A0A5K4FBK0_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4FBK0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 63 aa.

						>A0A5K4FBK0_SCHMA|A0A5K4FBK0
MQNSILRKNLAIRLIYYTSIKNFMITSKNLTRVATFADVIQRHSTTIFSKKSFNNNFENQFSH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67	Low	87.1	Confident	207 Å²	207	118.8 Å²	118.8	100%	1.02	60%	0.595	S	S	*	*				0	-36.7	0	-77.8	-173.7	164.3	0	0	114.2	N3 S4	M1-N3 PolarHBondContact O-N 3Å; M1-S4 PolarHBondContact O-N 3.23Å; M1-S4 PolarHBondContact O-OG 3.33Å
2	Q	77	Confident	87.9	Confident	163 Å²	163	118.3 Å²	118.3	76%	0.762	59%	0.593	S	S	*	*	H	α-helix	trans	-59.4	-37.3	-176.5	-70.8	165.2	-22.6	0	0	114.6	S4 I5 L6	Q2-S4 VanDerWaalsContact C-N 3.3Å; Q2-S4 PolarHBondContact O-N 3.3Å; Q2-I5 PolarHBondContact O-N 3.47Å; Q2-L6 PolarHBondContact O-N 3.4Å
3	N	80.2	Confident	88.5	Confident	116 Å²	116	121.2 Å²	121.2	62%	0.62	59%	0.593	S	S	*	*	H	α-helix	trans	-67	-24.6	179.6	-64.4	-12.8	0	0	0	114.5	M1 R7	M1-N3 PolarHBondContact O-N 3Å; N3-R7 PolarHBondContact O-N 2.87Å
4	S	82.8	Confident	89.1	Confident	54 Å²	54	119.6 Å²	119.6	38%	0.378	59%	0.588	S	S	.	*	H	α-helix	trans	-79.5	-32.5	178	62.6	0	0	0	0	111.5	M1 Q2 R7 K8	M1-S4 PolarHBondContact O-N 3.23Å; M1-S4 PolarHBondContact O-OG 3.33Å; Q2-S4 VanDerWaalsContact C-N 3.3Å; Q2-S4 PolarHBondContact O-N 3.3Å; S4-R7 PolarHBondContact O-N 3.3Å; S4-K8 WeakPolarHBondContact O-CG 3.38Å; S4-K8 PolarHBondContact O-N 3.29Å
5	I	91	Very high	89.6	Confident	92 Å²	92	118.9 Å²	118.9	47%	0.472	59%	0.586	S	S	.	*	H	α-helix	trans	-65	-43.8	175.1	-61	169.2	0	0	0	110.3	Q2 R7 K8 N9	Q2-I5 PolarHBondContact O-N 3.47Å; I5-R7 VanDerWaalsContact C-N 3.33Å; I5-R7 PolarHBondContact O-N 3.03Å; I5-K8 PolarHBondContact O-N 3.45Å; I5-N9 PolarHBondContact O-N 2.91Å
6	L	93	Very high	90.1	Very high	117 Å²	117	120.8 Å²	120.8	61%	0.613	59%	0.585	S	S	*	*	H	α-helix	trans	-58	-44.3	176.3	-68.5	174.9	0	0	0	112.1	Q2 N9 L10	Q2-L6 PolarHBondContact O-N 3.4Å; L6-N9 PolarHBondContact O-N 3.2Å; L6-L10 WeakPolarHBondContact O-CB 3.35Å; L6-L10 PolarHBondContact O-N 3.39Å
7	R	93.6	Very high	90.5	Very high	184 Å²	184	122.4 Å²	122.4	69%	0.694	59%	0.585	S	S	*	*	H	α-helix	trans	-64.8	-41.1	176.1	-77.3	-173	-96.7	-174.4	-8.7	112.6	N3 S4 I5 L10 A11	N3-R7 PolarHBondContact O-N 2.87Å; S4-R7 PolarHBondContact O-N 3.3Å; I5-R7 VanDerWaalsContact C-N 3.33Å; I5-R7 PolarHBondContact O-N 3.03Å; R7-L10 PolarHBondContact O-N 3.03Å; R7-A11 WeakPolarHBondContact O-CB 3.34Å; R7-A11 PolarHBondContact O-N 3.3Å
8	K	92.1	Very high	90.9	Very high	141 Å²	141	119.9 Å²	119.9	61%	0.613	58%	0.579	S	S	*	*	H	α-helix	trans	-61.5	-47.3	175.7	-74.3	178.2	178.3	-171.3	0	111.6	S4 I5 L10 A11 I12	S4-K8 WeakPolarHBondContact O-CG 3.38Å; S4-K8 PolarHBondContact O-N 3.29Å; I5-K8 PolarHBondContact O-N 3.45Å; K8-L10 VanDerWaalsContact C-N 3.33Å; K8-L10 PolarHBondContact O-N 3.39Å; K8-A11 PolarHBondContact O-N 2.95Å; K8-I12 WeakPolarHBondContact O-CG1 3.3Å; K8-I12 PolarHBondContact O-N 3.45Å
9	N	90.7	Very high	91.3	Very high	95 Å²	95	117.1 Å²	117.1	51%	0.508	57%	0.573	S	S	.	*	H	α-helix	trans	-63.3	-40.3	177.8	-75.1	-15.7	0	0	0	112	I5 L6 R13	I5-N9 PolarHBondContact O-N 2.91Å; L6-N9 PolarHBondContact O-N 3.2Å; N9-R13 WeakPolarHBondContact O-CB 3.37Å; N9-R13 PolarHBondContact O-N 2.88Å
10	L	95.2	Very high	91.6	Very high	92 Å²	92	114.2 Å²	114.2	48%	0.482	56%	0.56	S	S	.	*	H	α-helix	trans	-64.8	-44.4	176	-176.7	62.1	0	0	0	111.7	L6 R7 K8 I12 R13 L14	L6-L10 WeakPolarHBondContact O-CB 3.35Å; L6-L10 PolarHBondContact O-N 3.39Å; R7-L10 PolarHBondContact O-N 3.03Å; K8-L10 VanDerWaalsContact C-N 3.33Å; K8-L10 PolarHBondContact O-N 3.39Å; L10-I12 PolarHBondContact O-N 3.45Å; L10-R13 WeakPolarHBondContact O-CB 3.4Å; L10-R13 PolarHBondContact O-N 3.39Å; L10-L14 HydrophobicContact CD1-CD1 4.46Å; L10-L14 HydrophobicContact CD1-CG 4.38Å; L10-L14 HydrophobicContact CG-CD1 4.08Å; L10-L14 HydrophobicContact CG-CG 4.44Å; L10-L14 VanDerWaalsContact O-CG 3.3Å; L10-L14 WeakPolarHBondContact O-CG 3.31Å; L10-L14 PolarHBondContact O-N 2.93Å
