A0A5K4FC73_SCHMA Loading...

Secreted protein AlphaSync

AlphaFold DB , UniProt , Accession A0A5K4FC73, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 87 aa.

						>A0A5K4FC73_SCHMA|A0A5K4FC73
MNLNCLCLLTLVAIIHVSAKRNTTEDSVGFNLHNGHVLNVTNNLKEGEKKTGSDSNERGKNGKGNKRKGVQRVKPGSKSFSYFIHLT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.6	Low	60.4	Low	244 Å²	244	114.1 Å²	114.1	100%	1.202	62%	0.616	S	S	*	*				0	118.2	0	-71.6	-172.3	160.6	0	0	107.5	L3	M1-L3 PolarHBondContact O-N 3.12Å
2	N	50.9	Low	61	Low	137 Å²	137	112.6 Å²	112.6	73%	0.733	61%	0.613	S	S	*	*			trans	-69.3	97.6	-175.5	-88.5	-45.3	0	0	0	109.8	N4 C5	N2-N4 PolarHBondContact O-N 3.02Å; N2-N4 VanDerWaalsContact O-N 3.12Å; N2-C5 HydrophobicContact CB-CB 4.23Å; N2-C5 WeakPolarHBondContact O-CB 3.38Å; N2-C5 PolarHBondContact O-N 3.49Å
3	L	61	Low	61.2	Low	129 Å²	129	107.9 Å²	107.9	68%	0.675	60%	0.599	S	S	*	*	H	α-helix	trans	-53.1	-32.9	179.5	-161	68.7	0	0	0	111.6	M1 C5 L6 C7	M1-L3 PolarHBondContact O-N 3.12Å; L3-C5 VanDerWaalsContact C-N 3.31Å; L3-C5 PolarHBondContact O-N 2.98Å; L3-L6 WeakPolarHBondContact O-CB 3.39Å; L3-L6 PolarHBondContact O-N 3.43Å; L3-L6 VanDerWaalsContact O-N 3.16Å; L3-C7 PolarHBondContact O-N 2.78Å
4	N	55.5	Low	61.3	Low	124 Å²	124	105.8 Å²	105.8	66%	0.663	59%	0.585	S	S	*	*	H	α-helix	trans	-62.8	-31.7	176	-64.5	-18.9	0	0	0	113.9	N2 L6 C7 L8	N2-N4 PolarHBondContact O-N 3.02Å; N2-N4 VanDerWaalsContact O-N 3.12Å; N4-L6 VanDerWaalsContact C-N 3.32Å; N4-C7 PolarHBondContact O-N 3.07Å; N4-L8 PolarHBondContact O-N 3.43Å
5	C	57.5	Low	61.5	Low	71 Å²	71	106.7 Å²	106.7	48%	0.48	59%	0.587	S	S	.	*	H	α-helix	trans	-71.4	-33.2	178	-166.6	0	0	0	0	110.8	N2 L3 C7 L8 L9	N2-C5 HydrophobicContact CB-CB 4.23Å; N2-C5 WeakPolarHBondContact O-CB 3.38Å; N2-C5 PolarHBondContact O-N 3.49Å; L3-C5 VanDerWaalsContact C-N 3.31Å; L3-C5 PolarHBondContact O-N 2.98Å; C5-C7 VanDerWaalsContact C-N 3.34Å; C5-C7 PolarHBondContact O-N 3.34Å; C5-L8 PolarHBondContact O-N 3.09Å; C5-L9 VanDerWaalsContact O-CG 3.32Å; C5-L9 WeakPolarHBondContact O-CG 3.41Å; C5-L9 PolarHBondContact O-N 2.96Å
6	L	59.9	Low	61.5	Low	113 Å²	113	107.9 Å²	107.9	59%	0.592	59%	0.587	S	S	*	*	H	α-helix	trans	-65.5	-38.6	175.7	-156.7	79.2	0	0	0	111.4	L3 N4 L9 T10	L3-L6 WeakPolarHBondContact O-CB 3.39Å; L3-L6 PolarHBondContact O-N 3.43Å; L3-L6 VanDerWaalsContact O-N 3.16Å; N4-L6 VanDerWaalsContact C-N 3.32Å; L6-L9 PolarHBondContact O-N 3.37Å; L6-T10 PolarHBondContact O-N 3.14Å; L6-T10 PolarHBondContact O-OG1 2.82Å
7	C	64.3	Low	61.2	Low	51 Å²	51	105.6 Å²	105.6	35%	0.345	58%	0.577	S	S	.	*	H	α-helix	trans	-66	-37.4	175.9	-67.3	0	0	0	0	113	L3 N4 C5 T10 L11	L3-C7 PolarHBondContact O-N 2.78Å; N4-C7 PolarHBondContact O-N 3.07Å; C5-C7 VanDerWaalsContact C-N 3.34Å; C5-C7 PolarHBondContact O-N 3.34Å; C7-T10 WeakPolarHBondContact CA-OG1 3.42Å; C7-T10 PolarHBondContact O-OG1 2.79Å; C7-L11 WeakPolarHBondContact O-CG 3.39Å; C7-L11 PolarHBondContact O-N 2.82Å; C7-L11 VanDerWaalsContact O-N 3.11Å
