high	75 Å²	75	93.5 Å²	93.5	52%	0.524	52%	0.519	S	S	.	.	H	α-helix	trans	-63.6	-39.6	178.2	-58.1	0	0	0	0	112.1	A61 C62 I63 V68 L69	A61-S65 WeakPolarHBondContact O-CB 3.4Å; A61-S65 PolarHBondContact O-N 2.84Å; A61-S65 PolarHBondContact O-OG 2.97Å; C62-S65 CarbonylContact O-C 3.59Å; C62-S65 WeakPolarHBondContact O-CB 3.43Å; C62-S65 PolarHBondContact O-N 3.42Å; C62-S65 VanDerWaalsContact O-N 3.09Å; I63-S65 VanDerWaalsContact C-N 3.3Å; I63-S65 PolarHBondContact O-N 3.33Å; S65-V68 PolarHBondContact O-N 3.01Å; S65-L69 WeakPolarHBondContact O-CB 3.48Å; S65-L69 PolarHBondContact O-N 2.94Å
66	T	98.8	Very high	98.7	Very high	83 Å²	83	95.8 Å²	95.8	51%	0.509	52%	0.524	S	S	.	.	H	α-helix	trans	-62.7	-42	175.2	-57.8	0	0	0	0	111.8	C62 I63 K64 L69 M70	C62-T66 PolarHBondContact O-N 3.32Å; C62-T66 PolarHBondContact O-OG1 3.3Å; C62-T66 VanDerWaalsContact O-OG1 3.07Å; I63-T66 WeakPolarHBondContact O-CB 3.28Å; I63-T66 PolarHBondContact O-N 3.06Å; K64-T66 VanDerWaalsContact C-N 3.35Å; K64-T66 PolarHBondContact O-N 3.04Å; T66-L69 PolarHBondContact O-N 3.31Å; T66-M70 WeakPolarHBondContact O-CB 3.44Å; T66-M70 PolarHBondContact O-N 3.47Å
67	Y	98.7	Very high	98.7	Very high	163 Å²	163	95.8 Å²	95.8	64%	0.639	53%	0.525	S	S	*	.	H	α-helix	trans	-64.4	-40.5	175	-82.6	-69.4	0	0	0	112.6	I63 K64 L69 M70 A71	I63-Y67 HydrophobicContact CG2-CD2 3.8Å; I63-Y67 HydrophobicContact CG2-CE2 3.62Å; I63-Y67 VanDerWaalsContact O-CD2 3.28Å; I63-Y67 WeakPolarHBondContact O-CD2 3.42Å; I63-Y67 PolarHBondContact O-N 3.02Å; K64-Y67 PolarHBondContact O-N 3.49Å; Y67-L69 VanDerWaalsContact C-N 3.35Å; Y67-M70 WeakPolarHBondContact O-CB 3.49Å; Y67-M70 PolarHBondContact O-N 3.19Å; Y67-A71 PolarHBondContact O-N 2.83Å
68	V	98.8	Very high	98.6	Very high	85 Å²	85	96.9 Å²	96.9	52%	0.515	52%	0.523	S	S	.	.	H	α-helix	trans	-62.4	-44	173.9	171.7	0	0	0	0	110.9	K64 S65 M70 A71 K72	K64-V68 WeakPolarHBondContact O-CG2 3.45Å; K64-V68 PolarHBondContact O-N 3.07Å; S65-V68 PolarHBondContact O-N 3.01Å; V68-M70 VanDerWaalsContact C-N 3.32Å; V68-M70 PolarHBondContact O-N 3.46Å; V68-A71 PolarHBondContact O-N 3.47Å; V68-K72 WeakPolarHBondContact O-CG 3.29Å; V68-K72 PolarHBondContact O-N 2.88Å
69	L	98.8	Very high	98.5	Very high	105 Å²	105	96.7 Å²	96.7	55%	0.55	52%	0.524	S	S	.	.	H	α-helix	trans	-60.5	-43.3	176.2	179.8	62.9	0	0	0	111.3	S65 T66 Y67 A71 K72 C73	S65-L69 WeakPolarHBondContact O-CB 3.48Å; S65-L69 PolarHBondContact O-N 2.94Å; T66-L69 PolarHBondContact O-N 3.31Å; Y67-L69 VanDerWaalsContact C-N 3.35Å; L69-A71 PolarHBondContact O-N 2.88Å; L69-K72 PolarHBondContact O-N 2.87Å; L69-C73 PolarHBondContact O-N 3.37Å; L69-C73 PolarHBondContact O-SG 3.21Å; L69-C73 VanDerWaalsContact O-SG 3.37Å
