A0A5K4FBP4_SCHMA Loading...

Small integral membrane protein 26

AlphaFold DB , UniProt , Accession A0A5K4FBP4, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 76 aa.

						>A0A5K4FBP4_SCHMA|A0A5K4FBP4
MSNRPILVRGVLFIGTIIASAYYLTYIRYYAYEKKRLATQTPHLDEDYILEFYKEVSESSRKTEWTNKRVNRPWGE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.3	Low	74.1	Confident	235 Å²	235	123.7 Å²	123.7	100%	1.158	64%	0.641	S	S	*	*				0	130.3	0	-76.5	174.9	163.1	0	0	108.2	N3	M1-N3 PolarHBondContact O-N 3.48Å
2	S	71.5	Confident	74.8	Confident	91 Å²	91	123.7 Å²	123.7	64%	0.636	64%	0.641	S	S	*	*			trans	-74.8	123.9	-177.9	178.3	0	0	0	0	110.2	R4 P5	S2-R4 PolarHBondContact O-N 3.4Å; S2-R4 VanDerWaalsContact OG-CB 3.3Å; S2-R4 WeakPolarHBondContact OG-CB 3.24Å; S2-R4 PolarHBondContact OG-N 3.17Å; S2-P5 VanDerWaalsContact O-CD 3.24Å; S2-P5 WeakPolarHBondContact O-CD 3.3Å
3	N	72.9	Confident	75.5	Confident	110 Å²	110	124.8 Å²	124.8	59%	0.588	64%	0.639	S	S	*	*			trans	-75.9	3.7	176.1	-68.9	-19.2	0	0	0	113.2	M1 P5 I6 L7	M1-N3 PolarHBondContact O-N 3.48Å; N3-P5 VanDerWaalsContact C-CD 3.44Å; N3-I6 PolarHBondContact O-N 3.24Å; N3-L7 PolarHBondContact O-N 3.18Å
4	R	74.9	Confident	76.3	Confident	191 Å²	191	123.2 Å²	123.2	72%	0.721	63%	0.63	S	S	*	*	H	α-helix	trans	-53.5	-43.2	-178.8	-160.2	174.2	-174.9	-176.7	1.4	114.6	S2 I6 L7 V8	S2-R4 PolarHBondContact O-N 3.4Å; S2-R4 VanDerWaalsContact OG-CB 3.3Å; S2-R4 WeakPolarHBondContact OG-CB 3.24Å; S2-R4 PolarHBondContact OG-N 3.17Å; R4-I6 VanDerWaalsContact C-N 3.32Å; R4-I6 PolarHBondContact O-N 3.39Å; R4-L7 PolarHBondContact O-N 3.43Å; R4-V8 VanDerWaalsContact O-CG2 3.29Å; R4-V8 WeakPolarHBondContact O-CG2 3.32Å; R4-V8 PolarHBondContact O-N 3.17Å; R4-V8 VanDerWaalsContact O-N 3.07Å
5	P	76.2	Confident	76.9	Confident	80 Å²	80	117.5 Å²	117.5	52%	0.519	61%	0.614	S	S	.	*	H	α-helix	trans	-68.1	-29.9	-180	26.1	-31.9	0	0	0	113.1	S2 N3 R9	S2-P5 VanDerWaalsContact O-CD 3.24Å; S2-P5 WeakPolarHBondContact O-CD 3.3Å; N3-P5 VanDerWaalsContact C-CD 3.44Å; P5-R9 WeakPolarHBondContact O-CG 3.4Å; P5-R9 PolarHBondContact O-N 3.3Å
6	I	77.4	Confident	77.7	Confident	121 Å²	121	115.5 Å²	115.5	62%	0.621	61%	0.608	S	S	*	*	H	α-helix	trans	-70.4	-45.3	176.9	-60.8	173.5	0	0	0	109.8	N3 R4 V8 R9 G10	N3-I6 PolarHBondContact O-N 3.24Å; R4-I6 VanDerWaalsContact C-N 3.32Å; R4-I6 PolarHBondContact O-N 3.39Å; I6-V8 PolarHBondContact O-N 3.46Å; I6-R9 PolarHBondContact O-N 3.38Å; I6-G10 PolarHBondContact O-N 3.27Å
7	L	74.7	Confident	78.5	Confident	119 Å²	119	113.8 Å²	113.8	62%	0.623	60%	0.599	S	S	*	*	H	α-helix	trans	-62.2	-44	178.4	-71	168	0	0	0	112.1	N3 R4 R9 G10 V11	N3-L7 PolarHBondContact O-N 3.18Å; R4-L7 PolarHBondContact O-N 3.43Å; L7-R9 VanDerWaalsContact C-N 3.3Å; L7-R9 PolarHBondContact O-N 3.33Å; L7-G10 PolarHBondContact O-N 3.2Å; L7-V11 WeakPolarHBondContact O-CG2 3.41Å; L7-V11 PolarHBondContact O-N 3.07Å
8	V	77.3	Confident	79.2	Confident	85 Å²	85	113.7 Å²	113.7	52%	0.515	60%	0.597	S	S	.	*	H	α-helix	trans	-60.8	-40.3	178.9	172.4	0	0	0	0	111.5	R4 I6	R4-V8 VanDerWaalsContact O-CG2 3.29Å; R4-V8 WeakPolarHBondContact O-CG2 3.32Å; R4-V8 PolarHBondContact O-N 3.17Å; R4-V8 VanDerWaalsContact O-N 3.07Å; I6-V8 PolarHBondContact O-N 3.46Å
9	R	75.2	Confident	79.9	Confident	198 Å²	198	110.7 Å²	110.7	75%	0.747	59%	0.591	S	S	*	*	H	α-helix	trans	-70.6	-39.2	176	-70.3	179.9	-179.7	-174.7	0.7	112.3	P5 I6 L7 L12 F13	P5-R9 WeakPolarHBondContact O-CG 3.4Å; P5-R9 PolarHBondContact O-N 3.3Å; I6-R9 PolarHBondContact O-N 3.38Å; L7-R9 VanDerWaalsContact C-N 3.3Å; L7-R9 PolarHBondContact O-N 3.33Å; R9-L12 PolarHBondContact O-N 3.05Å; R9-F13 PolarHBondContact O-N 2.95Å; R9-F13 VanDerWaalsContact O-N 3.17Å
10	G	78.4	Confident	80.5	Confident	30 Å²	30	108.2 Å²	108.2	31%	0.309	58%	0.582	S	S	.	*	H	α-helix	trans	-62.5	-40.9	179.2	0	0	0	0	0	113.3	I6 L7 F13 I14	I6-G10 PolarHBondContact O-N 3.27Å; L7-G10 PolarHBondContact O-N 3.2Å; G10-F13 PolarHBondContact O-N 2.92Å; G10-I14 WeakPolarHBondContact O-CG1 3.29Å; G10-I14 PolarHBondContact O-N 3.5Å
11	V	80.6	Confident	81.2	Confident	101 Å²	101	105.4 Å²	105.4	61%	0.612	57%	0.574	S	S	*	*	H	α-helix	trans	-62.5	-45.4	178.7	173	0	0	0	0	111.7	L7 F13 I14 G15	L7-V11 WeakPolarHBondContact O-CG2 3.41Å; L7-V11 PolarHBondContact O-N 3.07Å; V11-F13 VanDerWaalsContact C-N 3.31Å; V11-F13 PolarHBondContact O-N 3.09Å; V11-I14 PolarHBondContact O-N 3.22Å; V11-G15 PolarHBondContact O-N 2.7Å