8	L	64.8	Low	60.6	Low	114 Å²	114	102.1 Å²	102.1	60%	0.597	56%	0.561	S	S	*	*	H	α-helix	trans	-69.2	-39.3	175.5	-69.9	171.7	0	0	0	111.5	N4 C5 T10 L11 V12	N4-L8 PolarHBondContact O-N 3.43Å; C5-L8 PolarHBondContact O-N 3.09Å; L8-T10 PolarHBondContact O-N 3.14Å; L8-L11 PolarHBondContact O-N 2.98Å; L8-V12 WeakPolarHBondContact O-CG2 3.2Å; L8-V12 PolarHBondContact O-N 3.27Å
9	L	66.7	Low	60.1	Low	111 Å²	111	100.2 Å²	100.2	58%	0.581	56%	0.56	S	S	*	*	H	α-helix	trans	-63.4	-40.2	176.2	-71.9	170.5	0	0	0	112.1	C5 L6 A13	C5-L9 VanDerWaalsContact O-CG 3.32Å; C5-L9 WeakPolarHBondContact O-CG 3.41Å; C5-L9 PolarHBondContact O-N 2.96Å; L6-L9 PolarHBondContact O-N 3.37Å; L9-A13 VanDerWaalsContact O-CB 3.31Å; L9-A13 WeakPolarHBondContact O-CB 3.28Å; L9-A13 PolarHBondContact O-N 2.81Å
10	T	66.5	Low	59.7	Low	77 Å²	77	103.6 Å²	103.6	47%	0.472	57%	0.569	S	S	.	*	H	α-helix	trans	-68.7	-39.2	176.3	41.1	0	0	0	0	112.3	L6 C7 L8 A13 I14	L6-T10 PolarHBondContact O-N 3.14Å; L6-T10 PolarHBondContact O-OG1 2.82Å; C7-T10 WeakPolarHBondContact CA-OG1 3.42Å; C7-T10 PolarHBondContact O-OG1 2.79Å; L8-T10 PolarHBondContact O-N 3.14Å; T10-A13 PolarHBondContact O-N 3.33Å; T10-I14 WeakPolarHBondContact O-CD1 3.42Å; T10-I14 WeakPolarHBondContact O-CG1 3.29Å; T10-I14 PolarHBondContact O-N 3.42Å
11	L	66.2	Low	59.1	Low	84 Å²	84	106.7 Å²	106.7	44%	0.44	57%	0.572	S	S	.	*	H	α-helix	trans	-61.5	-46.2	173.9	-75	169.9	0	0	0	112.3	C7 L8 A13 I14 I15	C7-L11 WeakPolarHBondContact O-CG 3.39Å; C7-L11 PolarHBondContact O-N 2.82Å; C7-L11 VanDerWaalsContact O-N 3.11Å; L8-L11 PolarHBondContact O-N 2.98Å; L11-A13 VanDerWaalsContact C-N 3.34Å; L11-A13 PolarHBondContact O-N 2.86Å; L11-I14 PolarHBondContact O-N 2.97Å; L11-I15 WeakPolarHBondContact O-CG1 3.48Å; L11-I15 PolarHBondContact O-N 2.62Å
12	V	67.5	Low	59	Low	96 Å²	96	100.6 Å²	100.6	58%	0.582	54%	0.544	S	S	*	.	H	α-helix	trans	-63.9	-40.5	177.1	173.8	0	0	0	0	111.1	L8 I14 I15 H16	L8-V12 WeakPolarHBondContact O-CG2 3.2Å; L8-V12 PolarHBondContact O-N 3.27Å; V12-I14 PolarHBondContact O-N 3.44Å; V12-I15 PolarHBondContact O-N 2.97Å; V12-H16 VanDerWaalsContact O-CB 3.28Å; V12-H16 WeakPolarHBondContact O-CB 3.31Å; V12-H16 PolarHBondContact O-N 3.02Å
13	A	62.8	Low	58.9	Low	52 Å²	52	100.3 Å²	100.3	43%	0.43	55%	0.548	S	S	.	.	H	α-helix	trans	-63	-40.6	176.8	0	0	0	0	0	112.1	L9 T10 L11 H16 V17	L9-A13 VanDerWaalsContact O-CB 3.31Å; L9-A13 WeakPolarHBondContact O-CB 3.28Å; L9-A13 PolarHBondContact O-N 2.81Å; T10-A13 PolarHBondContact O-N 3.33Å; L11-A13 VanDerWaalsContact C-N 3.34Å; L11-A13 PolarHBondContact O-N 2.86Å; A13-H16 PolarHBondContact O-N 3.14Å; A13-V17 WeakPolarHBondContact O-CB 3.41Å; A13-V17 WeakPolarHBondContact O-CG2 3.39Å; A13-V17 PolarHBondContact O-N 3.46Å
14	I	63.6	Low	58.2	Low	78 Å²	78	98.3 Å²	98.3	40%	0.4	54%	0.541	S	S	.	.	H	α-helix	trans	-63.7	-46.4	176.4	-67.8	161.8	0	0	0	110.5	T10 L11 V12 H16 V17 S18 F30	T10-I14 WeakPolarHBondContact O-CD1 3.42Å; T10-I14 WeakPolarHBondContact O-CG1 3.29Å; T10-I14 PolarHBondContact O-N 3.42Å; L11-I14 PolarHBondContact O-N 2.97Å; V12-I14 PolarHBondContact O-N 3.44Å; I14-H16 PolarHBondContact O-N 3.33Å; I14-V17 PolarHBondContact O-N 3.46Å; I14-S18 PolarHBondContact O-N 3.43Å; I14-S18 PolarHBondContact O-OG 3.43Å; I14-F30 HydrophobicContact CG2-CE1 4.12Å; I14-F30 HydrophobicContact CG2-CE2 3.88Å; I14-F30 HydrophobicContact CG2-CZ 3.46Å; I14-F30 VanDerWaalsContact CG2-CZ 3.46Å
