A0A5K4FCD0_SCHMA Loading...

Stage V sporulation protein R

AlphaFold DB , UniProt , Accession A0A5K4FCD0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 41 aa.

						>A0A5K4FCD0_SCHMA|A0A5K4FCD0
MFKRYSIKLKMDLVFRTIWGQKDIIWNTLTMIFEEYGFNEN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.3	Low	72.7	Confident	189 Å²	189	148 Å²	148	93%	0.931	68%	0.675	S	S	*	*				0	-47.9	0	-139.7	173.4	-159.9	0	0	112.9	K3 R4 Y5	M1-K3 PolarHBondContact O-N 3.48Å; M1-R4 PolarHBondContact O-N 3.34Å; M1-Y5 HydrophobicContact CG-CE2 4.17Å
2	F	60.6	Low	73.9	Confident	187 Å²	187	142.1 Å²	142.1	82%	0.82	65%	0.653	S	S	*	*	H	α-helix	trans	-52.9	-39.1	-178.9	-69.6	-79.6	0	0	0	116.2	R4 Y5 S6	F2-R4 VanDerWaalsContact C-N 3.3Å; F2-R4 PolarHBondContact O-N 2.72Å; F2-Y5 PolarHBondContact O-N 3.33Å; F2-S6 PolarHBondContact O-N 2.87Å
3	K	63.3	Low	74.7	Confident	184 Å²	184	140.1 Å²	140.1	80%	0.8	65%	0.649	S	S	*	*	H	α-helix	trans	-57.4	-37.9	178.8	-74.4	-174	178	-179	0	113.4	M1 S6 I7	M1-K3 PolarHBondContact O-N 3.48Å; K3-S6 PolarHBondContact O-N 3.44Å; K3-I7 WeakPolarHBondContact O-CG1 3.29Å; K3-I7 PolarHBondContact O-N 2.99Å
4	R	64.5	Low	75.6	Confident	217 Å²	217	136 Å²	136	82%	0.819	64%	0.639	S	S	*	*	H	α-helix	trans	-68.5	-39.8	-179.5	-76.2	-173.1	178.3	-179.9	-0.8	112.3	M1 F2 I7 K8	M1-R4 PolarHBondContact O-N 3.34Å; F2-R4 VanDerWaalsContact C-N 3.3Å; F2-R4 PolarHBondContact O-N 2.72Å; R4-I7 PolarHBondContact O-N 3.44Å; R4-K8 PolarHBondContact O-N 2.87Å; R4-K8 VanDerWaalsContact O-N 3.13Å
5	Y	69.4	Low	76.1	Confident	155 Å²	155	136 Å²	136	61%	0.608	64%	0.636	S	S	*	*	H	α-helix	trans	-64.7	-39.7	176.5	-72.6	-73.8	0	0	0	112.1	M1 F2 I7 K8 L9	M1-Y5 HydrophobicContact CG-CE2 4.17Å; F2-Y5 PolarHBondContact O-N 3.33Å; Y5-I7 PolarHBondContact O-N 3.17Å; Y5-K8 PolarHBondContact O-N 3.13Å; Y5-L9 PolarHBondContact O-N 3.46Å
6	S	75.7	Confident	76.6	Confident	60 Å²	60	138.1 Å²	138.1	42%	0.42	64%	0.636	S	S	.	*	H	α-helix	trans	-62.1	-41.1	177	-175.4	0	0	0	0	112.4	F2 K3 L9 K10	F2-S6 PolarHBondContact O-N 2.87Å; K3-S6 PolarHBondContact O-N 3.44Å; S6-L9 PolarHBondContact O-N 2.72Å; S6-K10 WeakPolarHBondContact O-CG 3.42Å; S6-K10 PolarHBondContact O-N 3.22Å
7	I	80.1	Confident	77.3	Confident	102 Å²	102	134.4 Å²	134.4	52%	0.523	63%	0.626	S	S	.	*	H	α-helix	trans	-65.6	-45.4	176.9	-65.2	164.2	0	0	0	110.7	K3 R4 Y5 L9 K10 M11	K3-I7 WeakPolarHBondContact O-CG1 3.29Å; K3-I7 PolarHBondContact O-N 2.99Å; R4-I7 PolarHBondContact O-N 3.44Å; Y5-I7 PolarHBondContact O-N 3.17Å; I7-L9 VanDerWaalsContact C-N 3.32Å; I7-L9 PolarHBondContact O-N 3.42Å; I7-K10 PolarHBondContact O-N 3.42Å; I7-M11 HydrophobicContact CG2-CG 4.36Å; I7-M11 HydrophobicContact CG2-SD 4.1Å; I7-M11 WeakPolarHBondContact O-CG 3.26Å; I7-M11 PolarHBondContact O-N 3.42Å