11	A	95.4	Very high	91.8	Very high	46 Å²	46	115.5 Å²	115.5	38%	0.38	56%	0.562	S	S	.	*	H	α-helix	trans	-60.5	-45.2	177.9	0	0	0	0	0	111.8	R7 K8 R13 L14 I15	R7-A11 WeakPolarHBondContact O-CB 3.34Å; R7-A11 PolarHBondContact O-N 3.3Å; K8-A11 PolarHBondContact O-N 2.95Å; A11-R13 VanDerWaalsContact C-N 3.33Å; A11-R13 PolarHBondContact O-N 2.95Å; A11-L14 PolarHBondContact O-N 3.47Å; A11-I15 VanDerWaalsContact O-CG1 3.31Å; A11-I15 WeakPolarHBondContact O-CG1 3.09Å; A11-I15 PolarHBondContact O-N 3.43Å
12	I	96.8	Very high	93.2	Very high	112 Å²	112	109.8 Å²	109.8	57%	0.574	54%	0.536	S	S	*	.	H	α-helix	trans	-59.8	-44.9	175.7	-66.7	165.6	0	0	0	110.6	K8 L10 L14 I15 Y16	K8-I12 WeakPolarHBondContact O-CG1 3.3Å; K8-I12 PolarHBondContact O-N 3.45Å; L10-I12 PolarHBondContact O-N 3.45Å; I12-L14 PolarHBondContact O-N 3.44Å; I12-I15 PolarHBondContact O-N 3.03Å; I12-Y16 WeakPolarHBondContact O-CB 3.4Å; I12-Y16 PolarHBondContact O-N 3.24Å
13	R	96	Very high	94.1	Very high	156 Å²	156	108.9 Å²	108.9	59%	0.589	53%	0.53	S	S	*	.	H	α-helix	trans	-60.4	-43.1	177.1	-178.3	-179.8	-68.9	176.4	-0.4	112	N9 L10 A11 Y16 Y17	N9-R13 WeakPolarHBondContact O-CB 3.37Å; N9-R13 PolarHBondContact O-N 2.88Å; L10-R13 WeakPolarHBondContact O-CB 3.4Å; L10-R13 PolarHBondContact O-N 3.39Å; A11-R13 VanDerWaalsContact C-N 3.33Å; A11-R13 PolarHBondContact O-N 2.95Å; R13-Y16 PolarHBondContact O-N 3.33Å; R13-Y17 HydrophobicContact CG-CD2 3.69Å; R13-Y17 HydrophobicContact CG-CE2 3.33Å; R13-Y17 WeakPolarHBondContact O-CD2 3.48Å; R13-Y17 PolarHBondContact O-N 2.89Å
14	L	96.5	Very high	94.9	Very high	100 Å²	100	108.2 Å²	108.2	52%	0.524	52%	0.524	S	S	.	.	H	α-helix	trans	-66.8	-41.2	179	-71.5	171.4	0	0	0	112.6	L10 A11 I12 T18	L10-L14 HydrophobicContact CD1-CD1 4.46Å; L10-L14 HydrophobicContact CD1-CG 4.38Å; L10-L14 HydrophobicContact CG-CD1 4.08Å; L10-L14 HydrophobicContact CG-CG 4.44Å; L10-L14 VanDerWaalsContact O-CG 3.3Å; L10-L14 WeakPolarHBondContact O-CG 3.31Å; L10-L14 PolarHBondContact O-N 2.93Å; A11-L14 PolarHBondContact O-N 3.47Å; I12-L14 PolarHBondContact O-N 3.44Å; L14-T18 WeakPolarHBondContact O-CB 3.43Å; L14-T18 PolarHBondContact O-N 3.22Å; L14-T18 PolarHBondContact O-OG1 2.85Å
15	I	97	Very high	95.6	Very high	109 Å²	109	109.6 Å²	109.6	56%	0.559	53%	0.527	S	S	*	.	H	α-helix	trans	-61.7	-49.2	174.4	-67.8	164.9	0	0	0	109.3	A11 I12 Y17 T18 S19	A11-I15 VanDerWaalsContact O-CG1 3.31Å; A11-I15 WeakPolarHBondContact O-CG1 3.09Å; A11-I15 PolarHBondContact O-N 3.43Å; I12-I15 PolarHBondContact O-N 3.03Å; I15-Y17 PolarHBondContact O-N 3.13Å; I15-T18 PolarHBondContact O-N 2.86Å; I15-S19 WeakPolarHBondContact O-CB 3.34Å; I15-S19 PolarHBondContact O-N 3.35Å; I15-S19 PolarHBondContact O-OG 2.99Å; I15-S19 VanDerWaalsContact O-OG 3.13Å
16	Y	97.2	Very high	95.8	Very high	148 Å²	148	109.7 Å²	109.7	58%	0.58	53%	0.531	S	S	*	.	H	α-helix	trans	-55.4	-49.4	178.7	-179.7	-97.7	0	0	0	112.3	I12 R13 T18 S19 I20	I12-Y16 WeakPolarHBondContact O-CB 3.4Å; I12-Y16 PolarHBondContact O-N 3.24Å; R13-Y16 PolarHBondContact O-N 3.33Å; Y16-T18 PolarHBondContact O-N 3.39Å; Y16-S19 PolarHBondContact O-N 3.49Å; Y16-I20 HydrophobicContact CD1-CG1 4.34Å; Y16-I20 HydrophobicContact CE1-CG1 3.97Å; Y16-I20 HydrophobicContact CE2-CD1 4.33Å; Y16-I20 HydrophobicContact CE2-CG1 4.19Å; Y16-I20 WeakPolarHBondContact O-CG1 3.48Å; Y16-I20 PolarHBondContact O-N 3.07Å
17	Y	97.6	Very high	96	Very high	148 Å²	148	106 Å²	106	58%	0.58	52%	0.516	S	S	*	.	H	α-helix	trans	-64.1	-40.3	178.5	-76.7	-58.9	0	0	0	113.2	R13 I15 I20 K21	R13-Y17 HydrophobicContact CG-CD2 3.69Å; R13-Y17 HydrophobicContact CG-CE2 3.33Å; R13-Y17 WeakPolarHBondContact O-CD2 3.48Å; R13-Y17 PolarHBondContact O-N 2.89Å; I15-Y17 PolarHBondContact O-N 3.13Å; Y17-I20 PolarHBondContact O-N 3.34Å; Y17-K21 WeakPolarHBondContact O-CB 3.45Å; Y17-K21 PolarHBondContact O-N 3.21Å
18	T	97.2	Very high	96	Very high	78 Å²	78	103.3 Å²	103.3	48%	0.479	51%	0.509	S	S	.	.	H	α-helix	trans	-63	-45	176.1	-58.4	0	0	0	0	111	L14 I15 Y16 K21 N22	L14-T18 WeakPolarHBondContact O-CB 3.43Å; L14-T18 PolarHBondContact O-N 3.22Å; L14-T18 PolarHBondContact O-OG1 2.85Å; I15-T18 PolarHBondContact O-N 2.86Å; Y16-T18 PolarHBondContact O-N 3.39Å; T18-K21 PolarHBondContact O-N 2.88Å; T18-N22 WeakPolarHBondContact O-CB 3.34Å; T18-N22 VanDerWaalsContact O-CG 3.3Å; T18-N22 PolarHBondContact O-N 3.03Å