15	I	64.3	Low	57.9	Low	119 Å²	119	101.7 Å²	101.7	61%	0.61	55%	0.553	S	S	*	*	H	α-helix	trans	-64.4	-41.6	178	-64	165.4	0	0	0	111	L11 V12 S18 A19	L11-I15 WeakPolarHBondContact O-CG1 3.48Å; L11-I15 PolarHBondContact O-N 2.62Å; V12-I15 PolarHBondContact O-N 2.97Å; I15-S18 PolarHBondContact O-N 3.27Å; I15-A19 WeakPolarHBondContact O-CB 3.19Å; I15-A19 PolarHBondContact O-N 3.42Å
16	H	61	Low	57.3	Low	126 Å²	126	102.8 Å²	102.8	58%	0.583	55%	0.554	S	S	*	*	H	α-helix	trans	-67.8	-37.5	-179.8	-168.8	46.1	0	0	0	112.3	V12 A13 I14 A19 K20	V12-H16 VanDerWaalsContact O-CB 3.28Å; V12-H16 WeakPolarHBondContact O-CB 3.31Å; V12-H16 PolarHBondContact O-N 3.02Å; A13-H16 PolarHBondContact O-N 3.14Å; I14-H16 PolarHBondContact O-N 3.33Å; H16-A19 PolarHBondContact O-N 3.45Å; H16-K20 WeakPolarHBondContact O-CB 3.35Å; H16-K20 PolarHBondContact O-N 3.17Å
17	V	56.7	Low	56.6	Low	70 Å²	70	101.8 Å²	101.8	42%	0.424	56%	0.556	S	S	.	*	H	α-helix	trans	-66.7	-39.6	173.1	171.7	0	0	0	0	111	A13 I14 K20 R21	A13-V17 WeakPolarHBondContact O-CB 3.41Å; A13-V17 WeakPolarHBondContact O-CG2 3.39Å; A13-V17 PolarHBondContact O-N 3.46Å; I14-V17 PolarHBondContact O-N 3.46Å; V17-K20 PolarHBondContact O-N 3.28Å; V17-R21 WeakPolarHBondContact O-CG 3.32Å; V17-R21 PolarHBondContact O-N 3.17Å; V17-R21 VanDerWaalsContact O-N 3.14Å
18	S	50.3	Low	55.9	Low	41 Å²	41	102 Å²	102	29%	0.287	56%	0.556	S	S	.	*	H	α-helix	trans	-65.3	-41.4	174.4	-66.1	0	0	0	0	112.3	I14 I15 K20 R21 N22	I14-S18 PolarHBondContact O-N 3.43Å; I14-S18 PolarHBondContact O-OG 3.43Å; I15-S18 PolarHBondContact O-N 3.27Å; S18-K20 PolarHBondContact O-N 3.5Å; S18-R21 PolarHBondContact O-N 2.99Å; S18-N22 PolarHBondContact O-N 2.94Å
19	A	51.3	Low	55.3	Low	66 Å²	66	98.3 Å²	98.3	55%	0.545	55%	0.545	S	S	.	.	H	α-helix	trans	-65.4	-36.8	177	0	0	0	0	0	112.5	I15 H16 R21 N22	I15-A19 WeakPolarHBondContact O-CB 3.19Å; I15-A19 PolarHBondContact O-N 3.42Å; H16-A19 PolarHBondContact O-N 3.45Å; A19-R21 VanDerWaalsContact C-N 3.35Å; A19-N22 PolarHBondContact O-N 2.84Å
20	K	52.3	Low	54.6	Low	168 Å²	168	96.9 Å²	96.9	73%	0.73	53%	0.534	S	S	*	.	H	α-helix	trans	-75.9	-20.1	178.7	-165.4	165.9	-176.8	173.2	0	113.6	H16 V17 S18	H16-K20 WeakPolarHBondContact O-CB 3.35Å; H16-K20 PolarHBondContact O-N 3.17Å; V17-K20 PolarHBondContact O-N 3.28Å; S18-K20 PolarHBondContact O-N 3.5Å
21	R	46.9	Very low	53.8	Low	169 Å²	169	99 Å²	99	64%	0.638	54%	0.543	S	S	*	.	H	α-helix	trans	-91.6	-6.4	174.7	-72	-177.1	174.6	166.1	-0.1	113.7	V17 S18 A19 T23	V17-R21 WeakPolarHBondContact O-CG 3.32Å; V17-R21 PolarHBondContact O-N 3.17Å; V17-R21 VanDerWaalsContact O-N 3.14Å; S18-R21 PolarHBondContact O-N 2.99Å; A19-R21 VanDerWaalsContact C-N 3.35Å; R21-T23 PolarHBondContact O-N 3.28Å
22	N	48	Very low	53.1	Low	116 Å²	116	100 Å²	100	62%	0.62	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.8	25.8	-172.8	-150.2	25.8	0	0	0	115.3	S18 A19	S18-N22 PolarHBondContact O-N 2.94Å; A19-N22 PolarHBondContact O-N 2.84Å