70	M	98.7	Very high	98.5	Very high	133 Å²	133	97.7 Å²	97.7	66%	0.655	53%	0.525	S	S	*	.	H	α-helix	trans	-58.7	-46.3	177.4	-169.9	173.5	-155.6	0	0	111.7	T66 Y67 V68 K72 C73 E74	T66-M70 WeakPolarHBondContact O-CB 3.44Å; T66-M70 PolarHBondContact O-N 3.47Å; Y67-M70 WeakPolarHBondContact O-CB 3.49Å; Y67-M70 PolarHBondContact O-N 3.19Å; V68-M70 VanDerWaalsContact C-N 3.32Å; V68-M70 PolarHBondContact O-N 3.46Å; M70-K72 PolarHBondContact O-N 3.33Å; M70-C73 PolarHBondContact O-N 3.02Å; M70-E74 PolarHBondContact O-N 3.24Å
71	A	98.8	Very high	98.4	Very high	57 Å²	57	100 Å²	100	47%	0.471	54%	0.537	S	S	.	.	H	α-helix	trans	-61.5	-42.5	175.9	0	0	0	0	0	112.1	Y67 V68 L69 C73 E74 E75	Y67-A71 PolarHBondContact O-N 2.83Å; V68-A71 PolarHBondContact O-N 3.47Å; L69-A71 PolarHBondContact O-N 2.88Å; A71-C73 VanDerWaalsContact C-N 3.34Å; A71-C73 PolarHBondContact O-N 3.46Å; A71-E74 WeakPolarHBondContact O-CB 3.49Å; A71-E74 PolarHBondContact O-N 3.31Å; A71-E75 PolarHBondContact O-N 2.87Å
72	K	98.7	Very high	98.3	Very high	129 Å²	129	104.2 Å²	104.2	56%	0.561	55%	0.548	S	S	*	.	H	α-helix	trans	-63.8	-37.8	175.5	-73.5	-170.9	174.7	-140.9	0	112.7	V68 L69 M70 E74 E75 L76	V68-K72 WeakPolarHBondContact O-CG 3.29Å; V68-K72 PolarHBondContact O-N 2.88Å; L69-K72 PolarHBondContact O-N 2.87Å; M70-K72 PolarHBondContact O-N 3.33Å; K72-E74 VanDerWaalsContact C-N 3.33Å; K72-E75 PolarHBondContact O-N 3.43Å; K72-L76 VanDerWaalsContact O-CB 3.29Å; K72-L76 WeakPolarHBondContact O-CB 3.44Å; K72-L76 PolarHBondContact O-N 3.21Å
73	C	98.7	Very high	98.2	Very high	70 Å²	70	105.1 Å²	105.1	47%	0.473	55%	0.547	S	S	.	.	H	α-helix	trans	-65.2	-37.7	174.4	-72.6	0	0	0	0	111.7	L69 M70 A71 S77	L69-C73 PolarHBondContact O-N 3.37Å; L69-C73 PolarHBondContact O-SG 3.21Å; L69-C73 VanDerWaalsContact O-SG 3.37Å; M70-C73 PolarHBondContact O-N 3.02Å; A71-C73 VanDerWaalsContact C-N 3.34Å; A71-C73 PolarHBondContact O-N 3.46Å; C73-S77 WeakPolarHBondContact O-CB 3.48Å; C73-S77 PolarHBondContact O-N 3.47Å
74	E	98.5	Very high	98.1	Very high	116 Å²	116	106.1 Å²	106.1	54%	0.542	55%	0.55	S	S	.	.	H	α-helix	trans	-65.6	-45.4	174.2	-167.5	-172.2	150.6	0	0	111.7	M70 A71 K72 L76 S77 R78	M70-E74 PolarHBondContact O-N 3.24Å; A71-E74 WeakPolarHBondContact O-CB 3.49Å; A71-E74 PolarHBondContact O-N 3.31Å; K72-E74 VanDerWaalsContact C-N 3.33Å; E74-L76 VanDerWaalsContact C-N 3.34Å; E74-L76 PolarHBondContact O-N 3.26Å; E74-S77 PolarHBondContact O-N 3.38Å; E74-R78 WeakPolarHBondContact O-CB 3.43Å; E74-R78 PolarHBondContact O-N 3.18Å; E74-R78 IonicContact OE1-NH2 3.25Å; E74-R78 PolarHBondContact OE1-NH2 3.28Å
75	E	98.5	Very high	98	Very high	132 Å²	132	102.1 Å²	102.1	62%	0.617	54%	0.539	S	S	*	.	H	α-helix	trans	-59.7	-44	175.3	-175.3	-179.1	-171.9	0	0	111.9	A71 K72 R78 S79	A71-E75 PolarHBondContact O-N 2.87Å; K72-E75 PolarHBondContact O-N 3.43Å; E75-R78 PolarHBondContact O-N 3.2Å; E75-S79 WeakPolarHBondContact O-CB 3.49Å; E75-S79 PolarHBondContact O-N 3.41Å; E75-S79 PolarHBondContact O-OG 2.92Å
