A0A5K4FCH6_SCHMA Loading...

Ribonuclease T(2) AlphaSync

AlphaFold DB , UniProt , Accession A0A5K4FCH6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 64 aa.

						>A0A5K4FCH6_SCHMA|A0A5K4FCH6
MFSTLSTFRKHEFEKHGLCAVEDPQVFNQYGYFKFGIQLMQKLNLLKYVIHVVINSWLHFYKIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	69.6	Low	92	Very high	240 Å²	240	102.8 Å²	102.8	100%	1.182	53%	0.527	S	S	*	.				0	126.2	0	-171.8	167.8	170.6	0	0	107.6
2	F	84.1	Confident	92.5	Very high	98 Å²	98	98 Å²	98	43%	0.43	50%	0.501	S	S	.	.			trans	-75	131.7	180	-55.8	-74.9	0	0	0	109.6	T4 F8 H11	F2-T4 VanDerWaalsContact C-N 3.34Å; F2-F8 HydrophobicContact CB-CB 3.9Å; F2-F8 HydrophobicContact CD1-CB 4.3Å; F2-F8 HydrophobicContact CD1-CD2 4.4Å; F2-F8 HydrophobicContact CD2-CB 4.11Å; F2-F8 AromaticContact CD2-CD2 3.39Å; F2-F8 HydrophobicContact CD2-CD2 3.39Å; F2-F8 HydrophobicContact CD2-CE2 4.2Å; F2-F8 HydrophobicContact CD2-CG 4.13Å; F2-F8 HydrophobicContact CE1-CD2 4.4Å; F2-F8 AromaticContact CE2-CD2 3.4Å; F2-F8 HydrophobicContact CE2-CD2 3.4Å; F2-F8 AromaticContact CE2-CE2 3.88Å; F2-F8 HydrophobicContact CE2-CE2 3.88Å; F2-F8 HydrophobicContact CG-CB 3.83Å; F2-F8 AromaticContact CG-CD2 3.92Å; F2-F8 HydrophobicContact CG-CD2 3.92Å; F2-F8 HydrophobicContact CG-CG 4.35Å; F2-F8 AromaticContact CZ-CD2 3.93Å; F2-F8 HydrophobicContact CZ-CD2 3.93Å; F2-F8 HydrophobicContact CZ-CE2 4.47Å; F2-H11 HydrophobicContact CD1-CB 4.29Å; F2-H11 HydrophobicContact CE1-CB 3.47Å; F2-H11 VanDerWaalsContact CE1-CB 3.47Å; F2-H11 AromaticContact CE1-CD2 3.71Å; F2-H11 AromaticContact CE1-CG 3.48Å; F2-H11 VanDerWaalsContact CE1-CG 3.48Å; F2-H11 HydrophobicContact CZ-CB 4.06Å; F2-H11 AromaticContact CZ-CD2 3.41Å; F2-H11 VanDerWaalsContact CZ-CD2 3.41Å; F2-H11 WeakPolarHBondContact CZ-CD2 3.37Å; F2-H11 AromaticContact CZ-CG 3.72Å; F2-H11 AromaticContact CZ-NE2 3.98Å
3	S	86.9	Confident	92.9	Very high	104 Å²	104	92.4 Å²	92.4	73%	0.727	47%	0.471	S	S	*	.	S	Bend	trans	-79.1	-20.5	-176.7	52.8	0	0	0	0	112.8	T7	S3-T7 PolarHBondContact N-OG1 2.94Å
4	T	96.1	Very high	93.3	Very high	65 Å²	65	93.6 Å²	93.6	40%	0.399	47%	0.474	S	S	.	.	S	Bend	trans	-150.2	161.2	-177.1	66.7	0	0	0	0	111.5	F2 S6 T7 F8	F2-T4 VanDerWaalsContact C-N 3.34Å; T4-S6 PolarHBondContact O-N 3.17Å; T4-S6 PolarHBondContact OG1-N 3.5Å; T4-S6 PolarHBondContact OG1-OG 2.96Å; T4-T7 PolarHBondContact N-OG1 2.84Å; T4-T7 PolarHBondContact O-N 3.33Å; T4-T7 PolarHBondContact O-OG1 2.92Å; T4-T7 WeakPolarHBondContact OG1-CG2 3.46Å; T4-T7 PolarHBondContact OG1-N 3.25Å; T4-T7 PolarHBondContact OG1-OG1 3.1Å; T4-F8 PolarHBondContact O-N 3.07Å
5	L	94.7	Very high	93.6	Very high	109 Å²	109	95.5 Å²	95.5	57%	0.571	48%	0.477	S	S	*	.	H	α-helix	trans	-61.2	-29.8	171.1	-179.9	60.8	0	0	0	112.5	F8 R9	L5-F8 HydrophobicContact CD1-CD1 4.43Å; L5-R9 HydrophobicContact CD1-CG 4.37Å; L5-R9 WeakPolarHBondContact O-CB 3.36Å; L5-R9 WeakPolarHBondContact O-CG 3.32Å; L5-R9 PolarHBondContact O-N 2.8Å; L5-R9 PolarHBondContact O-NE 3.42Å
6	S	95.5	Very high	93.8	Very high	77 Å²	77	94.8 Å²	94.8	54%	0.538	47%	0.472	S	S	.	.	H	α-helix	trans	-72.1	-41.7	176.8	57.2	0	0	0	0	112.1	T4 F8 R9 K10	T4-S6 PolarHBondContact O-N 3.17Å; T4-S6 PolarHBondContact OG1-N 3.5Å; T4-S6 PolarHBondContact OG1-OG 2.96Å; S6-F8 VanDerWaalsContact C-N 3.34Å; S6-R9 PolarHBondContact O-N 2.95Å; S6-K10 VanDerWaalsContact O-CB 3.3Å; S6-K10 WeakPolarHBondContact O-CB 2.79Å; S6-K10 PolarHBondContact O-N 3.33Å