12	L	81.7	Confident	83	Confident	123 Å²	123	102.2 Å²	102.2	64%	0.644	55%	0.55	S	S	*	*	H	α-helix	trans	-61.5	-42.5	176.8	-70.2	173.4	0	0	0	111.2	R9 G15 T16	R9-L12 PolarHBondContact O-N 3.05Å; L12-G15 PolarHBondContact O-N 3.44Å; L12-T16 WeakPolarHBondContact O-CG2 3.47Å; L12-T16 PolarHBondContact O-N 2.94Å; L12-T16 PolarHBondContact O-OG1 2.91Å
13	F	84.6	Confident	84.1	Confident	139 Å²	139	104.8 Å²	104.8	61%	0.61	55%	0.547	S	S	*	.	H	α-helix	trans	-62	-48.4	178.5	-169.6	-105	0	0	0	112	R9 G10 V11 G15 T16 I17	R9-F13 PolarHBondContact O-N 2.95Å; R9-F13 VanDerWaalsContact O-N 3.17Å; G10-F13 PolarHBondContact O-N 2.92Å; V11-F13 VanDerWaalsContact C-N 3.31Å; V11-F13 PolarHBondContact O-N 3.09Å; F13-G15 VanDerWaalsContact C-N 3.3Å; F13-G15 PolarHBondContact O-N 3.48Å; F13-T16 PolarHBondContact O-N 3.4Å; F13-T16 PolarHBondContact O-OG1 3.42Å; F13-I17 HydrophobicContact CD1-CD1 3.72Å; F13-I17 HydrophobicContact CE1-CD1 3.44Å; F13-I17 VanDerWaalsContact CE1-CD1 3.44Å; F13-I17 HydrophobicContact CE1-CG1 4.42Å; F13-I17 HydrophobicContact CZ-CD1 4.08Å; F13-I17 WeakPolarHBondContact O-CG1 3.4Å; F13-I17 PolarHBondContact O-N 3.45Å; F13-I17 VanDerWaalsContact O-N 3.09Å
14	I	86.1	Confident	85.1	Confident	102 Å²	102	104.6 Å²	104.6	52%	0.523	55%	0.546	S	S	.	.	H	α-helix	trans	-60.2	-43	176.1	-66	166.2	0	0	0	110.5	G10 V11 T16 I17 I18	G10-I14 WeakPolarHBondContact O-CG1 3.29Å; G10-I14 PolarHBondContact O-N 3.5Å; V11-I14 PolarHBondContact O-N 3.22Å; I14-T16 VanDerWaalsContact C-N 3.34Å; I14-T16 PolarHBondContact O-N 3.29Å; I14-I17 PolarHBondContact O-N 2.99Å; I14-I18 HydrophobicContact CG2-CD1 3.89Å; I14-I18 WeakPolarHBondContact O-CG1 3.4Å; I14-I18 PolarHBondContact O-N 2.84Å
15	G	85.8	Confident	86	Confident	37 Å²	37	99.9 Å²	99.9	38%	0.381	54%	0.539	S	S	.	.	H	α-helix	trans	-58	-43.8	176	0	0	0	0	0	112.8	V11 L12 F13 I17 I18 A19	V11-G15 PolarHBondContact O-N 2.7Å; L12-G15 PolarHBondContact O-N 3.44Å; F13-G15 VanDerWaalsContact C-N 3.3Å; F13-G15 PolarHBondContact O-N 3.48Å; G15-I17 PolarHBondContact O-N 3.04Å; G15-I18 PolarHBondContact O-N 3.2Å; G15-A19 WeakPolarHBondContact O-CB 3.36Å; G15-A19 PolarHBondContact O-N 3.41Å
16	T	89	Confident	86.9	Confident	86 Å²	86	102.1 Å²	102.1	53%	0.528	54%	0.538	S	S	.	.	H	α-helix	trans	-66.2	-35.1	177.5	57.5	0	0	0	0	113.2	L12 F13 I14 S20	L12-T16 WeakPolarHBondContact O-CG2 3.47Å; L12-T16 PolarHBondContact O-N 2.94Å; L12-T16 PolarHBondContact O-OG1 2.91Å; F13-T16 PolarHBondContact O-N 3.4Å; F13-T16 PolarHBondContact O-OG1 3.42Å; I14-T16 VanDerWaalsContact C-N 3.34Å; I14-T16 PolarHBondContact O-N 3.29Å; T16-S20 WeakPolarHBondContact O-CB 3.49Å; T16-S20 PolarHBondContact O-N 2.95Å; T16-S20 PolarHBondContact O-OG 3.33Å
17	I	91.5	Very high	87.7	Confident	87 Å²	87	99.8 Å²	99.8	45%	0.446	53%	0.525	S	S	.	.	H	α-helix	trans	-65	-45.4	175	-68.3	169.4	0	0	0	110.3	F13 I14 G15 S20 A21	F13-I17 HydrophobicContact CD1-CD1 3.72Å; F13-I17 HydrophobicContact CE1-CD1 3.44Å; F13-I17 VanDerWaalsContact CE1-CD1 3.44Å; F13-I17 HydrophobicContact CE1-CG1 4.42Å; F13-I17 HydrophobicContact CZ-CD1 4.08Å; F13-I17 WeakPolarHBondContact O-CG1 3.4Å; F13-I17 PolarHBondContact O-N 3.45Å; F13-I17 VanDerWaalsContact O-N 3.09Å; I14-I17 PolarHBondContact O-N 2.99Å; G15-I17 PolarHBondContact O-N 3.04Å; I17-S20 WeakPolarHBondContact CA-OG 3.45Å; I17-S20 PolarHBondContact O-N 3.46Å; I17-S20 PolarHBondContact O-OG 3.06Å; I17-A21 WeakPolarHBondContact O-CB 3.4Å; I17-A21 PolarHBondContact O-N 2.9Å
18	I	91.9	Very high	88.6	Confident	111 Å²	111	103.6 Å²	103.6	57%	0.569	53%	0.531	S	S	*	.	H	α-helix	trans	-64	-46.5	178.7	-65.2	168.2	0	0	0	110.6	I14 G15 S20 A21 Y22	I14-I18 HydrophobicContact CG2-CD1 3.89Å; I14-I18 WeakPolarHBondContact O-CG1 3.4Å; I14-I18 PolarHBondContact O-N 2.84Å; G15-I18 PolarHBondContact O-N 3.2Å; I18-S20 PolarHBondContact O-N 3.46Å; I18-A21 PolarHBondContact O-N 3.42Å; I18-Y22 WeakPolarHBondContact O-CB 3.4Å; I18-Y22 PolarHBondContact O-N 2.74Å
19	A	91.2	Very high	89.4	Confident	58 Å²	58	106.1 Å²	106.1	48%	0.479	53%	0.533	S	S	.	.	H	α-helix	trans	-62.1	-42.1	179.4	0	0	0	0	0	112.3	G15 Y22 Y23	G15-A19 WeakPolarHBondContact O-CB 3.36Å; G15-A19 PolarHBondContact O-N 3.41Å; A19-Y22 PolarHBondContact O-N 3.45Å; A19-Y23 WeakPolarHBondContact O-CB 3.47Å; A19-Y23 PolarHBondContact O-N 3.34Å