76	L	98.5	Very high	98	Very high	97 Å²	97	102.4 Å²	102.4	51%	0.508	54%	0.535	S	S	.	.	H	α-helix	trans	-62	-46.4	175.2	178.9	61.7	0	0	0	111.3	K72 E74 R78 S79 M80	K72-L76 VanDerWaalsContact O-CB 3.29Å; K72-L76 WeakPolarHBondContact O-CB 3.44Å; K72-L76 PolarHBondContact O-N 3.21Å; E74-L76 VanDerWaalsContact C-N 3.34Å; E74-L76 PolarHBondContact O-N 3.26Å; L76-R78 VanDerWaalsContact C-N 3.31Å; L76-R78 PolarHBondContact O-N 2.85Å; L76-S79 PolarHBondContact O-N 3.02Å; L76-M80 HydrophobicContact CD1-CE 3.73Å; L76-M80 HydrophobicContact CD1-CG 4.13Å; L76-M80 HydrophobicContact CG-CG 4.37Å; L76-M80 WeakPolarHBondContact O-CB 3.35Å; L76-M80 VanDerWaalsContact O-CG 3.25Å; L76-M80 WeakPolarHBondContact O-CG 3.25Å; L76-M80 PolarHBondContact O-N 2.9Å
77	S	98.3	Very high	97.9	Very high	82 Å²	82	103.4 Å²	103.4	57%	0.573	53%	0.532	S	S	*	.	H	α-helix	trans	-59	-43.6	177.6	-177.3	0	0	0	0	111.5	C73 E74 M80 S81	C73-S77 WeakPolarHBondContact O-CB 3.48Å; C73-S77 PolarHBondContact O-N 3.47Å; E74-S77 PolarHBondContact O-N 3.38Å; S77-M80 PolarHBondContact O-N 2.87Å; S77-S81 PolarHBondContact O-N 2.93Å
78	R	97.4	Very high	97.9	Very high	165 Å²	165	102.1 Å²	102.1	62%	0.623	53%	0.53	S	S	*	.	H	α-helix	trans	-62.3	-44	175.4	-169	179	-58.2	-159	2.8	111.9	E74 E75 L76 S81	E74-R78 WeakPolarHBondContact O-CB 3.43Å; E74-R78 PolarHBondContact O-N 3.18Å; E74-R78 IonicContact OE1-NH2 3.25Å; E74-R78 PolarHBondContact OE1-NH2 3.28Å; E75-R78 PolarHBondContact O-N 3.2Å; L76-R78 VanDerWaalsContact C-N 3.31Å; L76-R78 PolarHBondContact O-N 2.85Å; R78-S81 WeakPolarHBondContact O-CB 3.33Å; R78-S81 PolarHBondContact O-N 2.62Å; R78-S81 PolarHBondContact O-OG 3.11Å
79	S	97.4	Very high	97.9	Very high	61 Å²	61	104.2 Å²	104.2	43%	0.427	53%	0.534	S	S	.	.	H	α-helix	trans	-63.2	-43.3	176.9	-57	0	0	0	0	111.3	E75 L76 S81 Q82	E75-S79 WeakPolarHBondContact O-CB 3.49Å; E75-S79 PolarHBondContact O-N 3.41Å; E75-S79 PolarHBondContact O-OG 2.92Å; L76-S79 PolarHBondContact O-N 3.02Å; S79-S81 VanDerWaalsContact C-N 3.26Å; S79-S81 PolarHBondContact O-N 3.32Å; S79-Q82 WeakPolarHBondContact O-CB 3.42Å; S79-Q82 WeakPolarHBondContact O-CG 3.3Å; S79-Q82 PolarHBondContact O-N 3.32Å; S79-Q82 VanDerWaalsContact O-N 3.16Å
80	M	97.8	Very high	97.8	Very high	104 Å²	104	104 Å²	104	51%	0.512	53%	0.532	S	S	.	.	H	α-helix	trans	-65.6	-26.5	177.9	-71.1	-68.4	167.9	0	0	113.1	L76 S77 Q82 L83	L76-M80 HydrophobicContact CD1-CE 3.73Å; L76-M80 HydrophobicContact CD1-CG 4.13Å; L76-M80 HydrophobicContact CG-CG 4.37Å; L76-M80 WeakPolarHBondContact O-CB 3.35Å; L76-M80 VanDerWaalsContact O-CG 3.25Å; L76-M80 WeakPolarHBondContact O-CG 3.25Å; L76-M80 PolarHBondContact O-N 2.9Å; S77-M80 PolarHBondContact O-N 2.87Å; M80-Q82 PolarHBondContact O-N 3.01Å; M80-Q82 VanDerWaalsContact O-N 3.11Å; M80-L83 VanDerWaalsContact O-CB 3.3Å; M80-L83 WeakPolarHBondContact O-CB 3.42Å; M80-L83 WeakPolarHBondContact O-CG 3.47Å; M80-L83 PolarHBondContact O-N 3.16Å; M80-L83 HydrophobicContact SD-CD1 3.52Å; M80-L83 VanDerWaalsContact SD-CD1 3.52Å; M80-L83 HydrophobicContact SD-CG 4.41Å