7	T	97	Very high	94.1	Very high	54 Å²	54	89.2 Å²	89.2	33%	0.331	44%	0.444	S	S	.	.	H	α-helix	trans	-66.6	-38.2	176.7	50.4	0	0	0	0	111.4	S3 T4 H11	S3-T7 PolarHBondContact N-OG1 2.94Å; T4-T7 PolarHBondContact N-OG1 2.84Å; T4-T7 PolarHBondContact O-N 3.33Å; T4-T7 PolarHBondContact O-OG1 2.92Å; T4-T7 WeakPolarHBondContact OG1-CG2 3.46Å; T4-T7 PolarHBondContact OG1-N 3.25Å; T4-T7 PolarHBondContact OG1-OG1 3.1Å; T7-H11 PolarHBondContact O-N 2.97Å
8	F	97	Very high	94.3	Very high	83 Å²	83	89.6 Å²	89.6	36%	0.364	45%	0.448	S	S	.	.	H	α-helix	trans	-61.3	-54.2	171.5	177.2	-120	0	0	0	112.1	F2 T4 L5 S6 K10 H11 E12	F2-F8 HydrophobicContact CB-CB 3.9Å; F2-F8 HydrophobicContact CD1-CB 4.3Å; F2-F8 HydrophobicContact CD1-CD2 4.4Å; F2-F8 HydrophobicContact CD2-CB 4.11Å; F2-F8 AromaticContact CD2-CD2 3.39Å; F2-F8 HydrophobicContact CD2-CD2 3.39Å; F2-F8 HydrophobicContact CD2-CE2 4.2Å; F2-F8 HydrophobicContact CD2-CG 4.13Å; F2-F8 HydrophobicContact CE1-CD2 4.4Å; F2-F8 AromaticContact CE2-CD2 3.4Å; F2-F8 HydrophobicContact CE2-CD2 3.4Å; F2-F8 AromaticContact CE2-CE2 3.88Å; F2-F8 HydrophobicContact CE2-CE2 3.88Å; F2-F8 HydrophobicContact CG-CB 3.83Å; F2-F8 AromaticContact CG-CD2 3.92Å; F2-F8 HydrophobicContact CG-CD2 3.92Å; F2-F8 HydrophobicContact CG-CG 4.35Å; F2-F8 AromaticContact CZ-CD2 3.93Å; F2-F8 HydrophobicContact CZ-CD2 3.93Å; F2-F8 HydrophobicContact CZ-CE2 4.47Å; T4-F8 PolarHBondContact O-N 3.07Å; L5-F8 HydrophobicContact CD1-CD1 4.43Å; S6-F8 VanDerWaalsContact C-N 3.34Å; F8-K10 VanDerWaalsContact C-N 3.28Å; F8-K10 PolarHBondContact O-N 3.37Å; F8-H11 WeakPolarHBondContact O-CB 3.42Å; F8-H11 PolarHBondContact O-N 2.92Å; F8-H11 VanDerWaalsContact O-N 3.09Å; F8-E12 HydrophobicContact CD2-CG 4.06Å; F8-E12 HydrophobicContact CE1-CG 4.15Å; F8-E12 HydrophobicContact CE2-CG 3.59Å; F8-E12 WeakPolarHBondContact CE2-OE1 3.16Å; F8-E12 HydrophobicContact CZ-CG 3.64Å; F8-E12 WeakPolarHBondContact O-CG 3.26Å; F8-E12 PolarHBondContact O-N 2.88Å
9	R	97.1	Very high	94.5	Very high	117 Å²	117	90.6 Å²	90.6	44%	0.442	46%	0.463	S	S	.	.	H	α-helix	trans	-60.4	-38.2	179.8	-77.9	-172.7	-85.3	177.6	-8	112.6	L5 S6 E12 F13 F33	L5-R9 HydrophobicContact CD1-CG 4.37Å; L5-R9 WeakPolarHBondContact O-CB 3.36Å; L5-R9 WeakPolarHBondContact O-CG 3.32Å; L5-R9 PolarHBondContact O-N 2.8Å; L5-R9 PolarHBondContact O-NE 3.42Å; S6-R9 PolarHBondContact O-N 2.95Å; R9-E12 PolarHBondContact O-N 3.45Å; R9-F13 PolarHBondContact O-N 3.42Å; R9-F33 HydrophobicContact CB-CE1 4.14Å; R9-F33 HydrophobicContact CB-CE2 4.39Å; R9-F33 HydrophobicContact CB-CZ 3.72Å; R9-F33 HydrophobicContact CG-CE1 3.84Å; R9-F33 HydrophobicContact CG-CZ 3.95Å; R9-F33 WeakPolarHBondContact O-CZ 3.26Å