20	S	93.8	Very high	90.2	Very high	60 Å²	60	102.8 Å²	102.8	42%	0.42	52%	0.521	S	S	.	.	H	α-helix	trans	-67.2	-40.8	177.4	56.4	0	0	0	0	112.5	T16 I17 I18 Y23 L24	T16-S20 WeakPolarHBondContact O-CB 3.49Å; T16-S20 PolarHBondContact O-N 2.95Å; T16-S20 PolarHBondContact O-OG 3.33Å; I17-S20 WeakPolarHBondContact CA-OG 3.45Å; I17-S20 PolarHBondContact O-N 3.46Å; I17-S20 PolarHBondContact O-OG 3.06Å; I18-S20 PolarHBondContact O-N 3.46Å; S20-Y23 PolarHBondContact O-N 2.93Å; S20-L24 WeakPolarHBondContact O-CB 3.32Å; S20-L24 WeakPolarHBondContact O-CG 3.46Å; S20-L24 PolarHBondContact O-N 2.93Å
21	A	93.9	Very high	90.8	Very high	50 Å²	50	104 Å²	104	41%	0.413	53%	0.528	S	S	.	.	H	α-helix	trans	-62.4	-44	174.4	0	0	0	0	0	112	I17 I18 L24 T25	I17-A21 WeakPolarHBondContact O-CB 3.4Å; I17-A21 PolarHBondContact O-N 2.9Å; I18-A21 PolarHBondContact O-N 3.42Å; A21-L24 PolarHBondContact O-N 3.19Å; A21-T25 PolarHBondContact O-N 3.36Å; A21-T25 PolarHBondContact O-OG1 3.49Å
22	Y	94.6	Very high	91.3	Very high	167 Å²	167	106.3 Å²	106.3	66%	0.655	53%	0.527	S	S	*	.	H	α-helix	trans	-60.6	-46.9	174.8	179.1	-98	0	0	0	111.4	I18 A19 L24 T25 Y26	I18-Y22 WeakPolarHBondContact O-CB 3.4Å; I18-Y22 PolarHBondContact O-N 2.74Å; A19-Y22 PolarHBondContact O-N 3.45Å; Y22-L24 PolarHBondContact O-N 2.96Å; Y22-T25 PolarHBondContact O-N 2.92Å; Y22-Y26 WeakPolarHBondContact O-CB 3.32Å; Y22-Y26 PolarHBondContact O-N 2.97Å
23	Y	94.2	Very high	91.6	Very high	145 Å²	145	101.8 Å²	101.8	57%	0.569	50%	0.502	S	S	*	.	H	α-helix	trans	-60.9	-44.8	179.6	-175.5	-105.6	0	0	0	112.6	A19 S20 T25 Y26 I27	A19-Y23 WeakPolarHBondContact O-CB 3.47Å; A19-Y23 PolarHBondContact O-N 3.34Å; S20-Y23 PolarHBondContact O-N 2.93Å; Y23-T25 VanDerWaalsContact C-N 3.3Å; Y23-T25 PolarHBondContact O-N 3.44Å; Y23-Y26 PolarHBondContact O-N 3.41Å; Y23-I27 HydrophobicContact CD1-CD1 3.7Å; Y23-I27 HydrophobicContact CD1-CG1 4.49Å; Y23-I27 HydrophobicContact CE1-CD1 3.16Å; Y23-I27 HydrophobicContact CE1-CG1 4.18Å; Y23-I27 HydrophobicContact CE2-CD1 4.26Å; Y23-I27 HydrophobicContact CG-CD1 4.45Å; Y23-I27 VanDerWaalsContact CZ-CD1 3.48Å; Y23-I27 WeakPolarHBondContact O-CG1 3.4Å; Y23-I27 PolarHBondContact O-N 3.12Å
24	L	94.6	Very high	91.7	Very high	106 Å²	106	101.5 Å²	101.5	56%	0.555	50%	0.501	S	S	*	.	H	α-helix	trans	-61.4	-40.2	175.7	-75.5	168.8	0	0	0	112	S20 A21 Y22 R28	S20-L24 WeakPolarHBondContact O-CB 3.32Å; S20-L24 WeakPolarHBondContact O-CG 3.46Å; S20-L24 PolarHBondContact O-N 2.93Å; A21-L24 PolarHBondContact O-N 3.19Å; Y22-L24 PolarHBondContact O-N 2.96Å; L24-R28 WeakPolarHBondContact O-CG 3.47Å; L24-R28 PolarHBondContact O-N 3.32Å; L24-R28 VanDerWaalsContact O-N 3.12Å
25	T	93.1	Very high	91.6	Very high	93 Å²	93	103.9 Å²	103.9	57%	0.571	51%	0.508	S	S	*	.	H	α-helix	trans	-66.6	-44.3	177.8	-50.6	0	0	0	0	110.9	A21 Y22 Y23 R28 Y29	A21-T25 PolarHBondContact O-N 3.36Å; A21-T25 PolarHBondContact O-OG1 3.49Å; Y22-T25 PolarHBondContact O-N 2.92Å; Y23-T25 VanDerWaalsContact C-N 3.3Å; Y23-T25 PolarHBondContact O-N 3.44Å; T25-R28 PolarHBondContact O-N 2.87Å; T25-Y29 PolarHBondContact O-N 2.88Å
26	Y	94.5	Very high	91.5	Very high	127 Å²	127	107.2 Å²	107.2	50%	0.498	51%	0.509	S	S	.	.	H	α-helix	trans	-61	-45.3	176.5	177.7	-97.2	0	0	0	112.2	Y22 Y23 R28 Y29 Y30	Y22-Y26 WeakPolarHBondContact O-CB 3.32Å; Y22-Y26 PolarHBondContact O-N 2.97Å; Y23-Y26 PolarHBondContact O-N 3.41Å; Y26-R28 VanDerWaalsContact C-N 3.32Å; Y26-R28 PolarHBondContact O-N 3.47Å; Y26-Y29 PolarHBondContact O-N 3.28Å; Y26-Y30 WeakPolarHBondContact O-CB 3.35Å; Y26-Y30 PolarHBondContact O-N 3.44Å
27	I	94.7	Very high	90.9	Very high	71 Å²	71	108 Å²	108	36%	0.364	51%	0.509	S	S	.	.	H	α-helix	trans	-59.1	-45	176.4	-75.2	176	0	0	0	111	Y23 Y29 Y30 A31	Y23-I27 HydrophobicContact CD1-CD1 3.7Å; Y23-I27 HydrophobicContact CD1-CG1 4.49Å; Y23-I27 HydrophobicContact CE1-CD1 3.16Å; Y23-I27 HydrophobicContact CE1-CG1 4.18Å; Y23-I27 HydrophobicContact CE2-CD1 4.26Å; Y23-I27 HydrophobicContact CG-CD1 4.45Å; Y23-I27 VanDerWaalsContact CZ-CD1 3.48Å; Y23-I27 WeakPolarHBondContact O-CG1 3.4Å; Y23-I27 PolarHBondContact O-N 3.12Å; I27-Y29 VanDerWaalsContact C-N 3.34Å; I27-Y29 PolarHBondContact O-N 2.93Å; I27-Y30 PolarHBondContact O-N 3.4Å; I27-A31 WeakPolarHBondContact O-CB 3.36Å; I27-A31 PolarHBondContact O-N 2.83Å
28	R	93.6	Very high	90.1	Very high	199 Å²	199	107.7 Å²	107.7	75%	0.751	52%	0.52	S	S	*	.	H	α-helix	trans	-61.9	-44.5	178.8	-76.7	-179.8	173.3	-164.5	-1.1	111.5	L24 T25 Y26 A31 Y32	L24-R28 WeakPolarHBondContact O-CG 3.47Å; L24-R28 PolarHBondContact O-N 3.32Å; L24-R28 VanDerWaalsContact O-N 3.12Å; T25-R28 PolarHBondContact O-N 2.87Å; Y26-R28 VanDerWaalsContact C-N 3.32Å; Y26-R28 PolarHBondContact O-N 3.47Å; R28-A31 PolarHBondContact O-N 2.97Å; R28-Y32 WeakPolarHBondContact O-CB 3.4Å; R28-Y32 PolarHBondContact O-N 3.07Å