8	K	79.7	Confident	77.8	Confident	159 Å²	159	132.4 Å²	132.4	69%	0.691	62%	0.619	S	S	*	*	H	α-helix	trans	-58.3	-43.7	178.3	-171.1	177.8	179.8	-178.5	0	111.8	R4 Y5 M11 D12	R4-K8 PolarHBondContact O-N 2.87Å; R4-K8 VanDerWaalsContact O-N 3.13Å; Y5-K8 PolarHBondContact O-N 3.13Å; K8-M11 PolarHBondContact O-N 3.38Å; K8-D12 PolarHBondContact O-N 2.86Å
9	L	81	Confident	78.2	Confident	132 Å²	132	133.5 Å²	133.5	69%	0.691	62%	0.617	S	S	*	*	H	α-helix	trans	-64	-42.3	177.3	-164.9	100.5	0	0	0	112	Y5 S6 I7 D12 L13	Y5-L9 PolarHBondContact O-N 3.46Å; S6-L9 PolarHBondContact O-N 2.72Å; I7-L9 VanDerWaalsContact C-N 3.32Å; I7-L9 PolarHBondContact O-N 3.42Å; L9-D12 PolarHBondContact O-N 2.9Å; L9-L13 PolarHBondContact O-N 3.31Å
10	K	83.9	Confident	78.6	Confident	139 Å²	139	128.4 Å²	128.4	60%	0.604	60%	0.602	S	S	*	*	H	α-helix	trans	-63.3	-41.1	176.4	-75	-178	178.7	-170.5	0	112	S6 I7 L13 V14	S6-K10 WeakPolarHBondContact O-CG 3.42Å; S6-K10 PolarHBondContact O-N 3.22Å; I7-K10 PolarHBondContact O-N 3.42Å; K10-L13 PolarHBondContact O-N 2.8Å; K10-V14 WeakPolarHBondContact O-CG2 3.35Å; K10-V14 PolarHBondContact O-N 3.37Å; K10-V14 VanDerWaalsContact O-N 3.1Å
11	M	84.1	Confident	79.1	Confident	104 Å²	104	127.5 Å²	127.5	51%	0.512	60%	0.598	S	S	.	*	H	α-helix	trans	-65	-43.6	176	-68.2	-178.4	86.2	0	0	111.3	I7 K8 L13 V14 F15	I7-M11 HydrophobicContact CG2-CG 4.36Å; I7-M11 HydrophobicContact CG2-SD 4.1Å; I7-M11 WeakPolarHBondContact O-CG 3.26Å; I7-M11 PolarHBondContact O-N 3.42Å; K8-M11 PolarHBondContact O-N 3.38Å; M11-L13 VanDerWaalsContact C-N 3.31Å; M11-L13 PolarHBondContact O-N 2.94Å; M11-V14 PolarHBondContact O-N 2.97Å; M11-F15 HydrophobicContact CB-CD2 4.4Å; M11-F15 HydrophobicContact CB-CE2 4.39Å; M11-F15 HydrophobicContact CE-CE2 4.41Å; M11-F15 WeakPolarHBondContact O-CD2 3.26Å; M11-F15 PolarHBondContact O-N 2.72Å
12	D	86.6	Confident	80.5	Confident	77 Å²	77	124.1 Å²	124.1	41%	0.412	58%	0.578	S	S	.	*	H	α-helix	trans	-58	-43.4	176.8	-167.4	72.5	0	0	0	111.8	K8 L9 F15 R16	K8-D12 PolarHBondContact O-N 2.86Å; L9-D12 PolarHBondContact O-N 2.9Å; D12-F15 PolarHBondContact O-N 2.91Å; D12-R16 WeakPolarHBondContact O-CG 3.5Å; D12-R16 PolarHBondContact O-N 3.38Å; D12-R16 IonicContact OD2-CZ 3.32Å; D12-R16 IonicContact OD2-NE 2.77Å; D12-R16 PolarHBondContact OD2-NE 2.89Å; D12-R16 IonicContact OD2-NH2 3.03Å; D12-R16 PolarHBondContact OD2-NH2 3.19Å