10	K	96.9	Very high	94.6	Very high	121 Å²	121	87.7 Å²	87.7	53%	0.526	45%	0.453	S	S	.	.	H	α-helix	trans	-59.1	-49.4	174	-177.3	179.3	176.2	-178.5	0	110.9	S6 F8 E12 F13 E14	S6-K10 VanDerWaalsContact O-CB 3.3Å; S6-K10 WeakPolarHBondContact O-CB 2.79Å; S6-K10 PolarHBondContact O-N 3.33Å; F8-K10 VanDerWaalsContact C-N 3.28Å; F8-K10 PolarHBondContact O-N 3.37Å; K10-E12 PolarHBondContact O-N 2.66Å; K10-F13 PolarHBondContact O-N 2.89Å; K10-E14 WeakPolarHBondContact CE-OE1 3.31Å; K10-E14 VanDerWaalsContact CE-OE2 3.28Å; K10-E14 WeakPolarHBondContact CE-OE2 3.43Å; K10-E14 HydrophobicContact CG-CG 4.3Å; K10-E14 IonicContact NZ-OE1 3.52Å; K10-E14 WeakPolarHBondContact O-CB 3.45Å; K10-E14 WeakPolarHBondContact O-CG 3.15Å; K10-E14 PolarHBondContact O-N 2.92Å
11	H	97.2	Very high	94.7	Very high	63 Å²	63	85.7 Å²	85.7	29%	0.292	44%	0.444	S	S	.	.	H	α-helix	trans	-57.5	-48.7	178	179.3	77.5	0	0	0	112.4	F2 T7 F8 F13 E14 K15	F2-H11 HydrophobicContact CD1-CB 4.29Å; F2-H11 HydrophobicContact CE1-CB 3.47Å; F2-H11 VanDerWaalsContact CE1-CB 3.47Å; F2-H11 AromaticContact CE1-CD2 3.71Å; F2-H11 AromaticContact CE1-CG 3.48Å; F2-H11 VanDerWaalsContact CE1-CG 3.48Å; F2-H11 HydrophobicContact CZ-CB 4.06Å; F2-H11 AromaticContact CZ-CD2 3.41Å; F2-H11 VanDerWaalsContact CZ-CD2 3.41Å; F2-H11 WeakPolarHBondContact CZ-CD2 3.37Å; F2-H11 AromaticContact CZ-CG 3.72Å; F2-H11 AromaticContact CZ-NE2 3.98Å; T7-H11 PolarHBondContact O-N 2.97Å; F8-H11 WeakPolarHBondContact O-CB 3.42Å; F8-H11 PolarHBondContact O-N 2.92Å; F8-H11 VanDerWaalsContact O-N 3.09Å; H11-F13 VanDerWaalsContact C-N 3.33Å; H11-F13 PolarHBondContact O-N 3.46Å; H11-E14 PolarHBondContact O-N 3.41Å; H11-K15 VanDerWaalsContact CE1-CD 3.49Å; H11-K15 WeakPolarHBondContact CE1-CD 3.45Å; H11-K15 WeakPolarHBondContact NE2-CD 3.27Å; H11-K15 WeakPolarHBondContact O-CB 3.28Å; H11-K15 PolarHBondContact O-N 3.46Å
12	E	98	Very high	96	Very high	45 Å²	45	82.9 Å²	82.9	21%	0.21	43%	0.428	C	S	.	.	H	α-helix	trans	-60.3	-43.5	-179.8	-67.6	-56.9	124	0	0	111.7	F8 R9 K10 H16 G17 Y32	F8-E12 HydrophobicContact CD2-CG 4.06Å; F8-E12 HydrophobicContact CE1-CG 4.15Å; F8-E12 HydrophobicContact CE2-CG 3.59Å; F8-E12 WeakPolarHBondContact CE2-OE1 3.16Å; F8-E12 HydrophobicContact CZ-CG 3.64Å; F8-E12 WeakPolarHBondContact O-CG 3.26Å; F8-E12 PolarHBondContact O-N 2.88Å; R9-E12 PolarHBondContact O-N 3.45Å; K10-E12 PolarHBondContact O-N 2.66Å; E12-H16 WeakPolarHBondContact O-CA 3.3Å; E12-H16 VanDerWaalsContact O-CB 3.31Å; E12-H16 WeakPolarHBondContact O-CB 3.35Å; E12-H16 PolarHBondContact O-N 2.95Å; E12-H16 IonicContact OE2-CD2 3.69Å; E12-G17 PolarHBondContact O-N 3.05Å; E12-Y32 HydrophobicContact CB-CE1 4.45Å
13	F	98.2	Very high	96.6	Very high	25 Å²	25	81.4 Å²	81.4	11%	0.11	43%	0.425	C	S	.	.	H	α-helix	trans	-69.2	-47	179	-173.7	-107.7	0	0	0	112.4	R9 K10 H11 K15 G17 L18 V21 Q29 Y32 F33	R9-F13 PolarHBondContact O-N 3.42Å; K10-F13 PolarHBondContact O-N 2.89Å; H11-F13 VanDerWaalsContact C-N 3.33Å; H11-F13 PolarHBondContact O-N 3.46Å; F13-K15 VanDerWaalsContact C-N 3.35Å; F13-K15 PolarHBondContact O-N 3.32Å; F13-G17 CarbonylContact O-C 3.57Å; F13-G17 VanDerWaalsContact O-CA 3.27Å; F13-G17 WeakPolarHBondContact O-CA 3.38Å; F13-G17 PolarHBondContact O-N 3.09Å; F13-L18 HydrophobicContact CE1-CD2 3.71Å; F13-L18 HydrophobicContact CE1-CG 4.21Å; F13-L18 HydrophobicContact CZ-CD2 3.87Å; F13-L18 HydrophobicContact CZ-CG 4.48Å; F13-L18 PolarHBondContact O-N 3.04Å; F13-V21 HydrophobicContact CE2-CG1 4.49Å; F13-V21 HydrophobicContact CZ-CG1 4.33Å; F13-Q29 