29	Y	94.6	Very high	89.1	Confident	139 Å²	139	107.1 Å²	107.1	55%	0.545	52%	0.521	S	S	.	.	H	α-helix	trans	-62.2	-46.7	176.2	179.7	-98.3	0	0	0	111.8	T25 Y26 I27 A31 Y32 E33	T25-Y29 PolarHBondContact O-N 2.88Å; Y26-Y29 PolarHBondContact O-N 3.28Å; I27-Y29 VanDerWaalsContact C-N 3.34Å; I27-Y29 PolarHBondContact O-N 2.93Å; Y29-A31 PolarHBondContact O-N 3.5Å; Y29-Y32 WeakPolarHBondContact O-CB 3.44Å; Y29-Y32 PolarHBondContact O-N 2.84Å; Y29-E33 HydrophobicContact CD1-CG 4.21Å; Y29-E33 HydrophobicContact CE1-CG 3.67Å; Y29-E33 HydrophobicContact CE2-CG 4.11Å; Y29-E33 WeakPolarHBondContact O-CB 3.46Å; Y29-E33 PolarHBondContact O-N 2.86Å
30	Y	90.8	Very high	87.9	Confident	128 Å²	128	109.2 Å²	109.2	50%	0.502	52%	0.521	S	S	.	.	H	α-helix	trans	-60.1	-44.4	177.3	177.2	-96.8	0	0	0	112.2	Y26 I27 Y32 E33 K34	Y26-Y30 WeakPolarHBondContact O-CB 3.35Å; Y26-Y30 PolarHBondContact O-N 3.44Å; I27-Y30 PolarHBondContact O-N 3.4Å; Y30-Y32 VanDerWaalsContact C-N 3.33Å; Y30-Y32 PolarHBondContact O-N 2.88Å; Y30-E33 PolarHBondContact O-N 3.48Å; Y30-K34 HydrophobicContact CE1-CD 4.37Å; Y30-K34 VanDerWaalsContact O-CB 3.31Å; Y30-K34 WeakPolarHBondContact O-CB 3.31Å; Y30-K34 PolarHBondContact O-N 3.36Å
31	A	92.6	Very high	86.4	Confident	56 Å²	56	112 Å²	112	46%	0.463	54%	0.536	S	S	.	.	H	α-helix	trans	-63.5	-40	176.7	0	0	0	0	0	112	I27 R28 Y29 K35	I27-A31 WeakPolarHBondContact O-CB 3.36Å; I27-A31 PolarHBondContact O-N 2.83Å; R28-A31 PolarHBondContact O-N 2.97Å; Y29-A31 PolarHBondContact O-N 3.5Å; A31-K35 WeakPolarHBondContact O-CB 3.38Å; A31-K35 PolarHBondContact O-N 3.27Å; A31-K35 VanDerWaalsContact O-N 3.07Å
32	Y	91.1	Very high	84.8	Confident	149 Å²	149	114 Å²	114	58%	0.584	54%	0.544	S	S	*	.	H	α-helix	trans	-63	-49.4	174.7	174.5	-97.7	0	0	0	111.8	R28 Y29 Y30 K34 K35 R36	R28-Y32 WeakPolarHBondContact O-CB 3.4Å; R28-Y32 PolarHBondContact O-N 3.07Å; Y29-Y32 WeakPolarHBondContact O-CB 3.44Å; Y29-Y32 PolarHBondContact O-N 2.84Å; Y30-Y32 VanDerWaalsContact C-N 3.33Å; Y30-Y32 PolarHBondContact O-N 2.88Å; Y32-K34 PolarHBondContact O-N 3.5Å; Y32-K35 PolarHBondContact O-N 3.21Å; Y32-R36 WeakPolarHBondContact O-CB 3.44Å; Y32-R36 PolarHBondContact O-N 3.21Å
33	E	87.5	Confident	83.2	Confident	27 Å²	27	115.1 Å²	115.1	13%	0.126	56%	0.555	C	S	.	*	H	α-helix	trans	-61.8	-44.3	178.3	-82.4	-62	149	0	0	112.3	Y29 Y30 K35 R36 L37	Y29-E33 HydrophobicContact CD1-CG 4.21Å; Y29-E33 HydrophobicContact CE1-CG 3.67Å; Y29-E33 HydrophobicContact CE2-CG 4.11Å; Y29-E33 WeakPolarHBondContact O-CB 3.46Å; Y29-E33 PolarHBondContact O-N 2.86Å; Y30-E33 PolarHBondContact O-N 3.48Å; E33-K35 VanDerWaalsContact C-N 3.29Å; E33-K35 PolarHBondContact O-N 3.01Å; E33-R36 VanDerWaalsContact CD-CZ 3.5Å; E33-R36 WeakPolarHBondContact O-CB 3.4Å; E33-R36 PolarHBondContact O-N 3.07Å; E33-R36 VanDerWaalsContact O-N 3.16Å; E33-R36 IonicContact OE1-CZ 3.13Å; E33-R36 IonicContact OE1-NE 2.67Å; E33-R36 PolarHBondContact OE1-NE 3.03Å; E33-R36 IonicContact OE1-NH1 3.03Å; E33-R36 IonicContact OE1-NH2 3.32Å; E33-R36 PolarHBondContact OE1-NH2 3.32Å; E33-R36 IonicContact OE2-CZ 3.03Å; E33-R36 IonicContact OE2-NE 3.06Å; E33-R36 PolarHBondContact OE2-NE 2.95Å; E33-R36 IonicContact OE2-NH2 3.6Å; E33-R36 PolarHBondContact OE2-NH2 2.85Å; E33-L37 WeakPolarHBondContact O-CB 3.5Å; E33-L37 WeakPolarHBondContact O-CG 3.38Å; E33-L37 PolarHBondContact O-N 3.23Å
34	K	85.8	Confident	81.8	Confident	133 Å²	133	112.9 Å²	112.9	58%	0.578	55%	0.553	S	S	*	*	H	α-helix	trans	-58.6	-42.2	175.2	-176.4	176.4	-179.7	179.4	0	111.6	Y30 Y32 A38	Y30-K34 HydrophobicContact CE1-CD 4.37Å; Y30-K34 VanDerWaalsContact O-CB 3.31Å; Y30-K34 WeakPolarHBondContact O-CB 3.31Å; Y30-K34 PolarHBondContact O-N 3.36Å; Y32-K34 PolarHBondContact O-N 3.5Å; K34-A38 WeakPolarHBondContact O-CB 3.37Å; K34-A38 PolarHBondContact O-N 3.36Å
35	K	84.8	Confident	80.9	Confident	152 Å²	152	112 Å²	112	66%	0.661	55%	0.549	S	S	*	.	H	α-helix	trans	-66.8	-43.2	176.2	-170.1	179.9	179.4	-177.9	0	111.2	A31 Y32 E33 A38 T39	A31-K35 WeakPolarHBondContact O-CB 3.38Å; A31-K35 PolarHBondContact O-N 3.27Å; A31-K35 VanDerWaalsContact O-N 3.07Å; Y32-K35 PolarHBondContact O-N 3.21Å; E33-K35 VanDerWaalsContact C-N 3.29Å; E33-K35 PolarHBondContact O-N 3.01Å; K35-A38 PolarHBondContact O-N 2.75Å; K35-T39 PolarHBondContact O-N 3.16Å; K35-T39 PolarHBondContact O-OG1 2.67Å; K35-T39 VanDerWaalsContact O-OG1 3.07Å