19	S	97.6	Very high	96	Very high	67 Å²	67	100.6 Å²	100.6	47%	0.469	50%	0.501	S	S	.	.	H	α-helix	trans	-61.9	-44.9	177.7	-66.1	0	0	0	0	112.3	I15 Y16 N22 F23	I15-S19 WeakPolarHBondContact O-CB 3.34Å; I15-S19 PolarHBondContact O-N 3.35Å; I15-S19 PolarHBondContact O-OG 2.99Å; I15-S19 VanDerWaalsContact O-OG 3.13Å; Y16-S19 PolarHBondContact O-N 3.49Å; S19-N22 PolarHBondContact O-N 2.97Å; S19-F23 WeakPolarHBondContact O-CB 3.34Å; S19-F23 PolarHBondContact O-N 3.46Å
20	I	97.6	Very high	96.2	Very high	59 Å²	59	101.9 Å²	101.9	30%	0.303	51%	0.507	S	S	.	.	H	α-helix	trans	-63.7	-42.5	176.9	-67.2	-64.7	0	0	0	111.3	Y16 Y17 N22 F23 M24	Y16-I20 HydrophobicContact CD1-CG1 4.34Å; Y16-I20 HydrophobicContact CE1-CG1 3.97Å; Y16-I20 HydrophobicContact CE2-CD1 4.33Å; Y16-I20 HydrophobicContact CE2-CG1 4.19Å; Y16-I20 WeakPolarHBondContact O-CG1 3.48Å; Y16-I20 PolarHBondContact O-N 3.07Å; Y17-I20 PolarHBondContact O-N 3.34Å; I20-N22 PolarHBondContact O-N 2.88Å; I20-F23 PolarHBondContact O-N 3.49Å; I20-M24 HydrophobicContact CG2-CE 3.93Å; I20-M24 HydrophobicContact CG2-SD 4.4Å; I20-M24 WeakPolarHBondContact O-CG 3.39Å; I20-M24 PolarHBondContact O-N 3.21Å
21	K	96.7	Very high	96.2	Very high	141 Å²	141	101.6 Å²	101.6	61%	0.613	51%	0.51	S	S	*	.	H	α-helix	trans	-60.7	-45.9	176.3	-176.5	179.3	178.2	-178.1	0	111.5	Y17 T18 M24 I25	Y17-K21 WeakPolarHBondContact O-CB 3.45Å; Y17-K21 PolarHBondContact O-N 3.21Å; T18-K21 PolarHBondContact O-N 2.88Å; K21-M24 PolarHBondContact O-N 2.92Å; K21-I25 HydrophobicContact CG-CD1 4.12Å; K21-I25 WeakPolarHBondContact O-CG1 3.48Å; K21-I25 PolarHBondContact O-N 2.94Å
22	N	95.3	Very high	96.2	Very high	88 Å²	88	107.1 Å²	107.1	47%	0.471	52%	0.521	S	S	.	.	H	α-helix	trans	-64.5	-43.2	177.7	-71.2	-11.5	0	0	0	111.4	T18 S19 I20 M24 I25 T26	T18-N22 WeakPolarHBondContact O-CB 3.34Å; T18-N22 VanDerWaalsContact O-CG 3.3Å; T18-N22 PolarHBondContact O-N 3.03Å; S19-N22 PolarHBondContact O-N 2.97Å; I20-N22 PolarHBondContact O-N 2.88Å; N22-M24 VanDerWaalsContact C-N 3.33Å; N22-M24 PolarHBondContact O-N 3.49Å; N22-I25 PolarHBondContact O-N 3.45Å; N22-T26 WeakPolarHBondContact O-CB 3.36Å; N22-T26 PolarHBondContact O-N 3.02Å; N22-T26 PolarHBondContact O-OG1 3.16Å; N22-T26 VanDerWaalsContact O-OG1 3.07Å
23	F	97.5	Very high	96.1	Very high	143 Å²	143	106.4 Å²	106.4	63%	0.627	52%	0.521	S	S	*	.	H	α-helix	trans	-57.4	-45.1	174.6	177.3	-101.8	0	0	0	111.9	S19 I20 I25 T26 S27	S19-F23 WeakPolarHBondContact O-CB 3.34Å; S19-F23 PolarHBondContact O-N 3.46Å; I20-F23 PolarHBondContact O-N 3.49Å; F23-I25 PolarHBondContact O-N 3.41Å; F23-T26 PolarHBondContact O-N 3.34Å; F23-S27 WeakPolarHBondContact O-CB 3.36Å; F23-S27 PolarHBondContact O-N 2.92Å; F23-S27 PolarHBondContact O-OG 3.34Å
24	M	96.2	Very high	96	Very high	103 Å²	103	101.6 Å²	101.6	51%	0.507	52%	0.515	S	S	.	.	H	α-helix	trans	-63.9	-37.5	176.8	-73.9	-176.5	176	0	0	113.3	I20 K21 N22 S27 K28	I20-M24 HydrophobicContact CG2-CE 3.93Å; I20-M24 HydrophobicContact CG2-SD 4.4Å; I20-M24 WeakPolarHBondContact O-CG 3.39Å; I20-M24 PolarHBondContact O-N 3.21Å; K21-M24 PolarHBondContact O-N 2.92Å; N22-M24 VanDerWaalsContact C-N 3.33Å; N22-M24 PolarHBondContact O-N 3.49Å; M24-S27 WeakPolarHBondContact CA-OG 3.47Å; M24-S27 PolarHBondContact O-OG 3.4Å; M24-K28 WeakPolarHBondContact O-CB 3.37Å; M24-K28 WeakPolarHBondContact O-CD 3.43Å; M24-K28 WeakPolarHBondContact O-CG 3.48Å; M24-K28 PolarHBondContact O-N 2.85Å; M24-K28 VanDerWaalsContact O-N 3.17Å
25	I	96.6	Very high	96	Very high	83 Å²	83	100.5 Å²	100.5	43%	0.426	51%	0.512	S	S	.	.	H	α-helix	trans	-68.9	-47.8	177.2	-68	164.5	0	0	0	110	K21 N22 F23 S27 K28 N29	K21-I25 HydrophobicContact CG-CD1 4.12Å; K21-I25 WeakPolarHBondContact O-CG1 3.48Å; K21-I25 PolarHBondContact O-N 2.94Å; N22-I25 PolarHBondContact O-N 3.45Å; F23-I25 PolarHBondContact O-N 3.41Å; I25-S27 PolarHBondContact O-N 3.25Å; I25-K28 PolarHBondContact O-N 3.06Å; I25-N29 PolarHBondContact O-N 3.24Å; I25-N29 VanDerWaalsContact O-N 3.09Å