HydrophobicContact CB-CG 4.33Å; F13-Q29 HydrophobicContact CD1-CB 4.04Å; F13-Q29 HydrophobicContact CD1-CG 3.91Å; F13-Q29 HydrophobicContact CD2-CB 3.99Å; F13-Q29 HydrophobicContact CD2-CG 3.89Å; F13-Q29 HydrophobicContact CE1-CB 3.8Å; F13-Q29 HydrophobicContact CE1-CG 4.2Å; F13-Q29 HydrophobicContact CE2-CB 3.79Å; F13-Q29 HydrophobicContact CE2-CG 4.23Å; F13-Q29 HydrophobicContact CG-CB 4.13Å; F13-Q29 HydrophobicContact CG-CG 3.74Å; F13-Q29 HydrophobicContact CZ-CB 3.68Å; F13-Q29 HydrophobicContact CZ-CG 4.37Å; F13-Y32 AromaticContact CD2-CD1 3.93Å; F13-Y32 HydrophobicContact CD2-CD1 3.93Å; F13-Y32 AromaticContact CD2-CG 3.98Å; F13-Y32 HydrophobicContact CD2-CG 3.98Å; F13-Y32 HydrophobicContact CE2-CG 4.43Å; F13-F33 HydrophobicContact CB-CE2 4.16Å; F13-F33 HydrophobicContact CB-CZ 4.23Å
14	E	98	Very high	97	Very high	109 Å²	109	82.1 Å²	82.1	51%	0.509	43%	0.427	S	S	.	.	H	α-helix	trans	-66.1	-36.8	-178.7	-71.7	178.7	161.8	0	0	112.4	K10 H11	K10-E14 WeakPolarHBondContact CE-OE1 3.31Å; K10-E14 VanDerWaalsContact CE-OE2 3.28Å; K10-E14 WeakPolarHBondContact CE-OE2 3.43Å; K10-E14 HydrophobicContact CG-CG 4.3Å; K10-E14 IonicContact NZ-OE1 3.52Å; K10-E14 WeakPolarHBondContact O-CB 3.45Å; K10-E14 WeakPolarHBondContact O-CG 3.15Å; K10-E14 PolarHBondContact O-N 2.92Å; H11-E14 PolarHBondContact O-N 3.41Å
15	K	97.5	Very high	97	Very high	122 Å²	122	85 Å²	85	53%	0.53	44%	0.436	S	S	.	.	H	α-helix	trans	-85.7	-34.7	-177.4	-172.2	174.6	174.4	175	0	113.5	H11 F13	H11-K15 VanDerWaalsContact CE1-CD 3.49Å; H11-K15 WeakPolarHBondContact CE1-CD 3.45Å; H11-K15 WeakPolarHBondContact NE2-CD 3.27Å; H11-K15 WeakPolarHBondContact O-CB 3.28Å; H11-K15 PolarHBondContact O-N 3.46Å; F13-K15 VanDerWaalsContact C-N 3.35Å; F13-K15 PolarHBondContact O-N 3.32Å
16	H	97.6	Very high	97.1	Very high	84 Å²	84	80.3 Å²	80.3	39%	0.389	41%	0.412	S	S	.	.	T	Hydrogen-bonded Turn	trans	-123.8	-43	-170.6	-58.2	-58.1	0	0	0	112.7	E12 L18 C19	E12-H16 WeakPolarHBondContact O-CA 3.3Å; E12-H16 VanDerWaalsContact O-CB 3.31Å; E12-H16 WeakPolarHBondContact O-CB 3.35Å; E12-H16 PolarHBondContact O-N 2.95Å; E12-H16 IonicContact OE2-CD2 3.69Å; H16-L18 PolarHBondContact O-N 3.06Å; H16-C19 PolarHBondContact O-N 3.3Å
17	G	97.9	Very high	97.1	Very high	0 Å²	0	83.5 Å²	83.5	0%	0	42%	0.416	C	S	.	.	G	3₁₀ helix	trans	-64.3	-37.5	-176.7	0	0	0	0	0	114.5	E12 F13 C19 A20 Y32	E12-G17 PolarHBondContact O-N 3.05Å; F13-G17 CarbonylContact O-C 3.57Å; F13-G17 VanDerWaalsContact O-CA 3.27Å; F13-G17 WeakPolarHBondContact O-CA 3.38Å; F13-G17 PolarHBondContact O-N 3.09Å; G17-C19 PolarHBondContact O-N 2.88Å; G17-A20 PolarHBondContact O-N 3.26Å; G17-Y32 VanDerWaalsContact CA-CD2 3.49Å; G17-Y32 VanDerWaalsContact CA-CE2 3.45Å
18	L	98	Very high	97.2	Very high	97 Å²	97	84.2 Å²	84.2	51%	0.508	42%	0.418	S	S	.	.	G	3₁₀ helix	trans	-60.5	-29.6	178.2	-72.8	177.5	0	0	0	113.3	F13 H16 A20 V21	F13-L18 HydrophobicContact CE1-CD2 3.71Å; F13-L18 HydrophobicContact CE1-CG 4.21Å; F13-L18 HydrophobicContact CZ-CD2 3.87Å; F13-L18 HydrophobicContact CZ-CG 4.48Å; F13-L18 PolarHBondContact O-N 3.04Å; H16-L18 PolarHBondContact O-N 3.06Å; L18-A20 PolarHBondContact O-N 3.41Å; L18-V21 WeakPolarHBondContact O-CG2 3.21Å