81	S	97.2	Very high	97.8	Very high	74 Å²	74	101.6 Å²	101.6	52%	0.517	52%	0.52	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.4	-20.2	174.8	78.9	0	0	0	0	113.6	S77 R78 S79 L83 P85	S77-S81 PolarHBondContact O-N 2.93Å; R78-S81 WeakPolarHBondContact O-CB 3.33Å; R78-S81 PolarHBondContact O-N 2.62Å; R78-S81 PolarHBondContact O-OG 3.11Å; S79-S81 VanDerWaalsContact C-N 3.26Å; S79-S81 PolarHBondContact O-N 3.32Å; S81-L83 PolarHBondContact O-N 3.4Å; S81-P85 VanDerWaalsContact O-CD 3.31Å; S81-P85 WeakPolarHBondContact O-CD 3.31Å
82	Q	95.5	Very high	97.8	Very high	140 Å²	140	99.8 Å²	99.8	65%	0.654	51%	0.507	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.4	-13.5	175.7	-58.5	-175.6	-36.8	0	0	113.4	S79 M80 P85 L86	S79-Q82 WeakPolarHBondContact O-CB 3.42Å; S79-Q82 WeakPolarHBondContact O-CG 3.3Å; S79-Q82 PolarHBondContact O-N 3.32Å; S79-Q82 VanDerWaalsContact O-N 3.16Å; M80-Q82 PolarHBondContact O-N 3.01Å; M80-Q82 VanDerWaalsContact O-N 3.11Å; Q82-P85 WeakPolarHBondContact O-CD 3.5Å; Q82-L86 PolarHBondContact O-N 2.87Å
83	L	97.3	Very high	97.8	Very high	96 Å²	96	99.6 Å²	99.6	50%	0.503	51%	0.511	S	S	.	.	H	α-helix	trans	-68.8	-32.7	178.3	-68.2	177	0	0	0	112.9	M80 S81 L86 K87	M80-L83 VanDerWaalsContact O-CB 3.3Å; M80-L83 WeakPolarHBondContact O-CB 3.42Å; M80-L83 WeakPolarHBondContact O-CG 3.47Å; M80-L83 PolarHBondContact O-N 3.16Å; M80-L83 HydrophobicContact SD-CD1 3.52Å; M80-L83 VanDerWaalsContact SD-CD1 3.52Å; M80-L83 HydrophobicContact SD-CG 4.41Å; S81-L83 PolarHBondContact O-N 3.4Å; L83-L86 HydrophobicContact CD2-CD2 4.48Å; L83-L86 PolarHBondContact O-N 3.01Å; L83-K87 WeakPolarHBondContact O-CB 3.41Å; L83-K87 PolarHBondContact O-N 3.15Å
84	E	96.8	Very high	97.7	Very high	107 Å²	107	103 Å²	103	50%	0.5	52%	0.517	S	S	.	.	H	α-helix	trans	-66.9	-47.2	179.9	-79	-62.2	136.3	0	0	112.9	K87 K88	E84-K87 PolarHBondContact O-N 3.32Å; E84-K88 WeakPolarHBondContact O-CG 3.39Å; E84-K88 PolarHBondContact O-N 3.39Å; E84-K88 VanDerWaalsContact O-N 3.15Å
85	P	97.2	Very high	97.7	Very high	70 Å²	70	104.2 Å²	104.2	46%	0.455	52%	0.517	S	S	.	.	H	α-helix	trans	-56	-47.2	168.7	-26.6	33.6	0	0	0	113.2	S81 Q82 K87 K88 E89	S81-P85 VanDerWaalsContact O-CD 3.31Å; S81-P85 WeakPolarHBondContact O-CD 3.31Å; Q82-P85 WeakPolarHBondContact O-CD 3.5Å; P85-K87 VanDerWaalsContact C-N 3.31Å; P85-K87 PolarHBondContact O-N 3.03Å; P85-K88 WeakPolarHBondContact O-CB 3.42Å; P85-K88 PolarHBondContact O-N 3.26Å; P85-E89 PolarHBondContact O-N 3.42Å