26	T	96.1	Very high	95.9	Very high	93 Å²	93	101.9 Å²	101.9	57%	0.571	52%	0.515	S	S	*	.	H	α-helix	trans	-61.8	-44.9	179.2	-59.5	0	0	0	0	111.5	N22 F23 N29 L30	N22-T26 WeakPolarHBondContact O-CB 3.36Å; N22-T26 PolarHBondContact O-N 3.02Å; N22-T26 PolarHBondContact O-OG1 3.16Å; N22-T26 VanDerWaalsContact O-OG1 3.07Å; F23-T26 PolarHBondContact O-N 3.34Å; T26-N29 PolarHBondContact O-N 2.92Å; T26-L30 WeakPolarHBondContact O-CB 3.48Å; T26-L30 PolarHBondContact O-N 3.5Å
27	S	96.2	Very high	95.8	Very high	41 Å²	41	97.3 Å²	97.3	29%	0.287	51%	0.508	S	S	.	.	H	α-helix	trans	-65.1	-40.9	179.1	63.2	0	0	0	0	112.2	F23 M24 I25 N29 L30 T31	F23-S27 WeakPolarHBondContact O-CB 3.36Å; F23-S27 PolarHBondContact O-N 2.92Å; F23-S27 PolarHBondContact O-OG 3.34Å; M24-S27 WeakPolarHBondContact CA-OG 3.47Å; M24-S27 PolarHBondContact O-OG 3.4Å; I25-S27 PolarHBondContact O-N 3.25Å; S27-N29 VanDerWaalsContact C-N 3.33Å; S27-N29 PolarHBondContact O-N 3.27Å; S27-L30 PolarHBondContact O-N 3.39Å; S27-T31 PolarHBondContact O-N 3.3Å; S27-T31 PolarHBondContact O-OG1 2.9Å
28	K	94.5	Very high	95.7	Very high	127 Å²	127	93.7 Å²	93.7	55%	0.552	50%	0.498	S	S	*	.	H	α-helix	trans	-59.5	-41.6	173.5	-76.2	173.4	-176.1	-178.4	0	112.6	M24 I25 R32	M24-K28 WeakPolarHBondContact O-CB 3.37Å; M24-K28 WeakPolarHBondContact O-CD 3.43Å; M24-K28 WeakPolarHBondContact O-CG 3.48Å; M24-K28 PolarHBondContact O-N 2.85Å; M24-K28 VanDerWaalsContact O-N 3.17Å; I25-K28 PolarHBondContact O-N 3.06Å; K28-R32 WeakPolarHBondContact O-CG 3.42Å; K28-R32 PolarHBondContact O-N 3.06Å; K28-R32 VanDerWaalsContact O-N 3.16Å
29	N	92.6	Very high	95.5	Very high	84 Å²	84	93.6 Å²	93.6	45%	0.449	50%	0.498	S	S	.	.	H	α-helix	trans	-68	-41.4	177.1	-72.8	-9	0	0	0	111.4	I25 T26 S27 T31 R32 V33	I25-N29 PolarHBondContact O-N 3.24Å; I25-N29 VanDerWaalsContact O-N 3.09Å; T26-N29 PolarHBondContact O-N 2.92Å; S27-N29 VanDerWaalsContact C-N 3.33Å; S27-N29 PolarHBondContact O-N 3.27Å; N29-T31 PolarHBondContact O-N 3.09Å; N29-R32 PolarHBondContact O-N 3.41Å; N29-R32 PolarHBondContact OD1-NH1 3.49Å; N29-V33 WeakPolarHBondContact O-CG2 3.45Å; N29-V33 PolarHBondContact O-N 3.32Å
30	L	94.4	Very high	95.2	Very high	121 Å²	121	94.7 Å²	94.7	63%	0.634	50%	0.497	S	S	*	.	H	α-helix	trans	-61.2	-43.7	175.2	-176	63.8	0	0	0	111.7	T26 S27 R32 V33 A34	T26-L30 WeakPolarHBondContact O-CB 3.48Å; T26-L30 PolarHBondContact O-N 3.5Å; S27-L30 PolarHBondContact O-N 3.39Å; L30-R32 VanDerWaalsContact C-N 3.31Å; L30-R32 PolarHBondContact O-N 3.01Å; L30-V33 PolarHBondContact O-N 2.86Å; L30-A34 WeakPolarHBondContact O-CB 3.2Å; L30-A34 PolarHBondContact O-N 3.17Å
31	T	95.8	Very high	95	Very high	87 Å²	87	97.2 Å²	97.2	53%	0.534	51%	0.508	S	S	.	.	H	α-helix	trans	-58.9	-42.7	175.6	-56.6	0	0	0	0	111.3	S27 N29 A34 T35	S27-T31 PolarHBondContact O-N 3.3Å; S27-T31 PolarHBondContact O-OG1 2.9Å; N29-T31 PolarHBondContact O-N 3.09Å; T31-A34 PolarHBondContact O-N 2.92Å; T31-T35 PolarHBondContact O-N 3.33Å; T31-T35 PolarHBondContact O-OG1 3.4Å
32	R	95.3	Very high	94.6	Very high	162 Å²	162	96.5 Å²	96.5	61%	0.611	50%	0.501	S	S	*	.	H	α-helix	trans	-61.3	-45.7	176.2	-72.2	179.9	178.8	109.5	-0.8	112.4	K28 N29 L30 A34 T35 F36	K28-R32 WeakPolarHBondContact O-CG 3.42Å; K28-R32 PolarHBondContact O-N 3.06Å; K28-R32 VanDerWaalsContact O-N 3.16Å; N29-R32 PolarHBondContact O-N 3.41Å; N29-R32 PolarHBondContact OD1-NH1 3.49Å; L30-R32 VanDerWaalsContact C-N 3.31Å; L30-R32 PolarHBondContact O-N 3.01Å; R32-A34 VanDerWaalsContact C-N 3.34Å; R32-T35 PolarHBondContact O-N 3.39Å; R32-F36 WeakPolarHBondContact O-CB 3.23Å; R32-F36 PolarHBondContact O-N 3.23Å
33	V	94.4	Very high	94.2	Very high	96 Å²	96	98.2 Å²	98.2	58%	0.582	51%	0.506	S	S	*	.	H	α-helix	trans	-63.2	-42.7	177.4	174.7	0	0	0	0	110.7	N29 L30 F36 A37	N29-V33 WeakPolarHBondContact O-CG2 3.45Å; N29-V33 PolarHBondContact O-N 3.32Å; L30-V33 PolarHBondContact O-N 2.86Å; V33-F36 PolarHBondContact O-N 3.42Å; V33-A37 WeakPolarHBondContact O-CB 3.44Å; V33-A37 PolarHBondContact O-N 3.42Å
34	A	94.6	Very high	93.5	Very high	55 Å²	55	93.1 Å²	93.1	46%	0.455	49%	0.488	S	S	.	.	H	α-helix	trans	-62.8	-44.7	176.9	0	0	0	0	0	112	L30 T31 R32 F36 A37 D38	L30-A34 WeakPolarHBondContact O-CB 3.2Å; L30-A34 PolarHBondContact O-N 3.17Å; T31-A34 PolarHBondContact O-N 2.92Å; R32-A34 VanDerWaalsContact C-N 3.34Å; A34-F36 VanDerWaalsContact C-N 3.34Å; A34-F36 PolarHBondContact O-N 2.82Å; A34-A37 PolarHBondContact O-N 2.87Å; A34-D38 VanDerWaalsContact O-CB 3.23Å; A34-D38 WeakPolarHBondContact O-CB 3.5Å; A34-D38 PolarHBondContact O-N 3Å