23	T	49.1	Very low	52.2	Low	131 Å²	131	100.8 Å²	100.8	80%	0.804	55%	0.545	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.4	3	169.5	50.5	0	0	0	0	113.3	R21	R21-T23 PolarHBondContact O-N 3.28Å
24	T	47	Very low	51.4	Low	88 Å²	88	105.5 Å²	105.5	54%	0.54	56%	0.563	S	S	.	*	S	Bend	trans	-149.2	98	178.6	36.8	0	0	0	0	108.1	D26	T24-D26 WeakPolarHBondContact O-CB 3.5Å; T24-D26 PolarHBondContact O-N 3.45Å
25	E	49.5	Very low	50.9	Low	194 Å²	194	104.9 Å²	104.9	91%	0.907	58%	0.576	S	S	*	*	S	Bend	trans	32.6	12.1	155.8	-54.1	-167.3	140.2	0	0	122.1	S27	E25-S27 PolarHBondContact O-N 2.97Å
26	D	45.1	Very low	50.1	Low	95 Å²	95	101.3 Å²	101.3	51%	0.508	56%	0.557	S	S	.	*			trans	-103.9	85	-169.1	-73	-25.1	0	0	0	110.3	T24 V28	T24-D26 WeakPolarHBondContact O-CB 3.5Å; T24-D26 PolarHBondContact O-N 3.45Å; D26-V28 PolarHBondContact O-N 2.87Å
27	S	45.4	Very low	49.7	Very low	91 Å²	91	97 Å²	97	64%	0.636	54%	0.54	S	S	*	.			trans	-75.8	99.1	174.1	-57.1	0	0	0	0	110.7	E25 G29	E25-S27 PolarHBondContact O-N 2.97Å; S27-G29 PolarHBondContact O-N 3.36Å
28	V	49.4	Very low	49.4	Very low	56 Å²	56	97.5 Å²	97.5	34%	0.339	54%	0.539	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.1	103.8	164.3	-172.7	0	0	0	0	108.3	D26 F30	D26-V28 PolarHBondContact O-N 2.87Å; V28-F30 HydrophobicContact CB-CE2 4.25Å; V28-F30 HydrophobicContact CG1-CD2 4.36Å; V28-F30 HydrophobicContact CG1-CE1 4.31Å; V28-F30 HydrophobicContact CG1-CE2 3.63Å; V28-F30 HydrophobicContact CG1-CZ 3.61Å
29	G	51.2	Low	49.3	Very low	36 Å²	36	98.5 Å²	98.5	37%	0.371	54%	0.541	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.6	126.3	175.9	0	0	0	0	0	111.3	S27	S27-G29 PolarHBondContact O-N 3.36Å
30	F	52.5	Low	49.3	Very low	81 Å²	81	97.9 Å²	97.9	36%	0.355	53%	0.531	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	120.2	168.7	-62.7	-83.8	0	0	0	108.6	I14 V28 L32 V40	I14-F30 HydrophobicContact CG2-CE1 4.12Å; I14-F30 HydrophobicContact CG2-CE2 3.88Å; I14-F30 HydrophobicContact CG2-CZ 3.46Å; I14-F30 VanDerWaalsContact CG2-CZ 3.46Å; V28-F30 HydrophobicContact CB-CE2 4.25Å; V28-F30 HydrophobicContact CG1-CD2 4.36Å; V28-F30 HydrophobicContact CG1-CE1 4.31Å; V28-F30 HydrophobicContact CG1-CE2 3.63Å; V28-F30 HydrophobicContact CG1-CZ 3.61Å; F30-L32 HydrophobicContact CB-CD1 4.19Å; F30-V40 HydrophobicContact CD1-CG2 4.26Å; F30-V40 HydrophobicContact CE1-CG1 4.28Å; F30-V40 HydrophobicContact CE1-CG2 4.24Å
31	N	50.1	Low	49.2	Very low	122 Å²	122	93 Å²	93	65%	0.652	52%	0.515	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-97.4	103.5	172.4	-122.7	-22.2	0	0	0	108.7	L38	N31-L38 PolarHBondContact O-N 3.5Å; N31-L38 VanDerWaalsContact O-N 3.1Å
32	L	51.9	Low	49.4	Very low	106 Å²	106	89.4 Å²	89.4	56%	0.555	51%	0.508	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.8	126.1	173.4	-77.4	108.4	0	0	0	109.7	F30 H36 V37	F30-L32 HydrophobicContact CB-CD1 4.19Å; L32-H36 WeakPolarHBondContact CA-O 3.37Å; L32-V37 HydrophobicContact CG-CG2 4.43Å