86	L	97.5	Very high	97.7	Very high	82 Å²	82	102.3 Å²	102.3	43%	0.429	52%	0.515	S	S	.	.	H	α-helix	trans	-59.2	-42.8	179.6	-179.5	62.9	0	0	0	111.8	Q82 L83 K88 E89 I90	Q82-L86 PolarHBondContact O-N 2.87Å; L83-L86 HydrophobicContact CD2-CD2 4.48Å; L83-L86 PolarHBondContact O-N 3.01Å; L86-K88 VanDerWaalsContact C-N 3.33Å; L86-K88 PolarHBondContact O-N 3.05Å; L86-E89 WeakPolarHBondContact O-CB 3.36Å; L86-E89 PolarHBondContact O-N 3.36Å; L86-I90 HydrophobicContact CD1-CD1 4.44Å; L86-I90 HydrophobicContact CG-CD1 4.15Å; L86-I90 WeakPolarHBondContact O-CG1 3.36Å; L86-I90 PolarHBondContact O-N 3.41Å
87	K	97.7	Very high	97.6	Very high	103 Å²	103	102.2 Å²	102.2	45%	0.448	51%	0.514	S	S	.	.	H	α-helix	trans	-57	-45.5	173.6	175.4	-175.4	169.8	-171.5	0	111.6	L83 E84 P85 E89 I90 E91	L83-K87 WeakPolarHBondContact O-CB 3.41Å; L83-K87 PolarHBondContact O-N 3.15Å; E84-K87 PolarHBondContact O-N 3.32Å; P85-K87 VanDerWaalsContact C-N 3.31Å; P85-K87 PolarHBondContact O-N 3.03Å; K87-E89 VanDerWaalsContact C-N 3.33Å; K87-E89 PolarHBondContact O-N 2.91Å; K87-I90 PolarHBondContact O-N 2.92Å; K87-E91 WeakPolarHBondContact CE-OE1 3.42Å; K87-E91 WeakPolarHBondContact O-CG 3.48Å; K87-E91 PolarHBondContact O-N 2.94Å
88	K	98.2	Very high	97.6	Very high	136 Å²	136	102 Å²	102	59%	0.591	51%	0.507	S	S	*	.	H	α-helix	trans	-63.6	-38	178.9	-71	176.1	-178.1	176.7	0	112.4	E84 P85 L86 G92	E84-K88 WeakPolarHBondContact O-CG 3.39Å; E84-K88 PolarHBondContact O-N 3.39Å; E84-K88 VanDerWaalsContact O-N 3.15Å; P85-K88 WeakPolarHBondContact O-CB 3.42Å; P85-K88 PolarHBondContact O-N 3.26Å; L86-K88 VanDerWaalsContact C-N 3.33Å; L86-K88 PolarHBondContact O-N 3.05Å; K88-G92 PolarHBondContact O-N 3.49Å
89	E	97.9	Very high	97.5	Very high	129 Å²	129	101.1 Å²	101.1	60%	0.603	51%	0.508	S	S	*	.	H	α-helix	trans	-62.5	-47.4	174.7	-70.4	177.3	-170.6	0	0	111.1	P85 L86 K87 E91 G92 L93	P85-E89 PolarHBondContact O-N 3.42Å; L86-E89 WeakPolarHBondContact O-CB 3.36Å; L86-E89 PolarHBondContact O-N 3.36Å; K87-E89 VanDerWaalsContact C-N 3.33Å; K87-E89 PolarHBondContact O-N 2.91Å; E89-E91 PolarHBondContact O-N 3.23Å; E89-G92 WeakPolarHBondContact O-CA 3.14Å; E89-G92 PolarHBondContact O-N 3.29Å; E89-G92 VanDerWaalsContact O-N 3.11Å; E89-L93 PolarHBondContact O-N 3.11Å
90	I	98.2	Very high	97.4	Very high	100 Å²	100	104.6 Å²	104.6	51%	0.513	52%	0.515	S	S	.	.	H	α-helix	trans	-61.3	-45.8	177.1	-66.1	167.3	0	0	0	111.2	L86 K87 G92 L93 K94	L86-I90 HydrophobicContact CD1-CD1 4.44Å; L86-I90 HydrophobicContact CG-CD1 4.15Å; L86-I90 WeakPolarHBondContact O-CG1 3.36Å; L86-I90 PolarHBondContact O-N 3.41Å; K87-I90 PolarHBondContact O-N 2.92Å; I90-G92 PolarHBondContact O-N 3.37Å; I90-L93 PolarHBondContact O-N 3.45Å; I90-K94 PolarHBondContact O-N 2.9Å