35	T	95.7	Very high	93	Very high	77 Å²	77	91.5 Å²	91.5	47%	0.472	48%	0.484	S	S	.	.	H	α-helix	trans	-60.8	-42.5	174.6	-59.3	0	0	0	0	111.7	T31 R32 D38 V39	T31-T35 PolarHBondContact O-N 3.33Å; T31-T35 PolarHBondContact O-OG1 3.4Å; R32-T35 PolarHBondContact O-N 3.39Å; T35-D38 PolarHBondContact O-N 2.96Å; T35-V39 WeakPolarHBondContact O-CG2 3.32Å; T35-V39 PolarHBondContact O-N 2.63Å
36	F	96	Very high	92.2	Very high	138 Å²	138	92 Å²	92	61%	0.605	49%	0.492	S	S	*	.	H	α-helix	trans	-64.2	-46.3	177.6	-178.3	-106.9	0	0	0	112.1	R32 V33 A34 D38 V39 I40	R32-F36 WeakPolarHBondContact O-CB 3.23Å; R32-F36 PolarHBondContact O-N 3.23Å; V33-F36 PolarHBondContact O-N 3.42Å; A34-F36 VanDerWaalsContact C-N 3.34Å; A34-F36 PolarHBondContact O-N 2.82Å; F36-D38 VanDerWaalsContact C-N 3.31Å; F36-D38 PolarHBondContact O-N 3.16Å; F36-V39 PolarHBondContact O-N 2.71Å; F36-I40 HydrophobicContact CD1-CD1 3.76Å; F36-I40 HydrophobicContact CE1-CD1 3.23Å; F36-I40 HydrophobicContact CE1-CG1 4.37Å; F36-I40 HydrophobicContact CE2-CD1 4.18Å; F36-I40 HydrophobicContact CG-CD1 4.44Å; F36-I40 HydrophobicContact CZ-CD1 3.48Å; F36-I40 VanDerWaalsContact CZ-CD1 3.48Å; F36-I40 HydrophobicContact CZ-CG1 4.35Å; F36-I40 WeakPolarHBondContact O-CG1 3.45Å; F36-I40 PolarHBondContact O-N 3.31Å
37	A	94.5	Very high	91.2	Very high	53 Å²	53	91.5 Å²	91.5	44%	0.438	48%	0.484	S	S	.	.	H	α-helix	trans	-61.3	-39.7	176.4	0	0	0	0	0	112.1	V33 A34 I40 Q41	V33-A37 WeakPolarHBondContact O-CB 3.44Å; V33-A37 PolarHBondContact O-N 3.42Å; A34-A37 PolarHBondContact O-N 2.87Å; A37-I40 PolarHBondContact O-N 3.46Å; A37-Q41 WeakPolarHBondContact O-CB 3.44Å; A37-Q41 PolarHBondContact O-N 3.33Å
38	D	94.2	Very high	90.2	Very high	72 Å²	72	96.8 Å²	96.8	39%	0.385	50%	0.502	S	S	.	.	H	α-helix	trans	-65.4	-39.6	176.6	173.4	54.1	0	0	0	112.4	A34 T35 F36 Q41 R42	A34-D38 VanDerWaalsContact O-CB 3.23Å; A34-D38 WeakPolarHBondContact O-CB 3.5Å; A34-D38 PolarHBondContact O-N 3Å; T35-D38 PolarHBondContact O-N 2.96Å; F36-D38 VanDerWaalsContact C-N 3.31Å; F36-D38 PolarHBondContact O-N 3.16Å; D38-Q41 PolarHBondContact O-N 3.39Å; D38-R42 WeakPolarHBondContact O-CB 3.4Å; D38-R42 WeakPolarHBondContact O-CG 3.22Å; D38-R42 PolarHBondContact O-N 3.27Å; D38-R42 IonicContact OD1-CZ 3.64Å; D38-R42 IonicContact OD1-NH1 3.12Å; D38-R42 PolarHBondContact OD1-NH1 3.11Å; D38-R42 VanDerWaalsContact OD1-NH1 3.12Å; D38-R42 IonicContact OD2-CZ 2.98Å; D38-R42 IonicContact OD2-NH1 2.63Å; D38-R42 PolarHBondContact OD2-NH1 3.39Å; D38-R42 IonicContact OD2-NH2 2.71Å; D38-R42 PolarHBondContact OD2-NH2 3.12Å
39	V	93	Very high	89.5	Confident	76 Å²	76	92.9 Å²	92.9	46%	0.461	49%	0.491	S	S	.	.	H	α-helix	trans	-62.3	-46.6	171.8	171.1	0	0	0	0	111.4	T35 F36 R42 H43	T35-V39 WeakPolarHBondContact O-CG2 3.32Å; T35-V39 PolarHBondContact O-N 2.63Å; F36-V39 PolarHBondContact O-N 2.71Å; V39-R42 PolarHBondContact O-N 2.91Å; V39-H43 PolarHBondContact O-N 3.37Å
40	I	92.9	Very high	88.9	Confident	89 Å²	89	98 Å²	98	46%	0.456	51%	0.51	S	S	.	.	H	α-helix	trans	-62.3	-45.7	177.4	-70	174.1	0	0	0	110.9	F36 A37 R42 H43 S44	F36-I40 HydrophobicContact CD1-CD1 3.76Å; F36-I40 HydrophobicContact CE1-CD1 3.23Å; F36-I40 HydrophobicContact CE1-CG1 4.37Å; F36-I40 HydrophobicContact CE2-CD1 4.18Å; F36-I40 HydrophobicContact CG-CD1 4.44Å; F36-I40 HydrophobicContact CZ-CD1 3.48Å; F36-I40 VanDerWaalsContact CZ-CD1 3.48Å; F36-I40 HydrophobicContact CZ-CG1 4.35Å; F36-I40 WeakPolarHBondContact O-CG1 3.45Å; F36-I40 PolarHBondContact O-N 3.31Å; A37-I40 PolarHBondContact O-N 3.46Å; I40-R42 PolarHBondContact O-N 2.89Å; I40-H43 PolarHBondContact O-N 3.46Å; I40-S44 PolarHBondContact O-N 3.47Å; I40-S44 PolarHBondContact O-OG 3Å
41	Q	91.7	Very high	88.2	Confident	113 Å²	113	99.9 Å²	99.9	53%	0.528	51%	0.512	S	S	.	.	H	α-helix	trans	-60.2	-48.8	-179.9	-174.6	61.6	35.9	0	0	110.4	A37 D38 H43 S44 T45	A37-Q41 WeakPolarHBondContact O-CB 3.44Å; A37-Q41 PolarHBondContact O-N 3.33Å; D38-Q41 PolarHBondContact O-N 3.39Å; Q41-H43 VanDerWaalsContact C-N 3.34Å; Q41-H43 PolarHBondContact O-N 2.74Å; Q41-S44 PolarHBondContact O-N 3.03Å; Q41-S44 PolarHBondContact O-OG 2.9Å; Q41-T45 HydrophobicContact CG-CG2 4.45Å; Q41-T45 WeakPolarHBondContact O-CG2 3.18Å; Q41-T45 PolarHBondContact O-N 3.41Å; Q41-T45 PolarHBondContact O-OG1 3.43Å; Q41-T45 VanDerWaalsContact O-OG1 3.11Å