13	L	85.2	Confident	81.9	Confident	116 Å²	116	118.8 Å²	118.8	61%	0.607	56%	0.558	S	S	*	*	H	α-helix	trans	-60.6	-47.4	175.4	-175.2	67.2	0	0	0	111.7	L9 K10 M11 F15 R16 T17	L9-L13 PolarHBondContact O-N 3.31Å; K10-L13 PolarHBondContact O-N 2.8Å; M11-L13 VanDerWaalsContact C-N 3.31Å; M11-L13 PolarHBondContact O-N 2.94Å; L13-F15 PolarHBondContact O-N 2.95Å; L13-R16 PolarHBondContact O-N 3.47Å; L13-T17 PolarHBondContact O-N 3.34Å; L13-T17 PolarHBondContact O-OG1 3.4Å; L13-T17 VanDerWaalsContact O-OG1 3.06Å
14	V	86.5	Confident	83.1	Confident	83 Å²	83	115.2 Å²	115.2	50%	0.503	55%	0.546	S	S	.	.	H	α-helix	trans	-61.4	-44.6	178.1	171.4	0	0	0	0	111.1	K10 M11 R16 T17 I18	K10-V14 WeakPolarHBondContact O-CG2 3.35Å; K10-V14 PolarHBondContact O-N 3.37Å; K10-V14 VanDerWaalsContact O-N 3.1Å; M11-V14 PolarHBondContact O-N 2.97Å; V14-R16 PolarHBondContact O-N 3.14Å; V14-T17 PolarHBondContact O-N 3.3Å; V14-I18 HydrophobicContact CG1-CD1 3.7Å; V14-I18 HydrophobicContact CG1-CG1 4.38Å; V14-I18 WeakPolarHBondContact O-CG1 3.47Å; V14-I18 PolarHBondContact O-N 2.9Å
15	F	83.4	Confident	84.2	Confident	136 Å²	136	109.7 Å²	109.7	60%	0.596	53%	0.532	S	S	*	.	H	α-helix	trans	-61.4	-43.5	177.2	-82.9	-66.7	0	0	0	111.9	M11 D12 L13 T17 I18 W19	M11-F15 HydrophobicContact CB-CD2 4.4Å; M11-F15 HydrophobicContact CB-CE2 4.39Å; M11-F15 HydrophobicContact CE-CE2 4.41Å; M11-F15 WeakPolarHBondContact O-CD2 3.26Å; M11-F15 PolarHBondContact O-N 2.72Å; D12-F15 PolarHBondContact O-N 2.91Å; L13-F15 PolarHBondContact O-N 2.95Å; F15-T17 VanDerWaalsContact C-N 3.35Å; F15-T17 PolarHBondContact O-N 3.48Å; F15-I18 PolarHBondContact O-N 2.94Å; F15-W19 VanDerWaalsContact O-CB 3.27Å; F15-W19 WeakPolarHBondContact O-CB 2.99Å; F15-W19 PolarHBondContact O-N 3.38Å
16	R	85.1	Confident	85	Confident	170 Å²	170	110.5 Å²	110.5	64%	0.642	53%	0.534	S	S	*	.	H	α-helix	trans	-62.8	-40.6	175.7	-72.2	177.7	-167.2	-125.6	2	112.2	D12 L13 V14 G20	D12-R16 WeakPolarHBondContact O-CG 3.5Å; D12-R16 PolarHBondContact O-N 3.38Å; D12-R16 IonicContact OD2-CZ 3.32Å; D12-R16 IonicContact OD2-NE 2.77Å; D12-R16 PolarHBondContact OD2-NE 2.89Å; D12-R16 IonicContact OD2-NH2 3.03Å; D12-R16 PolarHBondContact OD2-NH2 3.19Å; L13-R16 PolarHBondContact O-N 3.47Å; V14-R16 PolarHBondContact O-N 3.14Å; R16-G20 PolarHBondContact O-N 3.33Å