19	C	97.6	Very high	97.2	Very high	108 Å²	108	85 Å²	85	73%	0.73	42%	0.423	S	S	*	.	G	3₁₀ helix	trans	-75	-15.1	175.8	-58.7	0	0	0	0	113.1	H16 G17	H16-C19 PolarHBondContact O-N 3.3Å; G17-C19 PolarHBondContact O-N 2.88Å
20	A	96.7	Very high	97.3	Very high	32 Å²	32	87.2 Å²	87.2	26%	0.264	43%	0.432	S	S	.	.	G	3₁₀ helix	trans	-101.1	-3.1	-175.9	0	0	0	0	0	113.2	G17 L18 E22 D23 V26	G17-A20 PolarHBondContact O-N 3.26Å; L18-A20 PolarHBondContact O-N 3.41Å; A20-E22 PolarHBondContact O-N 3.08Å; A20-E22 VanDerWaalsContact O-N 3.17Å; A20-D23 PolarHBondContact O-N 3.48Å; A20-V26 HydrophobicContact CB-CB 4.42Å; A20-V26 HydrophobicContact CB-CG1 3.99Å; A20-V26 HydrophobicContact CB-CG2 4.29Å; A20-V26 WeakPolarHBondContact O-CB 3.49Å
21	V	96.5	Very high	97.3	Very high	46 Å²	46	81.8 Å²	81.8	28%	0.279	41%	0.411	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.2	-13.8	-174.5	-58.2	0	0	0	0	114.1	F13 L18 D23 F27	F13-V21 HydrophobicContact CE2-CG1 4.49Å; F13-V21 HydrophobicContact CZ-CG1 4.33Å; L18-V21 WeakPolarHBondContact O-CG2 3.21Å; V21-D23 VanDerWaalsContact C-N 3.26Å; V21-D23 PolarHBondContact O-N 3.44Å; V21-F27 WeakPolarHBondContact O-CA 3.17Å
22	E	96.8	Very high	97.4	Very high	181 Å²	181	81.3 Å²	81.3	85%	0.846	41%	0.407	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.9	-22.7	172.5	-63.2	-178.4	179.6	0	0	112.3	A20 P24	A20-E22 PolarHBondContact O-N 3.08Å; A20-E22 VanDerWaalsContact O-N 3.17Å; E22-P24 WeakPolarHBondContact O-CD 3.27Å
23	D	97.4	Very high	97.4	Very high	68 Å²	68	81.7 Å²	81.7	36%	0.364	41%	0.408	S	S	.	.	S	Bend	trans	-76.7	124.1	174.4	-169.8	-46.7	0	0	0	109.9	A20 V21 Q25 V26 F27	A20-D23 PolarHBondContact O-N 3.48Å; V21-D23 VanDerWaalsContact C-N 3.26Å; V21-D23 PolarHBondContact O-N 3.44Å; D23-Q25 PolarHBondContact O-N 3.49Å; D23-Q25 VanDerWaalsContact O-N 3.1Å; D23-Q25 VanDerWaalsContact OD1-CB 3.26Å; D23-Q25 WeakPolarHBondContact OD1-CB 3.39Å; D23-Q25 PolarHBondContact OD1-N 2.9Å; D23-V26 HydrophobicContact CB-CB 4.45Å; D23-V26 CarbonylContact O-C 3.5Å; D23-V26 PolarHBondContact O-N 2.8Å; D23-F27 PolarHBondContact O-N 3.34Å
24	P	96.2	Very high	97.4	Very high	118 Å²	118	85.1 Å²	85.1	77%	0.766	42%	0.423	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.5	-24.6	178.6	-25.6	34.7	0	0	0	114.9	E22 V26	E22-P24 WeakPolarHBondContact O-CD 3.27Å; P24-V26 VanDerWaalsContact C-N 3.29Å
25	Q	94.9	Very high	97.4	Very high	127 Å²	127	83.3 Å²	83.3	59%	0.593	41%	0.413	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.3	-23.6	176.2	-63.5	175.2	89.7	0	0	112.4	D23 F35	D23-Q25 PolarHBondContact O-N 3.49Å; D23-Q25 VanDerWaalsContact O-N 3.1Å; D23-Q25 VanDerWaalsContact OD1-CB 3.26Å; D23-Q25 WeakPolarHBondContact OD1-CB 3.39Å; D23-Q25 PolarHBondContact OD1-N 2.9Å; Q25-F35 HydrophobicContact CB-CD2 3.99Å; Q25-F35 HydrophobicContact CB-CE2 4.29Å
26	V	97.2	Very high	97.3	Very high	10 Å²	10	79.2 Å²	79.2	6%	0.061	41%	0.406	C	S	.	.	T	Hydrogen-bonded Turn	trans	-98.5	-66.2	177.6	172.2	0	0	0	0	109.5	A20 D23 P24 N28 G31 Y32 F35	A20-V26 HydrophobicContact CB-CB 4.42Å; A20-V26 HydrophobicContact CB-CG1 3.99Å; A20-V26 HydrophobicContact CB-CG2 4.29Å; A20-V26 WeakPolarHBondContact O-CB 3.49Å; D23-V26 HydrophobicContact CB-CB 4.45Å; D23-V26 CarbonylContact O-C 3.5Å; D23-V26 PolarHBondContact O-N 2.8Å; P24-V26 VanDerWaalsContact C-N 3.29Å; V26-N28 PolarHBondContact O-N 2.98Å; V26-G31 CarbonylContact O-C 3.56Å; V26-G31 WeakPolarHBondContact O-CA 3.5Å; V26-Y32 HydrophobicContact CG1-CD2 4.23Å; V26-F35 HydrophobicContact CG2-CB 4.38Å; V26-F35 HydrophobicContact CG2-CG 4.42Å