42	R	88.7	Confident	87.3	Confident	126 Å²	126	97.4 Å²	97.4	48%	0.475	50%	0.499	S	S	.	.	H	α-helix	trans	-58	-44.9	176.9	-79.5	-166.6	-69.5	-99.9	-9.7	112.7	D38 V39 I40 T45 T46	D38-R42 WeakPolarHBondContact O-CB 3.4Å; D38-R42 WeakPolarHBondContact O-CG 3.22Å; D38-R42 PolarHBondContact O-N 3.27Å; D38-R42 IonicContact OD1-CZ 3.64Å; D38-R42 IonicContact OD1-NH1 3.12Å; D38-R42 PolarHBondContact OD1-NH1 3.11Å; D38-R42 VanDerWaalsContact OD1-NH1 3.12Å; D38-R42 IonicContact OD2-CZ 2.98Å; D38-R42 IonicContact OD2-NH1 2.63Å; D38-R42 PolarHBondContact OD2-NH1 3.39Å; D38-R42 IonicContact OD2-NH2 2.71Å; D38-R42 PolarHBondContact OD2-NH2 3.12Å; V39-R42 PolarHBondContact O-N 2.91Å; I40-R42 PolarHBondContact O-N 2.89Å; R42-T45 WeakPolarHBondContact CA-OG1 3.34Å; R42-T45 PolarHBondContact O-N 3Å; R42-T45 PolarHBondContact O-OG1 3.48Å; R42-T46 WeakPolarHBondContact O-CB 3.33Å; R42-T46 PolarHBondContact O-N 2.98Å; R42-T46 PolarHBondContact O-OG1 2.92Å
43	H	86.6	Confident	86.6	Confident	123 Å²	123	95.9 Å²	95.9	57%	0.569	50%	0.497	S	S	*	.	H	α-helix	trans	-62.4	-46.6	178.8	-169.6	54.9	0	0	0	111.4	V39 I40 Q41 T45 T46 I47	V39-H43 PolarHBondContact O-N 3.37Å; I40-H43 PolarHBondContact O-N 3.46Å; Q41-H43 VanDerWaalsContact C-N 3.34Å; Q41-H43 PolarHBondContact O-N 2.74Å; H43-T45 PolarHBondContact O-N 3.48Å; H43-T46 PolarHBondContact O-N 3.28Å; H43-I47 WeakPolarHBondContact NE2-CD1 3.37Å; H43-I47 PolarHBondContact O-N 3.48Å; H43-I47 VanDerWaalsContact O-N 3.13Å
44	S	83.9	Confident	85.9	Confident	36 Å²	36	95.6 Å²	95.6	25%	0.252	49%	0.492	S	S	.	.	H	α-helix	trans	-60.2	-45.3	176.2	74.1	0	0	0	0	112	I40 Q41 T46 I47 F48	I40-S44 PolarHBondContact O-N 3.47Å; I40-S44 PolarHBondContact O-OG 3Å; Q41-S44 PolarHBondContact O-N 3.03Å; Q41-S44 PolarHBondContact O-OG 2.9Å; S44-T46 VanDerWaalsContact C-N 3.27Å; S44-T46 PolarHBondContact O-N 3.06Å; S44-I47 PolarHBondContact O-N 3.47Å; S44-F48 WeakPolarHBondContact O-CB 3.47Å; S44-F48 WeakPolarHBondContact O-CD2 3.38Å; S44-F48 PolarHBondContact O-N 3.28Å
45	T	85	Confident	85.3	Confident	70 Å²	70	97 Å²	97	43%	0.429	49%	0.491	S	S	.	.	H	α-helix	trans	-67.3	-26.9	178.9	53.9	0	0	0	0	113.3	Q41 R42 H43 S49	Q41-T45 HydrophobicContact CG-CG2 4.45Å; Q41-T45 WeakPolarHBondContact O-CG2 3.18Å; Q41-T45 PolarHBondContact O-N 3.41Å; Q41-T45 PolarHBondContact O-OG1 3.43Å; Q41-T45 VanDerWaalsContact O-OG1 3.11Å; R42-T45 WeakPolarHBondContact CA-OG1 3.34Å; R42-T45 PolarHBondContact O-N 3Å; R42-T45 PolarHBondContact O-OG1 3.48Å; H43-T45 PolarHBondContact O-N 3.48Å; T45-S49 WeakPolarHBondContact O-CA 3.44Å; T45-S49 WeakPolarHBondContact O-CB 3.46Å; T45-S49 PolarHBondContact O-N 2.88Å
46	T	80.4	Confident	84.6	Confident	94 Å²	94	98.2 Å²	98.2	58%	0.577	50%	0.495	S	S	*	.	H	α-helix	trans	-71.7	-49.5	177.2	-58.3	0	0	0	0	109.9	R42 H43 S44 S49	R42-T46 WeakPolarHBondContact O-CB 3.33Å; R42-T46 PolarHBondContact O-N 2.98Å; R42-T46 PolarHBondContact O-OG1 2.92Å; H43-T46 PolarHBondContact O-N 3.28Å; S44-T46 VanDerWaalsContact C-N 3.27Å; S44-T46 PolarHBondContact O-N 3.06Å; T46-S49 PolarHBondContact O-N 2.78Å; T46-S49 PolarHBondContact O-OG 3.13Å
47	I	75.9	Confident	84	Confident	82 Å²	82	96.6 Å²	96.6	42%	0.421	49%	0.488	S	S	.	.	H	α-helix	trans	-62.2	-48.5	178.2	-66.2	170.3	0	0	0	110.7	H43 S44 S49 S52	H43-I47 WeakPolarHBondContact NE2-CD1 3.37Å; H43-I47 PolarHBondContact O-N 3.48Å; H43-I47 VanDerWaalsContact O-N 3.13Å; S44-I47 PolarHBondContact O-N 3.47Å; I47-S49 PolarHBondContact O-N 2.96Å; I47-S52 WeakPolarHBondContact O-CB 3.15Å; I47-S52 PolarHBondContact O-OG 3.1Å; I47-S52 VanDerWaalsContact O-OG 3.1Å
48	F	75.2	Confident	83.7	Confident	151 Å²	151	99.3 Å²	99.3	66%	0.662	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.5	18.8	-176.4	-60.3	-70.3	0	0	0	113.9	S44 K50	S44-F48 WeakPolarHBondContact O-CB 3.47Å; S44-F48 WeakPolarHBondContact O-CD2 3.38Å; S44-F48 PolarHBondContact O-N 3.28Å; F48-K50 PolarHBondContact O-N 2.95Å