33	H	47.3	Very low	49.5	Very low	112 Å²	112	89.7 Å²	89.7	52%	0.519	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.8	123.1	168.6	-175.3	-97.9	0	0	0	108.4	G35 H36 L38	H33-G35 VanDerWaalsContact C-N 3.28Å; H33-G35 PolarHBondContact O-N 3.06Å; H33-H36 PolarHBondContact N-O 3.31Å; H33-H36 WeakPolarHBondContact O-CB 3.32Å; H33-H36 PolarHBondContact O-N 2.95Å; H33-L38 HydrophobicContact CB-CD1 3.36Å; H33-L38 HydrophobicContact CB-CG 4.11Å
34	N	46.8	Very low	49.5	Very low	150 Å²	150	89.1 Å²	89.1	80%	0.802	50%	0.502	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.8	38.7	-179.1	-65.2	-12.2	0	0	0	114.9	H36	N34-H36 PolarHBondContact O-N 3.48Å
35	G	53.2	Low	49.6	Very low	65 Å²	65	94.4 Å²	94.4	67%	0.67	52%	0.517	S	S	*	.	T	Hydrogen-bonded Turn	trans	76.9	1.4	-178.4	0	0	0	0	0	114.7	H33	H33-G35 VanDerWaalsContact C-N 3.28Å; H33-G35 PolarHBondContact O-N 3.06Å
36	H	47	Very low	49.5	Very low	44 Å²	44	93.9 Å²	93.9	20%	0.204	52%	0.515	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	128.4	175.5	-137.8	-86.1	0	0	0	110.3	L32 H33 N34 L38 F83 I84	L32-H36 WeakPolarHBondContact CA-O 3.37Å; H33-H36 PolarHBondContact N-O 3.31Å; H33-H36 WeakPolarHBondContact O-CB 3.32Å; H33-H36 PolarHBondContact O-N 2.95Å; N34-H36 PolarHBondContact O-N 3.48Å; H36-L38 PolarHBondContact O-N 3.49Å; H36-F83 AromaticContact CE1-CE1 3.77Å; H36-I84 PolarHBondContact CE1-O 3.3Å; H36-I84 PolarHBondContact NE2-O 3.24Å
37	V	53.1	Low	49.8	Very low	37 Å²	37	92.6 Å²	92.6	22%	0.224	52%	0.524	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.5	104.4	168.5	-179.9	0	0	0	0	106.5	L32 V40	L32-V37 HydrophobicContact CG-CG2 4.43Å; V37-V40 HydrophobicContact CG1-CG2 3.8Å
38	L	50.8	Low	49.9	Very low	80 Å²	80	96.9 Å²	96.9	42%	0.419	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.5	-26.8	-176.1	-78	176.4	0	0	0	112.6	N31 H33 H36	N31-L38 PolarHBondContact O-N 3.5Å; N31-L38 VanDerWaalsContact O-N 3.1Å; H33-L38 HydrophobicContact CB-CD1 3.36Å; H33-L38 HydrophobicContact CB-CG 4.11Å; H36-L38 PolarHBondContact O-N 3.49Å
39	N	47	Very low	50.2	Low	61 Å²	61	103.3 Å²	103.3	33%	0.326	56%	0.557	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-162	136.6	-178.3	-157.1	7.2	0	0	0	111	T41	N39-T41 WeakPolarHBondContact ND2-CG2 3.38Å
40	V	52.2	Low	50.3	Low	54 Å²	54	111 Å²	111	33%	0.327	58%	0.58	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-111.1	96.2	168.9	-178.7	0	0	0	0	106.6	F30 V37	F30-V40 HydrophobicContact CD1-CG2 4.26Å; F30-V40 HydrophobicContact CE1-CG1 4.28Å; F30-V40 HydrophobicContact CE1-CG2 4.24Å; V37-V40 HydrophobicContact CG1-CG2 3.8Å
41	T	49.8	Very low	50.1	Low	66 Å²	66	112.9 Å²	112.9	41%	0.405	60%	0.599	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-90.2	109.1	173.6	42.9	0	0	0	0	109	N39	N39-T41 WeakPolarHBondContact ND2-CG2 3.38Å
42	N	50.1	Low	50.2	Low	92 Å²	92	110.5 Å²	110.5	49%	0.492	60%	0.602	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-93.4	110.1	170.4	-159	-4.8	0	0	0	108.4	L44	N42-L44 HydrophobicContact CB-CG 4.25Å; N42-L44 WeakPolarHBondContact ND2-CD1 3.49Å; N42-L44 VanDerWaalsContact ND2-CG 3.29Å; N42-L44 WeakPolarHBondContact ND2-CG 3.37Å; N42-L44 PolarHBondContact O-N 3.36Å; N42-L44 WeakPolarHBondContact OD1-CD2 3.45Å; N42-L44 WeakPolarHBondContact OD1-CG 3.36Å