27	F	96.3	Very high	97.3	Very high	144 Å²	144	79.4 Å²	79.4	63%	0.632	41%	0.409	S	S	*	.	S	Bend	trans	53.3	-33.9	178	-173.1	-111.5	0	0	0	118.3	V21 D23	V21-F27 WeakPolarHBondContact O-CA 3.17Å; D23-F27 PolarHBondContact O-N 3.34Å
28	N	97.8	Very high	97.3	Very high	68 Å²	68	84.2 Å²	84.2	36%	0.364	43%	0.431	S	S	.	.	S	Bend	trans	-156.8	-178.4	-177.8	61.9	43	0	0	0	110.4	V26 Y30 G31 Y32	V26-N28 PolarHBondContact O-N 2.98Å; N28-Y30 VanDerWaalsContact C-N 3.33Å; N28-Y30 PolarHBondContact O-N 3.46Å; N28-Y30 WeakPolarHBondContact OD1-CA 3.41Å; N28-Y30 WeakPolarHBondContact OD1-CB 3.39Å; N28-Y30 PolarHBondContact OD1-N 2.95Å; N28-G31 PolarHBondContact O-N 3.43Å; N28-G31 PolarHBondContact OD1-N 3.41Å; N28-Y32 PolarHBondContact O-N 2.99Å
29	Q	98	Very high	97.2	Very high	99 Å²	99	83.3 Å²	83.3	46%	0.463	43%	0.427	S	S	.	.	H	α-helix	trans	-59.1	-40.5	179.5	-171.9	177.5	0.4	0	0	113.6	F13 Y32 F33	F13-Q29 HydrophobicContact CB-CG 4.33Å; F13-Q29 HydrophobicContact CD1-CB 4.04Å; F13-Q29 HydrophobicContact CD1-CG 3.91Å; F13-Q29 HydrophobicContact CD2-CB 3.99Å; F13-Q29 HydrophobicContact CD2-CG 3.89Å; F13-Q29 HydrophobicContact CE1-CB 3.8Å; F13-Q29 HydrophobicContact CE1-CG 4.2Å; F13-Q29 HydrophobicContact CE2-CB 3.79Å; F13-Q29 HydrophobicContact CE2-CG 4.23Å; F13-Q29 HydrophobicContact CG-CB 4.13Å; F13-Q29 HydrophobicContact CG-CG 3.74Å; F13-Q29 HydrophobicContact CZ-CB 3.68Å; F13-Q29 HydrophobicContact CZ-CG 4.37Å; Q29-Y32 PolarHBondContact O-N 3.05Å; Q29-F33 HydrophobicContact CG-CD2 3.99Å; Q29-F33 HydrophobicContact CG-CE2 3.75Å; Q29-F33 WeakPolarHBondContact O-CD2 3.48Å; Q29-F33 PolarHBondContact O-N 2.99Å
30	Y	97.9	Very high	97.1	Very high	165 Å²	165	84 Å²	84	65%	0.647	42%	0.421	S	S	*	.	H	α-helix	trans	-64.7	-47.2	179.1	171.7	-95.6	0	0	0	111.1	N28 Y32 F33 K34	N28-Y30 VanDerWaalsContact C-N 3.33Å; N28-Y30 PolarHBondContact O-N 3.46Å; N28-Y30 WeakPolarHBondContact OD1-CA 3.41Å; N28-Y30 WeakPolarHBondContact OD1-CB 3.39Å; N28-Y30 PolarHBondContact OD1-N 2.95Å; Y30-Y32 PolarHBondContact O-N 3.28Å; Y30-F33 PolarHBondContact O-N 3.44Å; Y30-K34 HydrophobicContact CE1-CB 4.43Å; Y30-K34 HydrophobicContact CE1-CD 3.76Å; Y30-K34 VanDerWaalsContact O-CB 3.27Å; Y30-K34 WeakPolarHBondContact O-CB 3.32Å; Y30-K34 PolarHBondContact O-N 2.85Å
31	G	98.1	Very high	97	Very high	7 Å²	7	88.7 Å²	88.7	7%	0.072	44%	0.437	C	S	.	.	H	α-helix	trans	-66.7	-35.5	178.7	0	0	0	0	0	112.6	V26 N28 F33 K34 F35	V26-G31 CarbonylContact O-C 3.56Å; V26-G31 WeakPolarHBondContact O-CA 3.5Å; N28-G31 PolarHBondContact O-N 3.43Å; N28-G31 PolarHBondContact OD1-N 3.41Å; G31-F33 PolarHBondContact O-N 3.24Å; G31-K34 PolarHBondContact O-N 3.03Å; G31-F35 WeakPolarHBondContact O-CB 3.46Å; G31-F35 PolarHBondContact O-N 3.33Å