49	S	79.5	Confident	83.3	Confident	45 Å²	45	101.4 Å²	101.4	32%	0.315	50%	0.503	S	S	.	.			trans	-59.7	138.3	173.4	64.2	0	0	0	0	109.3	T45 T46 I47 K51 S52 F53	T45-S49 WeakPolarHBondContact O-CA 3.44Å; T45-S49 WeakPolarHBondContact O-CB 3.46Å; T45-S49 PolarHBondContact O-N 2.88Å; T46-S49 PolarHBondContact O-N 2.78Å; T46-S49 PolarHBondContact O-OG 3.13Å; I47-S49 PolarHBondContact O-N 2.96Å; S49-K51 PolarHBondContact O-N 3.21Å; S49-S52 PolarHBondContact O-N 3.42Å; S49-S52 WeakPolarHBondContact OG-CB 3.43Å; S49-S52 PolarHBondContact OG-N 2.83Å; S49-F53 PolarHBondContact O-N 3.23Å
50	K	79.8	Confident	82.9	Confident	193 Å²	193	104.5 Å²	104.5	84%	0.839	51%	0.513	S	S	*	.	H	α-helix	trans	-48.7	-36.2	179	-73.5	-175.3	177.4	-178.2	0	112.3	F48 N54	F48-K50 PolarHBondContact O-N 2.95Å; K50-N54 WeakPolarHBondContact O-CB 3.43Å; K50-N54 PolarHBondContact O-N 3.41Å
51	K	80.2	Confident	82.6	Confident	160 Å²	160	107.2 Å²	107.2	70%	0.696	52%	0.521	S	S	*	.	H	α-helix	trans	-67.4	-48.6	176.7	-172.3	177.6	-178.6	-179.9	0	112.8	S49 N54 N55	S49-K51 PolarHBondContact O-N 3.21Å; K51-N54 PolarHBondContact O-N 3.24Å; K51-N55 WeakPolarHBondContact O-CB 3.34Å; K51-N55 PolarHBondContact O-N 3Å; K51-N55 PolarHBondContact O-OD1 3.28Å
52	S	76.7	Confident	82.2	Confident	35 Å²	35	106.3 Å²	106.3	25%	0.245	53%	0.527	C	S	.	.	H	α-helix	trans	-63	-43.7	175.7	-179.4	0	0	0	0	111.3	I47 S49 N55 N56	I47-S52 WeakPolarHBondContact O-CB 3.15Å; I47-S52 PolarHBondContact O-OG 3.1Å; I47-S52 VanDerWaalsContact O-OG 3.1Å; S49-S52 PolarHBondContact O-N 3.42Å; S49-S52 WeakPolarHBondContact OG-CB 3.43Å; S49-S52 PolarHBondContact OG-N 2.83Å; S52-N55 PolarHBondContact O-N 3.18Å; S52-N56 WeakPolarHBondContact O-CB 3.39Å; S52-N56 PolarHBondContact O-N 3.42Å; S52-N56 PolarHBondContact O-OD1 2.85Å
53	F	78.7	Confident	81	Confident	130 Å²	130	111.1 Å²	111.1	57%	0.57	56%	0.555	S	S	*	*	H	α-helix	trans	-60.9	-47.4	175.8	-173.3	-94.1	0	0	0	111.6	S49 N56 F57	S49-F53 PolarHBondContact O-N 3.23Å; F53-N56 PolarHBondContact O-N 2.88Å; F53-F57 HydrophobicContact CE1-CB 4.49Å; F53-F57 HydrophobicContact CE1-CD2 4.27Å; F53-F57 HydrophobicContact CZ-CD2 4.27Å; F53-F57 WeakPolarHBondContact O-CB 3.17Å; F53-F57 PolarHBondContact O-N 2.95Å
54	N	80.9	Confident	80.7	Confident	89 Å²	89	110.6 Å²	110.6	48%	0.476	55%	0.554	S	S	.	*	H	α-helix	trans	-62.6	-45.1	179.1	-164.1	75.4	0	0	0	111.6	K50 K51 F57 E58	K50-N54 WeakPolarHBondContact O-CB 3.43Å; K50-N54 PolarHBondContact O-N 3.41Å; K51-N54 PolarHBondContact O-N 3.24Å; N54-F57 PolarHBondContact O-N 3.32Å; N54-E58 WeakPolarHBondContact O-CB 3.2Å; N54-E58 PolarHBondContact O-N 3.39Å
55	N	82.1	Confident	80.5	Confident	84 Å²	84	114.5 Å²	114.5	45%	0.449	57%	0.57	S	S	.	*	H	α-helix	trans	-64	-43.5	178.3	-69.8	1.6	0	0	0	112.2	K51 S52 N59	K51-N55 WeakPolarHBondContact O-CB 3.34Å; K51-N55 PolarHBondContact O-N 3Å; K51-N55 PolarHBondContact O-OD1 3.28Å; S52-N55 PolarHBondContact O-N 3.18Å; N55-N59 VanDerWaalsContact O-CB 3.28Å; N55-N59 WeakPolarHBondContact O-CB 3.22Å; N55-N59 PolarHBondContact O-N 3.41Å
56	N	80	Confident	80.3	Confident	104 Å²	104	116.9 Å²	116.9	56%	0.556	58%	0.578	S	S	*	*	H	α-helix	trans	-69.6	-37.9	178.1	-75.9	31.7	0	0	0	111.6	S52 F53 Q60	S52-N56 WeakPolarHBondContact O-CB 3.39Å; S52-N56 PolarHBondContact O-N 3.42Å; S52-N56 PolarHBondContact O-OD1 2.85Å; F53-N56 PolarHBondContact O-N 2.88Å; N56-Q60 WeakPolarHBondContact O-CB 3.28Å; N56-Q60 WeakPolarHBondContact O-CG 3.16Å; N56-Q60 PolarHBondContact O-N 3.12Å; N56-Q60 VanDerWaalsContact O-N 3.09Å
57	F	84.9	Confident	80.3	Confident	104 Å²	104	118.3 Å²	118.3	46%	0.456	58%	0.578	S	S	.	