43	N	51	Low	50.4	Low	122 Å²	122	110.3 Å²	110.3	65%	0.652	61%	0.61	S	S	*	*			trans	-80.6	52.5	173.2	-71.2	-37.3	0	0	0	110.1	K45	N43-K45 VanDerWaalsContact C-N 3.34Å; N43-K45 PolarHBondContact O-N 3.01Å
44	L	48.6	Very low	50.9	Low	120 Å²	120	112.8 Å²	112.8	63%	0.628	63%	0.627	S	S	*	*			trans	-63.6	102.9	169.9	-62.2	176.2	0	0	0	106.7	N42 E46	N42-L44 HydrophobicContact CB-CG 4.25Å; N42-L44 WeakPolarHBondContact ND2-CD1 3.49Å; N42-L44 VanDerWaalsContact ND2-CG 3.29Å; N42-L44 WeakPolarHBondContact ND2-CG 3.37Å; N42-L44 PolarHBondContact O-N 3.36Å; N42-L44 WeakPolarHBondContact OD1-CD2 3.45Å; N42-L44 WeakPolarHBondContact OD1-CG 3.36Å; L44-E46 PolarHBondContact O-N 3.05Å
45	K	49.7	Very low	51.7	Low	198 Å²	198	110.5 Å²	110.5	86%	0.861	62%	0.623	S	S	*	*			trans	-60	103.1	145.1	-80.7	179.8	178.9	171.2	0	104	N43 G47	N43-K45 VanDerWaalsContact C-N 3.34Å; N43-K45 PolarHBondContact O-N 3.01Å; K45-G47 PolarHBondContact O-N 3.38Å
46	E	47.1	Very low	51.8	Low	184 Å²	184	115.3 Å²	115.3	86%	0.86	63%	0.633	S	S	*	*			trans	-48.8	104.6	158.9	-113.9	-179.2	170.4	0	0	104.8	L44 E48	L44-E46 PolarHBondContact O-N 3.05Å; E46-E48 VanDerWaalsContact C-N 3.34Å; E46-E48 PolarHBondContact O-N 3.04Å
47	G	51	Low	52.5	Low	68 Å²	68	121.9 Å²	121.9	70%	0.701	66%	0.664	S	S	*	*			trans	-57.5	105.5	178.8	0	0	0	0	0	106.5	K45 K49	K45-G47 PolarHBondContact O-N 3.38Å; G47-K49 VanDerWaalsContact C-N 3.31Å; G47-K49 PolarHBondContact O-N 3.16Å
48	E	47.8	Very low	52.8	Low	181 Å²	181	131.9 Å²	131.9	85%	0.846	70%	0.698	S	S	*	*			trans	-53.2	104.4	166.9	-89.8	-173.3	136.1	0	0	105.7	E46 K50	E46-E48 VanDerWaalsContact C-N 3.34Å; E46-E48 PolarHBondContact O-N 3.04Å; E48-K50 PolarHBondContact O-N 3.05Å
49	K	55	Low	52.9	Low	190 Å²	190	131.5 Å²	131.5	83%	0.826	71%	0.714	S	S	*	*			trans	-59.6	96	164.2	-79.3	-174.8	176.5	-179.4	0	106	G47 T51	G47-K49 VanDerWaalsContact C-N 3.31Å; G47-K49 PolarHBondContact O-N 3.16Å; K49-T51 PolarHBondContact O-N 3.35Å
50	K	54	Low	53.8	Low	198 Å²	198	138.4 Å²	138.4	86%	0.861	74%	0.741	S	S	*	*			trans	-63.4	86.8	159.8	-74.7	-170.6	178.1	-178.7	0	106.8	E48 G52	E48-K50 PolarHBondContact O-N 3.05Å; K50-G52 PolarHBondContact O-N 3.5Å; K50-G52 VanDerWaalsContact O-N 3.09Å
51	T	48.9	Very low	54.1	Low	121 Å²	121	144.4 Å²	144.4	74%	0.742	77%	0.771	S	S	*	*			trans	-78	84.2	161.4	27.8	0	0	0	0	106.3	K49 S53	K49-T51 PolarHBondContact O-N 3.35Å; T51-S53 PolarHBondContact O-N 2.97Å
52	G	50.7	Low	54.6	Low	71 Å²	71	144.6 Å²	144.6	73%	0.732	79%	0.786	S	S	*	*			trans	-73.4	105.2	162.4	0	0	0	0	0	107.7	K50	K50-G52 PolarHBondContact O-N 3.5Å; K50-G52 VanDerWaalsContact O-N 3.09Å
53	S	57.2	Low	55.3	Low	102 Å²	102	150.6 Å²	150.6	71%	0.713	81%	0.808	S	S	*	*			trans	-131.6	88.1	165.9	-61.8	0	0	0	0	106.6	T51 S55	T51-S53 PolarHBondContact O-N 2.97Å; S53-S55 VanDerWaalsContact C-N 3.26Å; S53-S55 PolarHBondContact O-N 3.43Å
54	D	58.2	Low	55.5	Low	165 Å²	165	148.8 Å²	148.8	88%	0.882	82%	0.817	S	S	*	*			trans	-67	88	165.7	-77.7	-37.5	0	0	0	108.2	N56	D54-N56 PolarHBondContact O-N 3.11Å