91	E	98.4	Very high	97.2	Very high	84 Å²	84	104.3 Å²	104.3	39%	0.393	51%	0.513	S	S	.	.	H	α-helix	trans	-61.8	-35.5	175.3	-72.7	177.6	177	0	0	111.9	K87 E89 K94 R95	K87-E91 WeakPolarHBondContact CE-OE1 3.42Å; K87-E91 WeakPolarHBondContact O-CG 3.48Å; K87-E91 PolarHBondContact O-N 2.94Å; E89-E91 PolarHBondContact O-N 3.23Å; E91-K94 PolarHBondContact O-N 2.88Å; E91-R95 WeakPolarHBondContact O-CG 3.44Å; E91-R95 PolarHBondContact O-N 3.47Å
92	G	98.2	Very high	97.1	Very high	19 Å²	19	107.4 Å²	107.4	20%	0.196	52%	0.519	C	S	.	.	H	α-helix	trans	-60.6	-49.5	172	0	0	0	0	0	112.5	K88 E89 I90 K94 R95 T96	K88-G92 PolarHBondContact O-N 3.49Å; E89-G92 WeakPolarHBondContact O-CA 3.14Å; E89-G92 PolarHBondContact O-N 3.29Å; E89-G92 VanDerWaalsContact O-N 3.11Å; I90-G92 PolarHBondContact O-N 3.37Å; G92-K94 PolarHBondContact O-N 3.19Å; G92-R95 PolarHBondContact O-N 3.13Å; G92-T96 PolarHBondContact O-N 3.5Å; G92-T96 VanDerWaalsContact O-N 3.09Å; G92-T96 PolarHBondContact O-OG1 2.96Å
93	L	98.2	Very high	97	Very high	125 Å²	125	104.1 Å²	104.1	65%	0.654	52%	0.516	S	S	*	.	H	α-helix	trans	-60	-44.2	176.2	-70.2	173.9	0	0	0	111.8	E89 I90 R95 T96 L97	E89-L93 PolarHBondContact O-N 3.11Å; I90-L93 PolarHBondContact O-N 3.45Å; L93-R95 PolarHBondContact O-N 3.09Å; L93-T96 WeakPolarHBondContact O-CB 3.4Å; L93-T96 PolarHBondContact O-N 3.27Å; L93-T96 VanDerWaalsContact O-N 3.13Å; L93-L97 PolarHBondContact O-N 3.41Å
94	K	98.1	Very high	96.7	Very high	140 Å²	140	105.6 Å²	105.6	61%	0.609	52%	0.523	S	S	*	.	H	α-helix	trans	-60.3	-43.4	177	-174.6	172.5	-177.4	175.3	0	112.1	I90 E91 G92 T96 L97 N98	I90-K94 PolarHBondContact O-N 2.9Å; E91-K94 PolarHBondContact O-N 2.88Å; G92-K94 PolarHBondContact O-N 3.19Å; K94-T96 VanDerWaalsContact C-N 3.28Å; K94-T96 PolarHBondContact O-N 3.27Å; K94-L97 PolarHBondContact O-N 3.28Å; K94-N98 VanDerWaalsContact O-CG 3.31Å; K94-N98 PolarHBondContact O-N 3.44Å; K94-N98 PolarHBondContact O-OD1 3.28Å
95	R	98	Very high	96.2	Very high	142 Å²	142	105.2 Å²	105.2	54%	0.536	53%	0.533	S	S	.	.	H	α-helix	trans	-60.6	-39.3	175	-75	-173	-62.6	-90.7	1.5	111.9	E91 G92 L93 K99	E91-R95 WeakPolarHBondContact O-CG 3.44Å; E91-R95 PolarHBondContact O-N 3.47Å; G92-R95 PolarHBondContact O-N 3.13Å; L93-R95 PolarHBondContact O-N 3.09Å; R95-K99 WeakPolarHBondContact O-CG 3.31Å; R95-K99 PolarHBondContact O-N 3.03Å
96	T	97.3	Very high	95.4	Very high	93 Å²	93	106 Å²	106	57%	0.571	54%	0.536	S	S	*	.	H	α-helix	trans	-66.9	-42.2	176.3	-58.7	0	0	0	0	111.8	G92 L93 K94 K99 F100	G92-T96 PolarHBondContact O-N 3.5Å; G92-T96 VanDerWaalsContact O-N 3.09Å; G92-T96 PolarHBondContact O-OG1 2.96Å; L93-T96 WeakPolarHBondContact O-CB 3.4Å; L93-T96 PolarHBondContact O-N 3.27Å; L93-T96 VanDerWaalsContact O-N 3.13Å; K94-T96 VanDerWaalsContact C-N 3.28Å; K94-T96 PolarHBondContact O-N 3.27Å; T96-K99 PolarHBondContact O-N 3.17Å; T96-F100 PolarHBondContact O-N 2.95Å; T96-F100 VanDerWaalsContact O-N 3.15Å