17	T	87.5	Confident	85.6	Confident	74 Å²	74	112.3 Å²	112.3	45%	0.454	54%	0.539	S	S	.	.	H	α-helix	trans	-64.9	-47.1	177.3	-58.2	0	0	0	0	111.4	L13 V14 F15 Q21	L13-T17 PolarHBondContact O-N 3.34Å; L13-T17 PolarHBondContact O-OG1 3.4Å; L13-T17 VanDerWaalsContact O-OG1 3.06Å; V14-T17 PolarHBondContact O-N 3.3Å; F15-T17 VanDerWaalsContact C-N 3.35Å; F15-T17 PolarHBondContact O-N 3.48Å; T17-Q21 WeakPolarHBondContact O-CB 3.41Å; T17-Q21 VanDerWaalsContact O-CG 3.31Å; T17-Q21 WeakPolarHBondContact O-CG 3.33Å; T17-Q21 PolarHBondContact O-N 3.01Å
18	I	87.1	Confident	85.9	Confident	100 Å²	100	110.7 Å²	110.7	51%	0.513	53%	0.534	S	S	.	.	H	α-helix	trans	-63.9	-44.9	178.8	-66.7	169.4	0	0	0	110.7	V14 F15 Q21 K22	V14-I18 HydrophobicContact CG1-CD1 3.7Å; V14-I18 HydrophobicContact CG1-CG1 4.38Å; V14-I18 WeakPolarHBondContact O-CG1 3.47Å; V14-I18 PolarHBondContact O-N 2.9Å; F15-I18 PolarHBondContact O-N 2.94Å; I18-Q21 PolarHBondContact O-N 3.39Å; I18-K22 PolarHBondContact O-N 2.94Å
19	W	84.3	Confident	86.3	Confident	153 Å²	153	106.6 Å²	106.6	58%	0.58	52%	0.519	S	S	*	.	H	α-helix	trans	-65.9	-44.4	180	-164.5	-84.6	0	0	0	111.8	F15 Q21 K22 D23	F15-W19 VanDerWaalsContact O-CB 3.27Å; F15-W19 WeakPolarHBondContact O-CB 2.99Å; F15-W19 PolarHBondContact O-N 3.38Å; W19-Q21 VanDerWaalsContact C-N 3.3Å; W19-Q21 PolarHBondContact O-N 3.38Å; W19-K22 WeakPolarHBondContact O-CB 3.38Å; W19-K22 PolarHBondContact O-N 3.06Å; W19-K22 VanDerWaalsContact O-N 3.13Å; W19-D23 PolarHBondContact O-N 2.87Å
20	G	86.9	Confident	86.7	Confident	30 Å²	30	102.5 Å²	102.5	31%	0.309	50%	0.5	S	S	.	.	H	α-helix	trans	-61.5	-37.6	174.7	0	0	0	0	0	112.6	R16 D23 I24	R16-G20 PolarHBondContact O-N 3.33Å; G20-D23 PolarHBondContact O-N 2.88Å; G20-I24 VanDerWaalsContact O-CG1 3.27Å; G20-I24 WeakPolarHBondContact O-CG1 3.48Å; G20-I24 PolarHBondContact O-N 2.94Å
21	Q	88.1	Confident	86.9	Confident	111 Å²	111	101.9 Å²	101.9	52%	0.519	50%	0.501	S	S	.	.	H	α-helix	trans	-65.8	-39.8	173.1	-77.9	-178	-19.4	0	0	112.4	T17 I18 W19 D23 I24 I25	T17-Q21 WeakPolarHBondContact O-CB 3.41Å; T17-Q21 VanDerWaalsContact O-CG 3.31Å; T17-Q21 WeakPolarHBondContact O-CG 3.33Å; T17-Q21 PolarHBondContact O-N 3.01Å; I18-Q21 PolarHBondContact O-N 3.39Å; W19-Q21 VanDerWaalsContact C-N 3.3Å; W19-Q21 PolarHBondContact O-N 3.38Å; Q21-D23 VanDerWaalsContact C-N 3.32Å; Q21-D23 PolarHBondContact O-N 2.98Å; Q21-I24 PolarHBondContact O-N 3.13Å; Q21-I25 VanDerWaalsContact O-CG1 3.25Å; Q21-I25 WeakPolarHBondContact O-CG1 3.27Å; Q21-I25 PolarHBondContact O-N 2.96Å