55	S	62.5	Low	56.4	Low	102 Å²	102	149.8 Å²	149.8	71%	0.713	82%	0.824	S	S	*	*			trans	-91.5	89.3	161.8	58.5	0	0	0	0	108.3	S53 E57	S53-S55 VanDerWaalsContact C-N 3.26Å; S53-S55 PolarHBondContact O-N 3.43Å; S55-E57 VanDerWaalsContact C-N 3.32Å; S55-E57 PolarHBondContact O-N 3.35Å
56	N	55.6	Low	57.3	Low	165 Å²	165	150.3 Å²	150.3	88%	0.882	83%	0.826	S	S	*	*			trans	-71	86.7	167.3	-98.6	-17.5	0	0	0	109.4	D54	D54-N56 PolarHBondContact O-N 3.11Å
57	E	62.1	Low	58.2	Low	182 Å²	182	152.1 Å²	152.1	85%	0.85	83%	0.825	S	S	*	*			trans	-109.2	100.1	168	-90.5	-166.5	149.2	0	0	112	S55	S55-E57 VanDerWaalsContact C-N 3.32Å; S55-E57 PolarHBondContact O-N 3.35Å
58	R	60.4	Low	59.1	Low	247 Å²	247	158.4 Å²	158.4	93%	0.932	83%	0.833	S	S	*	*			trans	36.2	111.8	135.5	-142.8	171.1	-164.2	171.5	3.6	118.3
59	G	52.3	Low	59.5	Low	73 Å²	73	153.6 Å²	153.6	75%	0.753	83%	0.831	S	S	*	*			trans	-64.6	163.3	-175	0	0	0	0	0	118.5
60	K	64.6	Low	60.2	Low	205 Å²	205	151.1 Å²	151.1	89%	0.891	83%	0.832	S	S	*	*			trans	-140.6	128.6	148.9	-72.9	-173.3	178.1	175	0	108.1	G62	K60-G62 PolarHBondContact O-N 3.37Å; K60-G62 VanDerWaalsContact O-N 3.12Å
61	N	60.2	Low	60.8	Low	180 Å²	180	150.3 Å²	150.3	96%	0.963	83%	0.831	S	S	*	*			trans	-57	110.8	177.6	-67.2	-23.5	0	0	0	110.5
62	G	59.3	Low	61.6	Low	70 Å²	70	155.9 Å²	155.9	72%	0.722	84%	0.839	S	S	*	*			trans	-116.1	112.8	174.6	0	0	0	0	0	110.5	K60 G64	K60-G62 PolarHBondContact O-N 3.37Å; K60-G62 VanDerWaalsContact O-N 3.12Å; G62-G64 PolarHBondContact O-N 3.1Å
63	K	64.3	Low	62.4	Low	219 Å²	219	158.8 Å²	158.8	95%	0.952	84%	0.842	S	S	*	*			trans	-51.5	131.8	173.6	-76.7	177	175.1	176.3	0	110.4
64	G	55.4	Low	62.9	Low	83 Å²	83	162.9 Å²	162.9	86%	0.856	85%	0.847	S	S	*	*			trans	-63.1	139.2	-168.3	0	0	0	0	0	115.2	G62	G62-G64 PolarHBondContact O-N 3.1Å
65	N	69.3	Low	63.2	Low	142 Å²	142	161 Å²	161	76%	0.759	84%	0.844	S	S	*	*			trans	-123.7	109.8	157.6	-168.4	13.8	0	0	0	107.6	R67	N65-R67 PolarHBondContact O-N 3.35Å
66	K	66.8	Low	63.4	Low	208 Å²	208	159.2 Å²	159.2	90%	0.904	84%	0.842	S	S	*	*			trans	-72.4	89.5	-174.7	-165.2	174.1	-173.8	175.4	0	109.1	K68	K66-K68 PolarHBondContact O-N 2.97Å
67	R	65.9	Low	63.6	Low	223 Å²	223	157.4 Å²	157.4	84%	0.842	84%	0.842	S	S	*	*			trans	-68.7	125.7	173.2	-74	-178.3	169.4	170.5	-3	109.3	N65 G69	N65-R67 PolarHBondContact O-N 3.35Å; R67-G69 PolarHBondContact O-N 2.91Å
68	K	71.5	Confident	63.1	Low	200 Å²	200	157.6 Å²	157.6	87%	0.87	84%	0.84	S	S	*	*			trans	-57.8	128	172.2	-69.2	-171.2	176.8	-177.3	0	108.5	K66 V70	K66-K68 PolarHBondContact O-N 2.97Å; K68-V70 PolarHBondContact O-N 3.24Å
69	G	54.8	Low	62.7	Low	79 Å²	79	151.4 Å²	151.4	81%	0.814	83%	0.834	S	S	*	*			trans	-59.8	110.9	-179.8	0	0	0	0	0	110.5	R67 Q71	R67-G69 PolarHBondContact O-N 2.91Å; G69-Q71 PolarHBondContact O-N 2.93Å
70	V	69.5	Low	62.4	Low	139 Å²	139	154.8 Å²	154.8	84%	0.842	83%	0.829	S	S	*	*			trans	-73.8	114	167.6	177.2	0	0	0	0	106.4	K68 R72	K68-V70 PolarHBondContact O-N 3.24Å; V70-R72 PolarHBondContact O-N 3.12Å; V70-R72 VanDerWaalsContact O-N 3.14Å
71	Q	67.9	Low	61.6	Low	181 Å²	181	148.9 Å²	148.9	85%	0.846	81%	0.813	S	S	*	*			trans	-64.3	113.6	176.1	-162.3	162.4	41.1	0	0	108.4	G69 V73	G69-Q71 PolarHBondContact O-N 2.93Å; Q71-V73 PolarHBondContact O-N 3.37Å; Q71-V73 VanDerWaalsContact O-N 3.14Å