36	R	82.9	Confident	80.1	Confident	108 Å²	108	115.1 Å²	115.1	41%	0.408	56%	0.557	S	S	.	*	H	α-helix	trans	-58.8	-47.8	177.5	-172.9	-179.3	73.3	154.3	3.1	111.4	Y32 E33 A38 T39 Q40	Y32-R36 WeakPolarHBondContact O-CB 3.44Å; Y32-R36 PolarHBondContact O-N 3.21Å; E33-R36 VanDerWaalsContact CD-CZ 3.5Å; E33-R36 WeakPolarHBondContact O-CB 3.4Å; E33-R36 PolarHBondContact O-N 3.07Å; E33-R36 VanDerWaalsContact O-N 3.16Å; E33-R36 IonicContact OE1-CZ 3.13Å; E33-R36 IonicContact OE1-NE 2.67Å; E33-R36 PolarHBondContact OE1-NE 3.03Å; E33-R36 IonicContact OE1-NH1 3.03Å; E33-R36 IonicContact OE1-NH2 3.32Å; E33-R36 PolarHBondContact OE1-NH2 3.32Å; E33-R36 IonicContact OE2-CZ 3.03Å; E33-R36 IonicContact OE2-NE 3.06Å; E33-R36 PolarHBondContact OE2-NE 2.95Å; E33-R36 IonicContact OE2-NH2 3.6Å; E33-R36 PolarHBondContact OE2-NH2 2.85Å; R36-A38 VanDerWaalsContact C-N 3.34Å; R36-T39 WeakPolarHBondContact CA-OG1 3.46Å; R36-T39 PolarHBondContact O-N 3.03Å; R36-T39 PolarHBondContact O-OG1 3.48Å; R36-Q40 WeakPolarHBondContact O-CG 3.46Å; R36-Q40 PolarHBondContact O-N 3.23Å
37	L	76.6	Confident	79.5	Confident	102 Å²	102	114.9 Å²	114.9	53%	0.534	56%	0.564	S	S	.	*	H	α-helix	trans	-65.7	-35.4	177	-70.3	170.2	0	0	0	112.3	E33 T39 Q40	E33-L37 WeakPolarHBondContact O-CB 3.5Å; E33-L37 WeakPolarHBondContact O-CG 3.38Å; E33-L37 PolarHBondContact O-N 3.23Å; L37-T39 VanDerWaalsContact C-N 3.33Å; L37-Q40 PolarHBondContact O-N 2.84Å
38	A	74.4	Confident	78.8	Confident	81 Å²	81	118.5 Å²	118.5	67%	0.669	57%	0.574	S	S	*	*	H	α-helix	trans	-69	-31.6	174.4	0	0	0	0	0	112.7	K34 K35 R36	K34-A38 WeakPolarHBondContact O-CB 3.37Å; K34-A38 PolarHBondContact O-N 3.36Å; K35-A38 PolarHBondContact O-N 2.75Å; R36-A38 VanDerWaalsContact C-N 3.34Å
39	T	71.8	Confident	78.2	Confident	98 Å²	98	111.8 Å²	111.8	60%	0.601	55%	0.552	S	S	*	*	H	α-helix	trans	-82.3	-24.9	175.4	48.5	0	0	0	0	113.6	K35 R36 L37 T41	K35-T39 PolarHBondContact O-N 3.16Å; K35-T39 PolarHBondContact O-OG1 2.67Å; K35-T39 VanDerWaalsContact O-OG1 3.07Å; R36-T39 WeakPolarHBondContact CA-OG1 3.46Å; R36-T39 PolarHBondContact O-N 3.03Å; R36-T39 PolarHBondContact O-OG1 3.48Å; L37-T39 VanDerWaalsContact C-N 3.33Å; T39-T41 PolarHBondContact O-N 2.99Å
40	Q	66.1	Low	77.8	Confident	102 Å²	102	111.3 Å²	111.3	48%	0.477	56%	0.559	S	S	.	*	S	Bend	trans	-68.6	88	161.7	-72.2	176.4	-13.5	0	0	105.4	R36 L37 P42	R36-Q40 WeakPolarHBondContact O-CG 3.46Å; R36-Q40 PolarHBondContact O-N 3.23Å; L37-Q40 PolarHBondContact O-N 2.84Å; Q40-P42 VanDerWaalsContact O-CD 3.25Å; Q40-P42 WeakPolarHBondContact O-CD 3.25Å
41	T	61.6	Low	77.5	Confident	120 Å²	120	110.9 Å²	110.9	74%	0.736	56%	0.561	S	S	*	*			trans	-44	114.6	157	35.5	0	0	0	0	104.6	T39 H43	T39-T41 PolarHBondContact O-N 2.99Å; T41-H43 PolarHBondContact O-N 2.86Å
42	P	61.4	Low	77.1	Confident	90 Å²	90	113 Å²	113	58%	0.584	56%	0.56	S	S	*	*			trans	-51.3	127.3	175.5	21.7	-31.4	0	0	0	104.1	Q40 L44	Q40-P42 VanDerWaalsContact O-CD 3.25Å; Q40-P42 WeakPolarHBondContact O-CD 3.25Å; P42-L44 HydrophobicContact CB-CD1 4.37Å; P42-L44 HydrophobicContact CB-CD2 4.43Å; P42-L44 HydrophobicContact CB-CG 3.87Å; P42-L44 HydrophobicContact CG-CD1 3.65Å; P42-L44 HydrophobicContact CG-CD2 4.44Å; P42-L44 HydrophobicContact CG-CG 3.72Å; P42-L44 PolarHBondContact O-N 2.63Å
43	H	61.2	Low	76.8	Confident	192 Å²	192	113.4 Å²	113.4	89%	0.889	56%	0.562	S	S	*	*			trans	-67.2	73.3	166.9	-163.6	49.8	0	0	0	104.1	T41 D45	T41-H43 PolarHBondContact O-N 2.86Å; H43-D45 PolarHBondContact O-N 2.94Å
44	L	63.3	Low	76.8	Confident	98 Å²	98	118.2 Å²	118.2	51%	0.513	58%	0.582	S	S	.	*			trans	-67.2	98	172.1	-79.4	161.3	0	0	0	101.1	P42 E46 I49	P42-L44 HydrophobicContact CB-CD1 4.37Å; P42-L44 HydrophobicContact CB-CD2 4.43Å; P42-L44 HydrophobicContact CB-CG 3.87Å; P42-L44 HydrophobicContact CG-CD1 3.65Å; P42-L44 HydrophobicContact CG-CD2 4.44Å; P42-L44 HydrophobicContact CG-CG 3.72Å; P42-L44 PolarHBondContact O-N 2.63Å; L44-E46 PolarHBondContact O-N 2.94Å; L44-I49 HydrophobicContact CB-CD1 3.64Å; L44-I49 HydrophobicContact CB-CG1 4.36Å; L44-I49 HydrophobicContact CD1-CD1 4.1Å; L44-I49 HydrophobicContact CD2-CD1 3.93Å; L44-I49 HydrophobicContact CD2-CG1 4.28Å; L44-I49 HydrophobicContact CG-CD1 4.05Å