22	K	87.9	Confident	87	Confident	118 Å²	118	100.1 Å²	100.1	51%	0.513	49%	0.493	S	S	.	.	H	α-helix	trans	-59.7	-43.7	174.3	-176.2	-173.1	172.8	-169.7	0	111.2	I18 W19 I25 W26	I18-K22 PolarHBondContact O-N 2.94Å; W19-K22 WeakPolarHBondContact O-CB 3.38Å; W19-K22 PolarHBondContact O-N 3.06Å; W19-K22 VanDerWaalsContact O-N 3.13Å; K22-I25 PolarHBondContact O-N 3.19Å; K22-W26 WeakPolarHBondContact O-CB 3.38Å; K22-W26 PolarHBondContact O-N 3.31Å
23	D	89.1	Confident	87	Confident	74 Å²	74	101.4 Å²	101.4	40%	0.396	50%	0.495	S	S	.	.	H	α-helix	trans	-64.8	-40.6	177.7	-69.1	-14	0	0	0	111.6	W19 G20 Q21 W26 N27	W19-D23 PolarHBondContact O-N 2.87Å; G20-D23 PolarHBondContact O-N 2.88Å; Q21-D23 VanDerWaalsContact C-N 3.32Å; Q21-D23 PolarHBondContact O-N 2.98Å; D23-W26 PolarHBondContact O-N 3.49Å; D23-N27 WeakPolarHBondContact O-CB 3.46Å; D23-N27 VanDerWaalsContact O-CG 3.27Å; D23-N27 PolarHBondContact O-N 2.88Å; D23-N27 PolarHBondContact O-ND2 3.43Å
24	I	88.4	Confident	86.9	Confident	109 Å²	109	103.1 Å²	103.1	56%	0.559	50%	0.5	S	S	*	.	H	α-helix	trans	-61.4	-46.6	174.3	-68.1	163.9	0	0	0	111	G20 Q21 N27 T28	G20-I24 VanDerWaalsContact O-CG1 3.27Å; G20-I24 WeakPolarHBondContact O-CG1 3.48Å; G20-I24 PolarHBondContact O-N 2.94Å; Q21-I24 PolarHBondContact O-N 3.13Å; I24-N27 PolarHBondContact O-N 3.49Å; I24-T28 WeakPolarHBondContact O-CB 3.31Å; I24-T28 PolarHBondContact O-N 3.26Å; I24-T28 PolarHBondContact O-OG1 3.48Å
25	I	87.8	Confident	86.8	Confident	102 Å²	102	106 Å²	106	52%	0.523	51%	0.507	S	S	.	.	H	α-helix	trans	-61.6	-45.9	178.6	-69	163.9	0	0	0	110.2	Q21 K22 T28 L29	Q21-I25 VanDerWaalsContact O-CG1 3.25Å; Q21-I25 WeakPolarHBondContact O-CG1 3.27Å; Q21-I25 PolarHBondContact O-N 2.96Å; K22-I25 PolarHBondContact O-N 3.19Å; I25-T28 PolarHBondContact O-N 3.1Å; I25-L29 HydrophobicContact CG2-CD1 3.96Å; I25-L29 HydrophobicContact CG2-CG 4.4Å; I25-L29 WeakPolarHBondContact O-CB 3.42Å; I25-L29 WeakPolarHBondContact O-CG 3.37Å; I25-L29 PolarHBondContact O-N 3.06Å
26	W	86.7	Confident	86.7	Confident	171 Å²	171	107 Å²	107	65%	0.648	51%	0.509	S	S	*	.	H	α-helix	trans	-59.9	-50	179.2	-175	-95.8	0	0	0	111.6	K22 D23 T28 L29 T30	K22-W26 WeakPolarHBondContact O-CB 3.38Å; K22-W26 PolarHBondContact O-N 3.31Å; D23-W26 PolarHBondContact O-N 3.49Å; W26-T28 VanDerWaalsContact C-N 3.3Å; W26-T28 PolarHBondContact O-N 3.45Å; W26-L29 PolarHBondContact O-N 3.03Å; W26-T30 PolarHBondContact O-N 2.95Å; W26-T30 PolarHBondContact O-OG1 3.39Å