72	R	65	Low	61	Low	237 Å²	237	148.3 Å²	148.3	89%	0.894	80%	0.799	S	S	*	*			trans	-73.1	104.7	179.6	-155.9	179	-160.6	-140.3	4.8	108	V70 K74	V70-R72 PolarHBondContact O-N 3.12Å; V70-R72 VanDerWaalsContact O-N 3.14Å; R72-K74 PolarHBondContact O-N 3.04Å
73	V	68.6	Low	60.5	Low	132 Å²	132	151.4 Å²	151.4	80%	0.8	79%	0.793	S	S	*	*	P	Polyproline II helix	trans	-67.9	125.7	172.8	-162.5	0	0	0	0	107.6	Q71	Q71-V73 PolarHBondContact O-N 3.37Å; Q71-V73 VanDerWaalsContact O-N 3.14Å
74	K	67.8	Low	59.9	Low	188 Å²	188	145.8 Å²	145.8	82%	0.817	77%	0.772	S	S	*	*	P	Polyproline II helix	trans	-66.9	135.8	175.2	-68.6	-175.9	177.8	-177.9	0	108.9	R72 G76	R72-K74 PolarHBondContact O-N 3.04Å; K74-G76 PolarHBondContact O-N 3.18Å
75	P	63.9	Low	59.3	Low	126 Å²	126	149 Å²	149	82%	0.818	76%	0.764	S	S	*	*	P	Polyproline II helix	trans	-61.1	126.8	174.1	25.2	-31.1	0	0	0	109
76	G	66.9	Low	57.9	Low	65 Å²	65	147.2 Å²	147.2	67%	0.67	75%	0.754	S	S	*	*	P	Polyproline II helix	trans	-62.9	139.7	173.3	0	0	0	0	0	110.5	K74 K78	K74-G76 PolarHBondContact O-N 3.18Å; G76-K78 PolarHBondContact O-N 2.96Å
77	S	58.3	Low	56.9	Low	126 Å²	126	146.9 Å²	146.9	88%	0.881	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-61.1	118.9	174.8	-2.1	0	0	0	0	109.5
78	K	53.3	Low	56.4	Low	186 Å²	186	143.1 Å²	143.1	81%	0.809	77%	0.766	S	S	*	*			trans	-82.2	114.4	170.5	-68.5	-178.5	-179.7	178	0	108.5	G76 F80	G76-K78 PolarHBondContact O-N 2.96Å; K78-F80 HydrophobicContact CB-CE2 4.29Å
79	S	51.4	Low	55.6	Low	117 Å²	117	140.1 Å²	140.1	82%	0.818	76%	0.761	S	S	*	*			trans	-91.8	131.3	166.8	46.7	0	0	0	0	109.6
80	F	46.1	Very low	55.7	Low	145 Å²	145	143.5 Å²	143.5	64%	0.636	76%	0.758	S	S	*	*			trans	-103.6	127.1	170.2	-70.5	-86.9	0	0	0	108.3	K78 Y82	K78-F80 HydrophobicContact CB-CE2 4.29Å; F80-Y82 HydrophobicContact CB-CE2 4.11Å
81	S	46.7	Very low	54.8	Low	81 Å²	81	143.8 Å²	143.8	57%	0.566	75%	0.753	S	S	*	*			trans	-106.4	128.8	168.2	168.8	0	0	0	0	107.9
82	Y	48.5	Very low	54	Low	168 Å²	168	141.4 Å²	141.4	66%	0.659	75%	0.747	S	S	*	*			trans	-109.4	129.2	170.4	-65.1	-82.6	0	0	0	108.4	F80	F80-Y82 HydrophobicContact CB-CE2 4.11Å
83	F	49.2	Very low	53.3	Low	135 Å²	135	135.1 Å²	135.1	59%	0.592	74%	0.738	S	S	*	*			trans	-98.6	114.7	172.9	-145.5	-98.3	0	0	0	108	H36	H36-F83 AromaticContact CE1-CE1 3.77Å
84	I	51.7	Low	52.2	Low	101 Å²	101	135.3 Å²	135.3	52%	0.518	73%	0.733	S	S	.	*			trans	-98.9	113.7	175.4	-57.1	174.5	0	0	0	107.3	H36 L86	H36-I84 PolarHBondContact CE1-O 3.3Å; H36-I84 PolarHBondContact NE2-O 3.24Å; I84-L86 HydrophobicContact CG2-CD1 4.03Å
85	H	43.3	Very low	51	Low	149 Å²	149	131.2 Å²	131.2	69%	0.69	73%	0.727	S	S	*	*			trans	-83.6	115.8	171.4	-130.5	-86.9	0	0	0	108.5
86	L	39.3	Very low	49.9	Very low	106 Å²	106	131.7 Å²	131.7	56%	0.555	72%	0.719	S	S	*	*			trans	-93.6	108.8	164.6	-79	96.7	0	0	0	108	I84	I84-L86 HydrophobicContact CG2-CD1 4.03Å
87	T	44.6	Very low	48.4	Very low	201 Å²	201	137.7 Å²	137.7	100%	1.233	72%	0.723	S	S	*	*			trans	-77.6	0	159.5	35.7	0	0	0	0	110.9

Retrieved 87 of 87 residues in 161.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).