45	D	75.6	Confident	76.7	Confident	87 Å²	87	117.6 Å²	117.6	47%	0.465	58%	0.582	S	S	.	*			trans	-53	109.2	168.7	-172.5	-6.4	0	0	0	106.1	H43 D47 Y48 I49	H43-D45 PolarHBondContact O-N 2.94Å; D45-D47 PolarHBondContact O-N 2.9Å; D45-D47 WeakPolarHBondContact OD1-CB 3.43Å; D45-D47 PolarHBondContact OD1-N 3.49Å; D45-Y48 WeakPolarHBondContact O-CB 3.44Å; D45-Y48 PolarHBondContact O-N 2.9Å; D45-I49 PolarHBondContact O-N 3.2Å
46	E	76.6	Confident	76.5	Confident	158 Å²	158	113.4 Å²	113.4	74%	0.738	57%	0.569	S	S	*	*	H	α-helix	trans	-57.5	-32.3	-176.9	-74.7	-176.5	171.4	0	0	109.6	L44 I49 L50	L44-E46 PolarHBondContact O-N 2.94Å; E46-I49 PolarHBondContact O-N 3.32Å; E46-L50 WeakPolarHBondContact O-CB 3.44Å; E46-L50 PolarHBondContact O-N 3.06Å
47	D	82.6	Confident	76.3	Confident	123 Å²	123	110.7 Å²	110.7	66%	0.658	57%	0.566	S	S	*	*	H	α-helix	trans	-63.8	-44.1	176.3	-67.4	-22.8	0	0	0	111.1	D45 I49 L50 E51	D45-D47 PolarHBondContact O-N 2.9Å; D45-D47 WeakPolarHBondContact OD1-CB 3.43Å; D45-D47 PolarHBondContact OD1-N 3.49Å; D47-I49 PolarHBondContact O-N 3.27Å; D47-L50 PolarHBondContact O-N 3.4Å; D47-E51 WeakPolarHBondContact O-CB 3.27Å; D47-E51 PolarHBondContact O-N 3.37Å
48	Y	80.7	Confident	76.4	Confident	147 Å²	147	109.9 Å²	109.9	58%	0.576	56%	0.559	S	S	*	*	H	α-helix	trans	-63	-42.5	175.3	176.5	-99.7	0	0	0	112.2	D45 L50 E51 F52	D45-Y48 WeakPolarHBondContact O-CB 3.44Å; D45-Y48 PolarHBondContact O-N 2.9Å; Y48-L50 VanDerWaalsContact C-N 3.32Å; Y48-L50 PolarHBondContact O-N 3.45Å; Y48-E51 PolarHBondContact O-N 3.49Å; Y48-F52 WeakPolarHBondContact O-CB 3.46Å; Y48-F52 PolarHBondContact O-N 3.02Å
49	I	80.1	Confident	76.2	Confident	57 Å²	57	108.7 Å²	108.7	29%	0.292	55%	0.546	S	S	.	.	H	α-helix	trans	-60.8	-46.2	175.7	-71.2	-176.3	0	0	0	110.1	L44 D45 E46 D47 E51 F52 Y53	L44-I49 HydrophobicContact CB-CD1 3.64Å; L44-I49 HydrophobicContact CB-CG1 4.36Å; L44-I49 HydrophobicContact CD1-CD1 4.1Å; L44-I49 HydrophobicContact CD2-CD1 3.93Å; L44-I49 HydrophobicContact CD2-CG1 4.28Å; L44-I49 HydrophobicContact CG-CD1 4.05Å; D45-I49 PolarHBondContact O-N 3.2Å; E46-I49 PolarHBondContact O-N 3.32Å; D47-I49 PolarHBondContact O-N 3.27Å; I49-E51 VanDerWaalsContact C-N 3.34Å; I49-E51 PolarHBondContact O-N 2.94Å; I49-F52 PolarHBondContact O-N 3.42Å; I49-Y53 HydrophobicContact CG2-CD2 3.58Å; I49-Y53 HydrophobicContact CG2-CE2 3.65Å; I49-Y53 VanDerWaalsContact O-CD2 3.27Å; I49-Y53 WeakPolarHBondContact O-CD2 3.41Å; I49-Y53 PolarHBondContact O-N 3.41Å
50	L	85.5	Confident	75.8	Confident	129 Å²	129	107.5 Å²	107.5	68%	0.675	54%	0.542	S	S	*	.	H	α-helix	trans	-63.1	-43.6	-178	-134.4	103.6	0	0	0	111	E46 D47 Y48 Y53 K54	E46-L50 WeakPolarHBondContact O-CB 3.44Å; E46-L50 PolarHBondContact O-N 3.06Å; D47-L50 PolarHBondContact O-N 3.4Å; Y48-L50 VanDerWaalsContact C-N 3.32Å; Y48-L50 PolarHBondContact O-N 3.45Å; L50-Y53 PolarHBondContact O-N 2.9Å; L50-K54 VanDerWaalsContact O-CB 3.3Å; L50-K54 WeakPolarHBondContact O-CB 3.3Å; L50-K54 PolarHBondContact O-N 2.84Å
51	E	85.8	Confident	75.5	Confident	120 Å²	120	112.9 Å²	112.9	56%	0.561	56%	0.558	S	S	*	*	H	α-helix	trans	-63.2	-45.9	177	-170.7	166.7	-147.1	0	0	111.2	D47 Y48 I49 Y53 K54 E55	D47-E51 WeakPolarHBondContact O-CB 3.27Å; D47-E51 PolarHBondContact O-N 3.37Å; Y48-E51 PolarHBondContact O-N 3.49Å; I49-E51 VanDerWaalsContact C-N 3.34Å; I49-E51 PolarHBondContact O-N 2.94Å; E51-Y53 PolarHBondContact O-N 3.27Å; E51-K54 WeakPolarHBondContact O-CB 3.33Å; E51-K54 PolarHBondContact O-N 3.48Å; E51-K54 VanDerWaalsContact O-N 3.14Å; E51-E55 WeakPolarHBondContact O-CG 3.42Å; E51-E55 PolarHBondContact O-N 2.82Å
52	F	83.9	Confident	75.5	Confident	101 Å²	101	115.2 Å²	115.2	44%	0.443	56%	0.558	S	S	.	*	H	α-helix	trans	-57.3	-48.4	174.6	175.1	-98.1	0	0	0	112.1	Y48 I49 K54 E55 V56	Y48-F52 WeakPolarHBondContact O-CB 3.46Å; Y48-F52 PolarHBondContact O-N 3.02Å; I49-F52 PolarHBondContact O-N 3.42Å; F52-K54 VanDerWaalsContact C-N 3.29Å; F52-K54 PolarHBondContact O-N 3.49Å; F52-E55 PolarHBondContact O-N 2.89Å; F52-V56 HydrophobicContact CD1-CG2 4.33Å; F52-V56 HydrophobicContact CD2-CG2 4.39Å; F52-V56 HydrophobicContact CE1-CG2 3.9Å; F52-V56 HydrophobicContact CE2-CG2 3.97Å; F52-V56 HydrophobicContact CZ-CG2 3.71Å; F52-V56 WeakPolarHBondContact O-CB 3.38Å; F52-V56 VanDerWaalsContact O-CG2 3.3Å; F52-V56 WeakPolarHBondContact O-CG2 3.44Å; F52-V56 PolarHBondContact O-N 3.37Å