27	N	87.4	Confident	85.8	Confident	98 Å²	98	101.1 Å²	101.1	52%	0.524	50%	0.501	S	S	.	.	H	α-helix	trans	-61.2	-40.6	178.3	-70.1	-17.7	0	0	0	112	D23 I24 T30 M31	D23-N27 WeakPolarHBondContact O-CB 3.46Å; D23-N27 VanDerWaalsContact O-CG 3.27Å; D23-N27 PolarHBondContact O-N 2.88Å; D23-N27 PolarHBondContact O-ND2 3.43Å; I24-N27 PolarHBondContact O-N 3.49Å; N27-T30 PolarHBondContact O-N 3.36Å; N27-M31 WeakPolarHBondContact O-CG 3.34Å; N27-M31 PolarHBondContact O-N 2.93Å
28	T	87.7	Confident	84.5	Confident	68 Å²	68	104.6 Å²	104.6	42%	0.417	51%	0.51	S	S	.	.	H	α-helix	trans	-63.1	-43.8	176.9	-55	0	0	0	0	111.1	I24 I25 W26 M31 I32	I24-T28 WeakPolarHBondContact O-CB 3.31Å; I24-T28 PolarHBondContact O-N 3.26Å; I24-T28 PolarHBondContact O-OG1 3.48Å; I25-T28 PolarHBondContact O-N 3.1Å; W26-T28 VanDerWaalsContact C-N 3.3Å; W26-T28 PolarHBondContact O-N 3.45Å; T28-M31 PolarHBondContact O-N 3.38Å; T28-I32 HydrophobicContact CG2-CD1 4.01Å; T28-I32 VanDerWaalsContact O-CG1 3.26Å; T28-I32 WeakPolarHBondContact O-CG1 3.13Å; T28-I32 PolarHBondContact O-N 3.38Å
29	L	88.6	Confident	83.1	Confident	73 Å²	73	106 Å²	106	38%	0.382	52%	0.518	S	S	.	.	H	α-helix	trans	-63.8	-45.7	176	-75	173.3	0	0	0	111.5	I25 W26 M31 I32 F33	I25-L29 HydrophobicContact CG2-CD1 3.96Å; I25-L29 HydrophobicContact CG2-CG 4.4Å; I25-L29 WeakPolarHBondContact O-CB 3.42Å; I25-L29 WeakPolarHBondContact O-CG 3.37Å; I25-L29 PolarHBondContact O-N 3.06Å; W26-L29 PolarHBondContact O-N 3.03Å; L29-M31 VanDerWaalsContact C-N 3.32Å; L29-M31 PolarHBondContact O-N 2.77Å; L29-I32 PolarHBondContact O-N 3.19Å; L29-I32 VanDerWaalsContact O-N 3.17Å; L29-F33 HydrophobicContact CB-CD2 4.21Å; L29-F33 HydrophobicContact CB-CE2 3.99Å; L29-F33 HydrophobicContact CD2-CE2 4.45Å; L29-F33 WeakPolarHBondContact O-CB 3.33Å; L29-F33 WeakPolarHBondContact O-CD2 3.44Å; L29-F33 WeakPolarHBondContact O-CG 3.25Å; L29-F33 PolarHBondContact O-N 3.48Å
30	T	88.7	Confident	81.7	Confident	46 Å²	46	108 Å²	108	28%	0.282	53%	0.534	S	S	.	.	H	α-helix	trans	-57.8	-45.3	176.3	-60	0	0	0	0	111.3	W26 N27 I32 F33 E34	W26-T30 PolarHBondContact O-N 2.95Å; W26-T30 PolarHBondContact O-OG1 3.39Å; N27-T30 PolarHBondContact O-N 3.36Å; T30-I32 PolarHBondContact O-N 3.06Å; T30-F33 PolarHBondContact O-N 2.99Å; T30-E34 HydrophobicContact CG2-CG 4.45Å; T30-E34 WeakPolarHBondContact O-CB 3.27Å; T30-E34 WeakPolarHBondContact O-CG 3.34Å; T30-E34 PolarHBondContact O-N 3.02Å