*	H	α-helix	trans	-64.8	-51.7	175.8	-170.2	-88.4	0	0	0	110.3	F53 N54 N59 Q60 F61	F53-F57 HydrophobicContact CE1-CB 4.49Å; F53-F57 HydrophobicContact CE1-CD2 4.27Å; F53-F57 HydrophobicContact CZ-CD2 4.27Å; F53-F57 WeakPolarHBondContact O-CB 3.17Å; F53-F57 PolarHBondContact O-N 2.95Å; N54-F57 PolarHBondContact O-N 3.32Å; F57-N59 VanDerWaalsContact C-N 3.31Å; F57-N59 PolarHBondContact O-N 2.97Å; F57-Q60 PolarHBondContact O-N 2.84Å; F57-Q60 VanDerWaalsContact O-N 3.12Å; F57-F61 AromaticContact CD1-CD2 3.67Å; F57-F61 HydrophobicContact CD1-CD2 3.67Å; F57-F61 HydrophobicContact CD1-CE2 4.19Å; F57-F61 AromaticContact CD2-CD2 3.82Å; F57-F61 HydrophobicContact CD2-CD2 3.82Å; F57-F61 AromaticContact CD2-CE2 3.5Å; F57-F61 HydrophobicContact CD2-CE2 3.5Å; F57-F61 VanDerWaalsContact CD2-CE2 3.5Å; F57-F61 AromaticContact CE1-CD2 3.53Å; F57-F61 HydrophobicContact CE1-CD2 3.53Å; F57-F61 AromaticContact CE1-CE2 3.91Å; F57-F61 HydrophobicContact CE1-CE2 3.91Å; F57-F61 HydrophobicContact CE1-CG 4.28Å; F57-F61 AromaticContact CE2-CD2 3.7Å; F57-F61 HydrophobicContact CE2-CD2 3.7Å; F57-F61 AromaticContact CE2-CE2 3.18Å; F57-F61 HydrophobicContact CE2-CE2 3.18Å; F57-F61 HydrophobicContact CE2-CZ 4.01Å; F57-F61 AromaticContact CG-CD2 3.81Å; F57-F61 HydrophobicContact CG-CD2 3.81Å; F57-F61 AromaticContact CG-CE2 4Å; F57-F61 HydrophobicContact CG-CE2 4Å; F57-F61 AromaticContact CZ-CD2 3.54Å; F57-F61 HydrophobicContact CZ-CD2 3.54Å; F57-F61 AromaticContact CZ-CE2 3.4Å; F57-F61 HydrophobicContact CZ-CE2 3.4Å; F57-F61 HydrophobicContact CZ-CG 4.41Å; F57-F61 HydrophobicContact CZ-CZ 4.12Å; F57-F61 WeakPolarHBondContact O-CD2 3.45Å; F57-F61 PolarHBondContact O-N 3.02Å
58	E	87.7	Confident	80.6	Confident	109 Å²	109	120.6 Å²	120.6	51%	0.509	59%	0.588	S	S	.	*	H	α-helix	trans	-57.1	-42.5	177.7	-171.9	174.9	173.2	0	0	111.8	N54 Q60 F61 S62	N54-E58 WeakPolarHBondContact O-CB 3.2Å; N54-E58 PolarHBondContact O-N 3.39Å; E58-Q60 PolarHBondContact O-N 3.09Å; E58-F61 PolarHBondContact O-N 2.67Å; E58-S62 WeakPolarHBondContact O-CB 3.2Å; E58-S62 PolarHBondContact O-N 2.94Å; E58-S62 PolarHBondContact O-OG 3.46Å
59	N	85.2	Confident	80.9	Confident	116 Å²	116	118.5 Å²	118.5	62%	0.62	58%	0.583	S	S	*	*	H	α-helix	trans	-69	-31	178.3	-163.8	79.1	0	0	0	113.5	N55 F57	N55-N59 VanDerWaalsContact O-CB 3.28Å; N55-N59 WeakPolarHBondContact O-CB 3.22Å; N55-N59 PolarHBondContact O-N 3.41Å; F57-N59 VanDerWaalsContact C-N 3.31Å; F57-N59 PolarHBondContact O-N 2.97Å
60	Q	85.1	Confident	81	Confident	142 Å²	142	123.8 Å²	123.8	66%	0.664	60%	0.602	S	S	*	*	H	α-helix	trans	-80.9	-22.6	177.8	-67.6	-65.5	94.8	0	0	113.3	N56 F57 E58	N56-Q60 WeakPolarHBondContact O-CB 3.28Å; N56-Q60 WeakPolarHBondContact O-CG 3.16Å; N56-Q60 PolarHBondContact O-N 3.12Å; N56-Q60 VanDerWaalsContact O-N 3.09Å; F57-Q60 PolarHBondContact O-N 2.84Å; F57-Q60 VanDerWaalsContact O-N 3.12Å; E58-Q60 PolarHBondContact O-N 3.09Å
61	F	86.6	Confident	81.1	Confident	145 Å²	145	118.5 Å²	118.5	64%	0.636	58%	0.584	S	S	*	*	H	α-helix	trans	-107.9	-2.9	-179.2	-70.8	-75.4	0	0	0	114.3	F57 E58	F57-F61 AromaticContact CD1-CD2 3.67Å; F57-F61 HydrophobicContact CD1-CD2 3.67Å; F57-F61 HydrophobicContact CD1-CE2 4.19Å; F57-F61 AromaticContact CD2-CD2 3.82Å; F57-F61 HydrophobicContact CD2-CD2 3.82Å; F57-F61 AromaticContact CD2-CE2 3.5Å; F57-F61 HydrophobicContact CD2-CE2 3.5Å; F57-F61 VanDerWaalsContact CD2-CE2 3.5Å; F57-F61 AromaticContact CE1-CD2 3.53Å; F57-F61 HydrophobicContact CE1-CD2 3.53Å; F57-F61 AromaticContact CE1-CE2 3.91Å; F57-F61 HydrophobicContact CE1-CE2 3.91Å; F57-F61 HydrophobicContact CE1-CG 4.28Å; F57-F61 AromaticContact CE2-CD2 3.7Å; F57-F61 HydrophobicContact CE2-CD2 3.7Å; F57-F61 AromaticContact CE2-CE2 3.18Å; F57-F61 HydrophobicContact CE2-CE2 3.18Å; F57-F61 HydrophobicContact CE2-CZ 4.01Å; F57-F61 AromaticContact CG-CD2 3.81Å; F57-F61 HydrophobicContact CG-CD2 3.81Å; F57-F61 AromaticContact CG-CE2 4Å; F57-F61 HydrophobicContact CG-CE2 4Å; F57-F61 AromaticContact CZ-CD2 3.54Å; F57-F61 HydrophobicContact CZ-CD2 3.54Å; F57-F61 AromaticContact CZ-CE2 3.4Å; F57-F61 HydrophobicContact CZ-CE2 3.4Å; F57-F61 HydrophobicContact CZ-CG 4.41Å; F57-F61 HydrophobicContact CZ-CZ 4.12Å; F57-F61 WeakPolarHBondContact O-CD2 3.45Å; F57-F61 PolarHBondContact O-N 3.02Å; E58-F61 PolarHBondContact O-N 2.67Å
62	S	82.2	Confident	81.2	Confident	94 Å²	94	115 Å²	115	66%	0.657	58%	0.575	S	S	*	*			trans	-92	0.9	172.9	-57.9	0	0	0	0	113.6	E58	E58-S62 WeakPolarHBondContact O-CB 3.2Å; E58-S62 PolarHBondContact O-N 2.94Å; E58-S62 PolarHBondContact O-OG 3.46Å
63	H	64.3	Low	81.6	Confident	228 Å²	228	122.3 Å²	122.3	100%	1.056	61%	0.605	S	S	*	*			trans	-115.7	0	179.2	-153.7	-45	0	0	0	110.9

Retrieved 63 of 63 residues in 186.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).