53	Y	83.5	Confident	75.4	Confident	157 Å²	157	115.3 Å²	115.3	62%	0.616	56%	0.557	S	S	*	*	H	α-helix	trans	-63.9	-36.8	177.3	-87.7	-70.6	0	0	0	112.3	I49 L50 E51 V56 S57	I49-Y53 HydrophobicContact CG2-CD2 3.58Å; I49-Y53 HydrophobicContact CG2-CE2 3.65Å; I49-Y53 VanDerWaalsContact O-CD2 3.27Å; I49-Y53 WeakPolarHBondContact O-CD2 3.41Å; I49-Y53 PolarHBondContact O-N 3.41Å; L50-Y53 PolarHBondContact O-N 2.9Å; E51-Y53 PolarHBondContact O-N 3.27Å; Y53-V56 PolarHBondContact O-N 3.2Å; Y53-S57 VanDerWaalsContact O-CB 3.27Å; Y53-S57 WeakPolarHBondContact O-CB 3.26Å; Y53-S57 PolarHBondContact O-N 2.88Å; Y53-S57 PolarHBondContact O-OG 3.49Å
54	K	88	Confident	75.3	Confident	128 Å²	128	114 Å²	114	56%	0.557	55%	0.551	S	S	*	*	H	α-helix	trans	-63.7	-49.8	176.1	-170	-179.7	177.5	-171.7	0	110.6	L50 E51 F52 V56 S57 E58	L50-K54 VanDerWaalsContact O-CB 3.3Å; L50-K54 WeakPolarHBondContact O-CB 3.3Å; L50-K54 PolarHBondContact O-N 2.84Å; E51-K54 WeakPolarHBondContact O-CB 3.33Å; E51-K54 PolarHBondContact O-N 3.48Å; E51-K54 VanDerWaalsContact O-N 3.14Å; F52-K54 VanDerWaalsContact C-N 3.29Å; F52-K54 PolarHBondContact O-N 3.49Å; K54-V56 PolarHBondContact O-N 2.8Å; K54-S57 PolarHBondContact O-N 3.43Å; K54-S57 PolarHBondContact O-OG 2.8Å; K54-E58 WeakPolarHBondContact CE-OE1 3.27Å; K54-E58 WeakPolarHBondContact O-CG 3.3Å; K54-E58 PolarHBondContact O-N 3.34Å
55	E	83.9	Confident	75.1	Confident	120 Å²	120	119.3 Å²	119.3	56%	0.561	56%	0.564	S	S	*	*	H	α-helix	trans	-58	-45.8	175.4	-73.7	-172.2	164.5	0	0	112	E51 F52 S57 E58 S59	E51-E55 WeakPolarHBondContact O-CG 3.42Å; E51-E55 PolarHBondContact O-N 2.82Å; F52-E55 PolarHBondContact O-N 2.89Å; E55-S57 PolarHBondContact O-N 3.14Å; E55-E58 PolarHBondContact O-N 3.29Å; E55-S59 VanDerWaalsContact O-CB 3.26Å; E55-S59 WeakPolarHBondContact O-CB 3.42Å; E55-S59 PolarHBondContact O-N 3.36Å; E55-S59 PolarHBondContact O-OG 3.02Å
56	V	81.1	Confident	74.3	Confident	64 Å²	64	120 Å²	120	39%	0.388	57%	0.572	S	S	.	*	H	α-helix	trans	-62.4	-44.7	177	170.8	0	0	0	0	110.5	F52 Y53 K54 E58 S59 S60	F52-V56 HydrophobicContact CD1-CG2 4.33Å; F52-V56 HydrophobicContact CD2-CG2 4.39Å; F52-V56 HydrophobicContact CE1-CG2 3.9Å; F52-V56 HydrophobicContact CE2-CG2 3.97Å; F52-V56 HydrophobicContact CZ-CG2 3.71Å; F52-V56 WeakPolarHBondContact O-CB 3.38Å; F52-V56 VanDerWaalsContact O-CG2 3.3Å; F52-V56 WeakPolarHBondContact O-CG2 3.44Å; F52-V56 PolarHBondContact O-N 3.37Å; Y53-V56 PolarHBondContact O-N 3.2Å; K54-V56 PolarHBondContact O-N 2.8Å; V56-E58 PolarHBondContact O-N 3.47Å; V56-S59 WeakPolarHBondContact CA-OG 3.42Å; V56-S59 PolarHBondContact O-N 2.75Å; V56-S59 PolarHBondContact O-OG 3.13Å; V56-S60 WeakPolarHBondContact O-CB 3.35Å; V56-S60 PolarHBondContact O-N 3.36Å; V56-S60 PolarHBondContact O-OG 2.84Å
57	S	78.8	Confident	73.5	Confident	50 Å²	50	114.6 Å²	114.6	35%	0.35	55%	0.548	S	S	.	.	H	α-helix	trans	-63.3	-42	178.7	77.1	0	0	0	0	111.9	Y53 K54 E55 S60 R61	Y53-S57 VanDerWaalsContact O-CB 3.27Å; Y53-S57 WeakPolarHBondContact O-CB 3.26Å; Y53-S57 PolarHBondContact O-N 2.88Å; Y53-S57 PolarHBondContact O-OG 3.49Å; K54-S57 PolarHBondContact O-N 3.43Å; K54-S57 PolarHBondContact O-OG 2.8Å; E55-S57 PolarHBondContact O-N 3.14Å; S57-S60 PolarHBondContact O-N 2.89Å; S57-S60 PolarHBondContact O-OG 2.96Å; S57-R61 WeakPolarHBondContact O-CG 3.33Å; S57-R61 PolarHBondContact O-N 2.78Å
58	E	78.3	Confident	72.6	Confident	85 Å²	85	118.2 Å²	118.2	40%	0.397	56%	0.558	S	S	.	*	H	α-helix	trans	-67.7	-40.2	176	-72.5	-176.5	-166.5	0	0	111.7	K54 E55 V56 R61 K62	K54-E58 WeakPolarHBondContact CE-OE1 3.27Å; K54-E58 WeakPolarHBondContact O-CG 3.3Å; K54-E58 PolarHBondContact O-N 3.34Å; E55-E58 PolarHBondContact O-N 3.29Å; V56-E58 PolarHBondContact O-N 3.47Å; E58-R61 PolarHBondContact O-N 3.06Å; E58-K62 WeakPolarHBondContact O-CG 3.47Å; E58-K62 PolarHBondContact O-N 2.74Å
59	S	69.2	Low	71.8	Confident	56 Å²	56	122.3 Å²	122.3	39%	0.392	57%	0.572	S	S	.	*	H	α-helix	trans	-65.9	-37.6	176.1	78.1	0	0	0	0	112	E55 V56 R61 K62 T63	E55-S59 VanDerWaalsContact O-CB 3.26Å; E55-S59 WeakPolarHBondContact O-CB 3.42Å; E55-S59 PolarHBondContact O-N 3.36Å; E55-S59 PolarHBondContact O-OG 3.02Å; V56-S59 WeakPolarHBondContact CA-OG 3.42Å; V56-S59 PolarHBondContact O-N 2.75Å; V56-S59 PolarHBondContact O-OG 3.13Å; S59-R61 VanDerWaalsContact C-N 3.35Å; S59-K62 PolarHBondContact O-N 2.94Å; S59-T63 WeakPolarHBondContact O-CB 3.45Å; S59-T63 PolarHBondContact O-N 3.03Å; S59-T63 PolarHBondContact O-OG1 3.36Å