32	Y	98.5	Very high	96.9	Very high	52 Å²	52	95 Å²	95	20%	0.204	46%	0.461	C	S	.	.	H	α-helix	trans	-54.4	-53.3	172.9	178.7	-104.3	0	0	0	112.1	E12 F13 G17 V26 N28 Q29 Y30 G36	E12-Y32 HydrophobicContact CB-CE1 4.45Å; F13-Y32 AromaticContact CD2-CD1 3.93Å; F13-Y32 HydrophobicContact CD2-CD1 3.93Å; F13-Y32 AromaticContact CD2-CG 3.98Å; F13-Y32 HydrophobicContact CD2-CG 3.98Å; F13-Y32 HydrophobicContact CE2-CG 4.43Å; G17-Y32 VanDerWaalsContact CA-CD2 3.49Å; G17-Y32 VanDerWaalsContact CA-CE2 3.45Å; V26-Y32 HydrophobicContact CG1-CD2 4.23Å; N28-Y32 PolarHBondContact O-N 2.99Å; Q29-Y32 PolarHBondContact O-N 3.05Å; Y30-Y32 PolarHBondContact O-N 3.28Å; Y32-G36 PolarHBondContact O-N 2.98Å; Y32-G36 VanDerWaalsContact O-N 3.08Å
33	F	98.4	Very high	96.8	Very high	54 Å²	54	90.8 Å²	90.8	24%	0.237	44%	0.444	C	S	.	.	H	α-helix	trans	-71.4	-38	180	-72.1	-65	0	0	0	112.6	R9 F13 Q29 Y30 G31 G36 I37	R9-F33 HydrophobicContact CB-CE1 4.14Å; R9-F33 HydrophobicContact CB-CE2 4.39Å; R9-F33 HydrophobicContact CB-CZ 3.72Å; R9-F33 HydrophobicContact CG-CE1 3.84Å; R9-F33 HydrophobicContact CG-CZ 3.95Å; R9-F33 WeakPolarHBondContact O-CZ 3.26Å; F13-F33 HydrophobicContact CB-CE2 4.16Å; F13-F33 HydrophobicContact CB-CZ 4.23Å; Q29-F33 HydrophobicContact CG-CD2 3.99Å; Q29-F33 HydrophobicContact CG-CE2 3.75Å; Q29-F33 WeakPolarHBondContact O-CD2 3.48Å; Q29-F33 PolarHBondContact O-N 2.99Å; Y30-F33 PolarHBondContact O-N 3.44Å; G31-F33 PolarHBondContact O-N 3.24Å; F33-G36 PolarHBondContact O-N 2.92Å; F33-I37 WeakPolarHBondContact O-CB 3.37Å; F33-I37 WeakPolarHBondContact O-CD1 3.44Å; F33-I37 VanDerWaalsContact O-CG1 3.26Å; F33-I37 WeakPolarHBondContact O-CG1 3.41Å; F33-I37 PolarHBondContact O-N 3.39Å
34	K	98.1	Very high	96.5	Very high	97 Å²	97	91.3 Å²	91.3	42%	0.422	45%	0.447	S	S	.	.	H	α-helix	trans	-59.4	-48.7	175.6	178.8	-178.5	174.4	-175.8	0	110.9	Y30 G31 I37 Q38	Y30-K34 HydrophobicContact CE1-CB 4.43Å; Y30-K34 HydrophobicContact CE1-CD 3.76Å; Y30-K34 VanDerWaalsContact O-CB 3.27Å; Y30-K34 WeakPolarHBondContact O-CB 3.32Å; Y30-K34 PolarHBondContact O-N 2.85Å; G31-K34 PolarHBondContact O-N 3.03Å; K34-I37 PolarHBondContact O-N 3.48Å; K34-Q38 HydrophobicContact CG-CG 4.5Å; K34-Q38 WeakPolarHBondContact O-CB 3.31Å; K34-Q38 VanDerWaalsContact O-CG 3.31Å; K34-Q38 WeakPolarHBondContact O-CG 3.48Å; K34-Q38 PolarHBondContact O-N 3.36Å
35	F	97.4	Very high	96.2	Very high	70 Å²	70	91 Å²	91	31%	0.307	44%	0.438	S	S	.	.	H	α-helix	trans	-60.7	-47.8	179.2	-178	-95.6	0	0	0	111.2	Q25 V26 G31 I37 Q38 L39	Q25-F35 HydrophobicContact CB-CD2 3.99Å; Q25-F35 HydrophobicContact CB-CE2 4.29Å; V26-F35 HydrophobicContact CG2-CB 4.38Å; V26-F35 HydrophobicContact CG2-CG 4.42Å; G31-F35 WeakPolarHBondContact O-CB 3.46Å; G31-F35 PolarHBondContact O-N 3.33Å; F35-I37 VanDerWaalsContact C-N 3.35Å; F35-I37 PolarHBondContact O-N 2.89Å; F35-Q38 PolarHBondContact O-N 2.83Å; F35-L39 HydrophobicContact CE1-CD2 4.37Å; F35-L39 WeakPolarHBondContact O-CB 3.41Å; F35-L39 PolarHBondContact O-N 2.97Å
36	G	96.6	Very high	96	Very high	37 Å²	37	90.7 Å²	90.7	38%	0.381	44%	0.44	S	S	.	.	H	α-helix	trans	-58.4	-43.1	176.8	0	0	0	0	0	113.2	Y32 F33 L39 M40	Y32-G36 PolarHBondContact O-N 2.98Å; Y32-G36 VanDerWaalsContact O-N 3.08Å; F33-G36 PolarHBondContact O-N 2.92Å; G36-L39 PolarHBondContact O-N 3.43Å; G36-M40 WeakPolarHBondContact O-CB 3.33Å; G36-M40 PolarHBondContact O-N 2.86Å