31	M	88.2	Confident	79.7	Confident	127 Å²	127	117 Å²	117	63%	0.626	58%	0.575	S	S	*	*	H	α-helix	trans	-59.8	-43.8	175.2	-73.1	177.1	65.3	0	0	112.2	N27 T28 L29 E34 E35	N27-M31 WeakPolarHBondContact O-CG 3.34Å; N27-M31 PolarHBondContact O-N 2.93Å; T28-M31 PolarHBondContact O-N 3.38Å; L29-M31 VanDerWaalsContact C-N 3.32Å; L29-M31 PolarHBondContact O-N 2.77Å; M31-E34 PolarHBondContact O-N 3.38Å; M31-E35 VanDerWaalsContact O-CB 3.26Å; M31-E35 WeakPolarHBondContact O-CB 3.38Å; M31-E35 PolarHBondContact O-N 3.21Å
32	I	86.9	Confident	79.3	Confident	66 Å²	66	117.3 Å²	117.3	34%	0.338	58%	0.578	S	S	.	*	H	α-helix	trans	-63.6	-43.5	176.3	-69.2	166.9	0	0	0	110.5	T28 L29 T30 E34 E35 Y36	T28-I32 HydrophobicContact CG2-CD1 4.01Å; T28-I32 VanDerWaalsContact O-CG1 3.26Å; T28-I32 WeakPolarHBondContact O-CG1 3.13Å; T28-I32 PolarHBondContact O-N 3.38Å; L29-I32 PolarHBondContact O-N 3.19Å; L29-I32 VanDerWaalsContact O-N 3.17Å; T30-I32 PolarHBondContact O-N 3.06Å; I32-E34 VanDerWaalsContact C-N 3.33Å; I32-E34 PolarHBondContact O-N 3.28Å; I32-E35 PolarHBondContact O-N 3.27Å; I32-Y36 HydrophobicContact CB-CD2 4.46Å; I32-Y36 HydrophobicContact CG2-CD2 3.73Å; I32-Y36 HydrophobicContact CG2-CE2 4.23Å; I32-Y36 WeakPolarHBondContact O-CB 3.42Å; I32-Y36 VanDerWaalsContact O-CD2 3.29Å; I32-Y36 WeakPolarHBondContact O-CD2 3.48Å; I32-Y36 PolarHBondContact O-N 3.39Å
33	F	85	Confident	78.8	Confident	105 Å²	105	117.2 Å²	117.2	46%	0.461	58%	0.581	S	S	.	*	H	α-helix	trans	-64	-39.6	179	-73.9	-56.9	0	0	0	112.2	L29 T30 G37 F38	L29-F33 HydrophobicContact CB-CD2 4.21Å; L29-F33 HydrophobicContact CB-CE2 3.99Å; L29-F33 HydrophobicContact CD2-CE2 4.45Å; L29-F33 WeakPolarHBondContact O-CB 3.33Å; L29-F33 WeakPolarHBondContact O-CD2 3.44Å; L29-F33 WeakPolarHBondContact O-CG 3.25Å; L29-F33 PolarHBondContact O-N 3.48Å; T30-F33 PolarHBondContact O-N 2.99Å; F33-G37 PolarHBondContact O-N 3.45Å; F33-G37 VanDerWaalsContact O-N 3.13Å; F33-F38 HydrophobicContact CD1-CB 3.88Å; F33-F38 AromaticContact CD1-CD2 3.74Å; F33-F38 HydrophobicContact CD1-CD2 3.74Å; F33-F38 HydrophobicContact CD1-CG 4.06Å; F33-F38 HydrophobicContact CE1-CB 4.44Å; F33-F38 HydrophobicContact CE1-CD2 4.17Å; F33-F38 HydrophobicContact CE1-CG 4.38Å; F33-F38 PolarHBondContact O-N 3.13Å
34	E	84.7	Confident	78.2	Confident	152 Å²	152	119.6 Å²	119.6	71%	0.71	59%	0.591	S	S	*	*	H	α-helix	trans	-67.7	-41.3	174.6	-72.6	177.9	176.4	0	0	112.3	T30 M31 I32	T30-E34 HydrophobicContact CG2-CG 4.45Å; T30-E34 WeakPolarHBondContact O-CB 3.27Å; T30-E34 WeakPolarHBondContact O-CG 3.34Å; T30-E34 PolarHBondContact O-N 3.02Å; M31-E34 PolarHBondContact O-N 3.38Å; I32-E34 VanDerWaalsContact C-N 3.33Å; I32-E34 PolarHBondContact O-N 3.28Å