60	S	63.5	Low	70.6	Confident	73 Å²	73	122.9 Å²	122.9	51%	0.51	58%	0.578	S	S	.	*	H	α-helix	trans	-69.5	-32.1	176.2	71.8	0	0	0	0	112.4	V56 S57 T63	V56-S60 WeakPolarHBondContact O-CB 3.35Å; V56-S60 PolarHBondContact O-N 3.36Å; V56-S60 PolarHBondContact O-OG 2.84Å; S57-S60 PolarHBondContact O-N 2.89Å; S57-S60 PolarHBondContact O-OG 2.96Å; S60-T63 CarbonylContact O-C 3.55Å; S60-T63 VanDerWaalsContact O-O 3.09Å
61	R	61.1	Low	69.6	Low	216 Å²	216	125.2 Å²	125.2	82%	0.815	59%	0.591	S	S	*	*	H	α-helix	trans	-70.5	-34.5	172	-77.6	179	176.7	174.7	0.7	112.1	S57 E58 S59	S57-R61 WeakPolarHBondContact O-CG 3.33Å; S57-R61 PolarHBondContact O-N 2.78Å; E58-R61 PolarHBondContact O-N 3.06Å; S59-R61 VanDerWaalsContact C-N 3.35Å
62	K	60.3	Low	68.5	Low	169 Å²	169	127.4 Å²	127.4	74%	0.735	60%	0.595	S	S	*	*	H	α-helix	trans	-76.7	-33	176.8	-70.7	173.9	-173.3	173	0	112.5	E58 S59	E58-K62 WeakPolarHBondContact O-CG 3.47Å; E58-K62 PolarHBondContact O-N 2.74Å; S59-K62 PolarHBondContact O-N 2.94Å
63	T	60.2	Low	67.4	Low	91 Å²	91	128.3 Å²	128.3	56%	0.558	61%	0.61	S	S	*	*	S	Bend	trans	-102.1	83.9	-177.2	-36.5	0	0	0	0	107.9	S59 S60 W65	S59-T63 WeakPolarHBondContact O-CB 3.45Å; S59-T63 PolarHBondContact O-N 3.03Å; S59-T63 PolarHBondContact O-OG1 3.36Å; S60-T63 CarbonylContact O-C 3.55Å; S60-T63 VanDerWaalsContact O-O 3.09Å; T63-W65 PolarHBondContact O-N 3.33Å
64	E	60	Low	66.3	Low	165 Å²	165	130.6 Å²	130.6	77%	0.771	62%	0.618	S	S	*	*			trans	-47.7	115.5	164.6	-107.6	-178.4	177.3	0	0	107.8	T66	E64-T66 PolarHBondContact O-N 2.75Å
65	W	58.9	Low	64.7	Low	210 Å²	210	127.6 Å²	127.6	80%	0.795	62%	0.623	S	S	*	*			trans	-72.4	82.9	-178.3	-154.4	88.4	0	0	0	108	T63 N67	T63-W65 PolarHBondContact O-N 3.33Å; W65-N67 HydrophobicContact CE3-CB 3.97Å; W65-N67 HydrophobicContact CZ3-CB 3.62Å; W65-N67 PolarHBondContact O-N 3.41Å
66	T	58.4	Low	62.8	Low	100 Å²	100	134.8 Å²	134.8	61%	0.613	66%	0.657	S	S	*	*			trans	-72.2	103.3	173.8	48.9	0	0	0	0	107.1	E64 K68	E64-T66 PolarHBondContact O-N 2.75Å; T66-K68 VanDerWaalsContact C-N 3.28Å; T66-K68 PolarHBondContact O-N 2.83Å
67	N	59.4	Low	61.9	Low	45 Å²	45	138.3 Å²	138.3	24%	0.241	67%	0.67	C	S	.	*			trans	-64	91.6	174	-173	-10.5	0	0	0	109	W65 R69 V70	W65-N67 HydrophobicContact CE3-CB 3.97Å; W65-N67 HydrophobicContact CZ3-CB 3.62Å; W65-N67 PolarHBondContact O-N 3.41Å; N67-R69 PolarHBondContact O-N 3.26Å; N67-R69 WeakPolarHBondContact OD1-CB 3.33Å; N67-R69 PolarHBondContact OD1-N 3.03Å; N67-R69 VanDerWaalsContact OD1-N 3.13Å; N67-V70 PolarHBondContact O-N 2.75Å
68	K	63.1	Low	61	Low	199 Å²	199	142.9 Å²	142.9	87%	0.865	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.3	-16.6	179.8	-68.7	-169.2	179.4	-176.2	0	113.6	T66	T66-K68 VanDerWaalsContact C-N 3.28Å; T66-K68 PolarHBondContact O-N 2.83Å
69	R	64.6	Low	60	Low	234 Å²	234	146.2 Å²	146.2	88%	0.883	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.3	-19.8	179.1	-58.9	-174.3	176.2	-132.7	0.4	113	N67	N67-R69 PolarHBondContact O-N 3.26Å; N67-R69 WeakPolarHBondContact OD1-CB 3.33Å; N67-R69 PolarHBondContact OD1-N 3.03Å; N67-R69 VanDerWaalsContact OD1-N 3.13Å
70	V	55.4	Low	59.5	Low	69 Å²	69	151.5 Å²	151.5	42%	0.418	72%	0.722	S	S	.	*			trans	-134	104.8	-176.3	-167.4	0	0	0	0	109.1	N67 R72	N67-V70 PolarHBondContact O-N 2.75Å; V70-R72 HydrophobicContact CG1-CB 4.38Å; V70-R72 HydrophobicContact CG1-CG 3.78Å; V70-R72 PolarHBondContact O-N 2.9Å
71	N	63.6	Low	59.3	Low	178 Å²	178	156.4 Å²	156.4	95%	0.952	74%	0.735	S	S	*	*			trans	-78.6	42	-176.3	-150.9	26.5	0	0	0	112.7
72	R	62.7	Low	59.1	Low	166 Å²	166	152.4 Å²	152.4	63%	0.626	73%	0.73	S	S	*	*	S	Bend	trans	-117.4	132.9	176	80.6	-172.7	-168.5	-174.2	4.3	109.1	V70 W74	V70-R72 HydrophobicContact CG1-CB 4.38Å; V70-R72 HydrophobicContact CG1-CG 3.78Å; V70-R72 PolarHBondContact O-N 2.9Å; R72-W74 PolarHBondContact O-N 2.89Å
73	P	62	Low	59	Low	119 Å²	119	151.2 Å²	151.2	77%	0.773	73%	0.729	S	S	*	*			trans	-58.1	137.1	168.1	24.7	-30.6	0	0	0	108.4	G75	P73-G75 PolarHBondContact O-N 3.42Å
74	W	59.8	Low	59	Low	205 Å²	205	155.8 Å²	155.8	78%	0.777	74%	0.742	S	S	*	*			trans	-69.2	87.9	165.5	-78.3	87.8	0	0	0	106.6	R72	R72-W74 PolarHBondContact O-N 2.89Å
75	G	54.8	Low	58.9	Low	65 Å²	65	155.1 Å²	155.1	67%	0.67	74%	0.74	S	S	*	*			trans	-74.8	130	170.3	0	0	0	0	0	109.7	P73	P73-G75 PolarHBondContact O-N 3.42Å
76	E	43.9	Very low	58.9	Low	271 Å²	271	150.1 Å²	150.1	100%	1.266	74%	0.735	S	S	*	*			trans	-73	0	139.6	-70	-179.1	170.2	0	0	109.4

Retrieved 76 of 76 residues in 44.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).