97	L	97.5	Very high	94	Very high	94 Å²	94	107.5 Å²	107.5	49%	0.492	55%	0.551	S	S	.	*	H	α-helix	trans	-60.9	-47.5	176	-178.7	63.4	0	0	0	111.7	L93 K94 K99 F100 E101	L93-L97 PolarHBondContact O-N 3.41Å; K94-L97 PolarHBondContact O-N 3.28Å; L97-K99 VanDerWaalsContact C-N 3.27Å; L97-K99 PolarHBondContact O-N 3.27Å; L97-F100 WeakPolarHBondContact O-CA 3.43Å; L97-F100 VanDerWaalsContact O-CB 3.31Å; L97-F100 WeakPolarHBondContact O-CB 3.46Å; L97-F100 PolarHBondContact O-N 3.35Å; L97-E101 PolarHBondContact O-N 3.46Å
98	N	97	Very high	92.4	Very high	79 Å²	79	111 Å²	111	42%	0.422	57%	0.573	S	S	.	*	H	α-helix	trans	-57.2	-40.5	178.1	-69.9	2.1	0	0	0	112.2	K94 F100 E101 E102	K94-N98 VanDerWaalsContact O-CG 3.31Å; K94-N98 PolarHBondContact O-N 3.44Å; K94-N98 PolarHBondContact O-OD1 3.28Å; N98-F100 VanDerWaalsContact C-N 3.3Å; N98-F100 PolarHBondContact O-N 2.91Å; N98-E101 PolarHBondContact O-N 2.96Å; N98-E102 WeakPolarHBondContact O-CB 3.4Å; N98-E102 PolarHBondContact O-N 3.15Å
99	K	96	Very high	90.2	Very high	146 Å²	146	117.7 Å²	117.7	64%	0.635	60%	0.603	S	S	*	*	H	α-helix	trans	-63.4	-37.3	175.4	-71.4	175	178.9	-176.6	0	112.1	R95 T96 L97 A103	R95-K99 WeakPolarHBondContact O-CG 3.31Å; R95-K99 PolarHBondContact O-N 3.03Å; T96-K99 PolarHBondContact O-N 3.17Å; L97-K99 VanDerWaalsContact C-N 3.27Å; L97-K99 PolarHBondContact O-N 3.27Å; K99-A103 PolarHBondContact O-N 3.33Å
100	F	95.1	Very high	89.9	Confident	133 Å²	133	117.2 Å²	117.2	58%	0.583	60%	0.603	S	S	*	*	H	α-helix	trans	-68.1	-42.3	176.5	-161.9	-97.3	0	0	0	111.3	T96 L97 N98 A103 L104	T96-F100 PolarHBondContact O-N 2.95Å; T96-F100 VanDerWaalsContact O-N 3.15Å; L97-F100 WeakPolarHBondContact O-CA 3.43Å; L97-F100 VanDerWaalsContact O-CB 3.31Å; L97-F100 WeakPolarHBondContact O-CB 3.46Å; L97-F100 PolarHBondContact O-N 3.35Å; N98-F100 VanDerWaalsContact C-N 3.3Å; N98-F100 PolarHBondContact O-N 2.91Å; F100-A103 PolarHBondContact O-N 3.09Å; F100-L104 HydrophobicContact CD1-CD1 3.74Å; F100-L104 HydrophobicContact CD1-CG 4.37Å; F100-L104 HydrophobicContact CE1-CD1 3.63Å; F100-L104 HydrophobicContact CE1-CG 4.29Å; F100-L104 WeakPolarHBondContact O-CG 3.43Å; F100-L104 PolarHBondContact O-N 3.37Å; F100-L104 VanDerWaalsContact O-N 3.09Å
101	E	94.5	Very high	89.4	Confident	99 Å²	99	118.1 Å²	118.1	46%	0.463	61%	0.607	S	S	.	*	H	α-helix	trans	-64.1	-40.3	175.8	-70.1	176.4	174	0	0	113	L97 N98 L104 S105	L97-E101 PolarHBondContact O-N 3.46Å; N98-E101 PolarHBondContact O-N 2.96Å; E101-L104 PolarHBondContact O-N 3.28Å; E101-S105 WeakPolarHBondContact O-CB 3.4Å; E101-S105 PolarHBondContact O-N 3.39Å; E101-S105 PolarHBondContact O-OG 2.87Å