35	E	83.5	Confident	77.6	Confident	142 Å²	142	120.2 Å²	120.2	66%	0.664	59%	0.593	S	S	*	*	H	α-helix	trans	-71.8	-47.2	-178.7	-177.3	177.5	-170.7	0	0	112.4	M31 I32 G37	M31-E35 VanDerWaalsContact O-CB 3.26Å; M31-E35 WeakPolarHBondContact O-CB 3.38Å; M31-E35 PolarHBondContact O-N 3.21Å; I32-E35 PolarHBondContact O-N 3.27Å; E35-G37 VanDerWaalsContact C-N 3.28Å; E35-G37 PolarHBondContact O-N 3.46Å
36	Y	80.9	Confident	77	Confident	159 Å²	159	121.4 Å²	121.4	62%	0.624	60%	0.598	S	S	*	*	H	α-helix	trans	-86.1	-2.9	-176.4	-71.1	-89.3	0	0	0	113	I32 F38	I32-Y36 HydrophobicContact CB-CD2 4.46Å; I32-Y36 HydrophobicContact CG2-CD2 3.73Å; I32-Y36 HydrophobicContact CG2-CE2 4.23Å; I32-Y36 WeakPolarHBondContact O-CB 3.42Å; I32-Y36 VanDerWaalsContact O-CD2 3.29Å; I32-Y36 WeakPolarHBondContact O-CD2 3.48Å; I32-Y36 PolarHBondContact O-N 3.39Å; Y36-F38 VanDerWaalsContact C-N 3.32Å; Y36-F38 PolarHBondContact O-N 3.26Å
37	G	66.9	Low	76.4	Confident	46 Å²	46	118.1 Å²	118.1	47%	0.474	59%	0.594	S	S	.	*	T	Hydrogen-bonded Turn	trans	56.1	47.8	173.7	0	0	0	0	0	111.8	F33 E35 N39	F33-G37 PolarHBondContact O-N 3.45Å; F33-G37 VanDerWaalsContact O-N 3.13Å; E35-G37 VanDerWaalsContact C-N 3.28Å; E35-G37 PolarHBondContact O-N 3.46Å; G37-N39 PolarHBondContact O-N 3.33Å
38	F	59.1	Low	75.6	Confident	146 Å²	146	119.5 Å²	119.5	64%	0.64	60%	0.599	S	S	*	*			trans	-69.3	54.9	158.3	-67.9	-84.9	0	0	0	108.7	F33 Y36 E40	F33-F38 HydrophobicContact CD1-CB 3.88Å; F33-F38 AromaticContact CD1-CD2 3.74Å; F33-F38 HydrophobicContact CD1-CD2 3.74Å; F33-F38 HydrophobicContact CD1-CG 4.06Å; F33-F38 HydrophobicContact CE1-CB 4.44Å; F33-F38 HydrophobicContact CE1-CD2 4.17Å; F33-F38 HydrophobicContact CE1-CG 4.38Å; F33-F38 PolarHBondContact O-N 3.13Å; Y36-F38 VanDerWaalsContact C-N 3.32Å; Y36-F38 PolarHBondContact O-N 3.26Å; F38-E40 PolarHBondContact O-N 3.25Å
39	N	57.7	Low	74.6	Confident	130 Å²	130	123.5 Å²	123.5	70%	0.695	61%	0.613	S	S	*	*			trans	-77.4	108.2	165.2	-146.9	-6.3	0	0	0	103	G37 N41	G37-N39 PolarHBondContact O-N 3.33Å; N39-N41 PolarHBondContact O-N 3.19Å
40	E	56.4	Low	73.5	Confident	194 Å²	194	127.7 Å²	127.7	91%	0.907	63%	0.633	S	S	*	*			trans	-60.6	74.4	-179.8	-65.9	-177.8	141.5	0	0	111.6	F38	F38-E40 PolarHBondContact O-N 3.25Å
41	N	43.7	Very low	72.1	Confident	219 Å²	219	135.1 Å²	135.1	100%	1.171	66%	0.664	S	S	*	*			trans	-114.9	0	160.4	-79.2	-36.4	0	0	0	108.9	N39	N39-N41 PolarHBondContact O-N 3.19Å

Retrieved 41 of 41 residues in 30.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).