102	E	94.7	Very high	88.9	Confident	139 Å²	139	119.9 Å²	119.9	65%	0.65	62%	0.619	S	S	*	*	H	α-helix	trans	-63.1	-41.9	175.4	-175	177.6	-173.6	0	0	111.6	N98 L104 S105 T106	N98-E102 WeakPolarHBondContact O-CB 3.4Å; N98-E102 PolarHBondContact O-N 3.15Å; E102-L104 VanDerWaalsContact C-N 3.31Å; E102-L104 PolarHBondContact O-N 2.86Å; E102-S105 PolarHBondContact O-N 3.15Å; E102-T106 PolarHBondContact O-N 2.88Å; E102-T106 VanDerWaalsContact O-N 3.15Å; E102-T106 PolarHBondContact O-OG1 3.44Å
103	A	92.6	Very high	88.4	Confident	71 Å²	71	125.9 Å²	125.9	59%	0.587	64%	0.644	S	S	*	*	H	α-helix	trans	-63.9	-35.6	175.6	0	0	0	0	0	112.4	K99 F100	K99-A103 PolarHBondContact O-N 3.33Å; F100-A103 PolarHBondContact O-N 3.09Å
104	L	90.9	Very high	87.8	Confident	126 Å²	126	125.9 Å²	125.9	66%	0.66	64%	0.644	S	S	*	*	H	α-helix	trans	-77.3	-33	176.5	-71.5	173.4	0	0	0	113.6	F100 E101 E102 T106	F100-L104 HydrophobicContact CD1-CD1 3.74Å; F100-L104 HydrophobicContact CD1-CG 4.37Å; F100-L104 HydrophobicContact CE1-CD1 3.63Å; F100-L104 HydrophobicContact CE1-CG 4.29Å; F100-L104 WeakPolarHBondContact O-CG 3.43Å; F100-L104 PolarHBondContact O-N 3.37Å; F100-L104 VanDerWaalsContact O-N 3.09Å; E101-L104 PolarHBondContact O-N 3.28Å; E102-L104 VanDerWaalsContact C-N 3.31Å; E102-L104 PolarHBondContact O-N 2.86Å; L104-T106 VanDerWaalsContact C-N 3.3Å
105	S	86.5	Confident	87.1	Confident	100 Å²	100	125 Å²	125	70%	0.699	65%	0.646	S	S	*	*	H	α-helix	trans	-78.3	-17.1	179.9	-57.2	0	0	0	0	112.9	E101 E102 P107	E101-S105 WeakPolarHBondContact O-CB 3.4Å; E101-S105 PolarHBondContact O-N 3.39Å; E101-S105 PolarHBondContact O-OG 2.87Å; E102-S105 PolarHBondContact O-N 3.15Å; S105-P107 WeakPolarHBondContact O-CD 3.33Å
106	T	81.9	Confident	86.3	Confident	87 Å²	87	123.8 Å²	123.8	53%	0.534	65%	0.654	S	S	.	*	S	Bend	trans	-71	114.6	171.2	-55.9	0	0	0	0	108	E102 L104 L108	E102-T106 PolarHBondContact O-N 2.88Å; E102-T106 VanDerWaalsContact O-N 3.15Å; E102-T106 PolarHBondContact O-OG1 3.44Å; L104-T106 VanDerWaalsContact C-N 3.3Å; T106-L108 PolarHBondContact O-N 3.14Å; T106-L108 VanDerWaalsContact O-N 3.14Å
107	P	66.4	Low	85.4	Confident	112 Å²	112	126.2 Å²	126.2	73%	0.727	66%	0.66	S	S	*	*			trans	-57	124.4	-176.2	19.1	-29	0	0	0	110	S105 K109	S105-P107 WeakPolarHBondContact O-CD 3.33Å; P107-K109 PolarHBondContact O-N 3.03Å
108	L	64.5	Low	84.4	Confident	176 Å²	176	128.8 Å²	128.8	92%	0.921	67%	0.674	S	S	*	*			trans	-52.1	114	168	-72.6	165.7	0	0	0	106.6	T106	T106-L108 PolarHBondContact O-N 3.14Å; T106-L108 VanDerWaalsContact O-N 3.14Å
109	K	53.1	Low	83.3	Confident	278 Å²	278	133.4 Å²	133.4	100%	1.209	70%	0.697	S	S	*	*			trans	-52.9	0	175.3	-79.5	-176.5	175.5	176.8	0	111.3	P107	P107-K109 PolarHBondContact O-N 3.03Å

Retrieved 109 of 109 residues in 83.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).