37	I	97.2	Very high	95.7	Very high	88 Å²	88	97.2 Å²	97.2	45%	0.451	47%	0.467	S	S	.	.	H	α-helix	trans	-65.8	-43.9	176.8	-69.1	165.2	0	0	0	111.2	F33 K34 F35 L39 M40 Q41	F33-I37 WeakPolarHBondContact O-CB 3.37Å; F33-I37 WeakPolarHBondContact O-CD1 3.44Å; F33-I37 VanDerWaalsContact O-CG1 3.26Å; F33-I37 WeakPolarHBondContact O-CG1 3.41Å; F33-I37 PolarHBondContact O-N 3.39Å; K34-I37 PolarHBondContact O-N 3.48Å; F35-I37 VanDerWaalsContact C-N 3.35Å; F35-I37 PolarHBondContact O-N 2.89Å; I37-L39 VanDerWaalsContact C-N 3.33Å; I37-L39 PolarHBondContact O-N 3.28Å; I37-M40 HydrophobicContact CG2-CE 4.49Å; I37-M40 WeakPolarHBondContact O-CB 3.48Å; I37-M40 PolarHBondContact O-N 3.33Å; I37-Q41 WeakPolarHBondContact O-CG 3.48Å; I37-Q41 PolarHBondContact O-N 3.29Å
38	Q	97.2	Very high	95.3	Very high	100 Å²	100	97.9 Å²	97.9	47%	0.467	47%	0.467	S	S	.	.	H	α-helix	trans	-62.7	-41	177.2	-74	179.5	-48	0	0	111.5	K34 F35 Q41 K42	K34-Q38 HydrophobicContact CG-CG 4.5Å; K34-Q38 WeakPolarHBondContact O-CB 3.31Å; K34-Q38 VanDerWaalsContact O-CG 3.31Å; K34-Q38 WeakPolarHBondContact O-CG 3.48Å; K34-Q38 PolarHBondContact O-N 3.36Å; F35-Q38 PolarHBondContact O-N 2.83Å; Q38-Q41 PolarHBondContact O-N 3.42Å; Q38-K42 WeakPolarHBondContact O-CB 3.35Å; Q38-K42 PolarHBondContact O-N 3.48Å
39	L	95.8	Very high	95	Very high	78 Å²	78	98.3 Å²	98.3	41%	0.408	47%	0.471	S	S	.	.	H	α-helix	trans	-63.9	-44.7	176.5	-175.4	61	0	0	0	111.3	F35 G36 I37 Q41 K42 L43	F35-L39 HydrophobicContact CE1-CD2 4.37Å; F35-L39 WeakPolarHBondContact O-CB 3.41Å; F35-L39 PolarHBondContact O-N 2.97Å; G36-L39 PolarHBondContact O-N 3.43Å; I37-L39 VanDerWaalsContact C-N 3.33Å; I37-L39 PolarHBondContact O-N 3.28Å; L39-Q41 VanDerWaalsContact C-N 3.34Å; L39-Q41 PolarHBondContact O-N 3.43Å; L39-K42 PolarHBondContact O-N 2.98Å; L39-L43 HydrophobicContact CD1-CD1 3.97Å; L39-L43 HydrophobicContact CD1-CG 4.08Å; L39-L43 HydrophobicContact CG-CD1 3.95Å; L39-L43 HydrophobicContact CG-CG 4.43Å; L39-L43 WeakPolarHBondContact O-CB 3.48Å; L39-L43 WeakPolarHBondContact O-CG 3.34Å; L39-L43 PolarHBondContact O-N 3.06Å
40	M	95.6	Very high	94.6	Very high	123 Å²	123	97.5 Å²	97.5	61%	0.606	47%	0.469	S	S	*	.	H	α-helix	trans	-56.8	-47.2	174.6	178.6	-162	70.2	0	0	111.5	G36 I37 N44	G36-M40 WeakPolarHBondContact O-CB 3.33Å; G36-M40 PolarHBondContact O-N 2.86Å; I37-M40 HydrophobicContact CG2-CE 4.49Å; I37-M40 WeakPolarHBondContact O-CB 3.48Å; I37-M40 PolarHBondContact O-N 3.33Å; M40-N44 PolarHBondContact O-N 2.94Å
41	Q	95	Very high	94.2	Very high	130 Å²	130	95.1 Å²	95.1	61%	0.607	46%	0.464	S	S	*	.	H	α-helix	trans	-64.5	-41.9	178.8	-72.4	173	-16.3	0	0	112.2	I37 Q38 L39	I37-Q41 WeakPolarHBondContact O-CG 3.48Å; I37-Q41 PolarHBondContact O-N 3.29Å; Q38-Q41 PolarHBondContact O-N 3.42Å; L39-Q41 VanDerWaalsContact C-N 3.34Å; L39-Q41 PolarHBondContact O-N 3.43Å
42	K	95.1	Very high	93.8	Very high	178 Å²	178	97.6 Å²	97.6	77%	0.774	48%	0.478	S	S	*	.	H	α-helix	trans	-64.8	-44.1	179.5	-177.4	179.4	178.8	-178.5	0	112.1	Q38 L39	Q38-K42 WeakPolarHBondContact O-CB 3.35Å; Q38-K42 PolarHBondContact O-N 3.48Å; L39-K42 PolarHBondContact O-N 2.98Å
43	L	94.3	Very high	93.5	Very high	94 Å²	94	98.1 Å²	98.1	49%	0.492	49%	0.486	S	S	.	.	H	α-helix	trans	-73.5	-34.4	-178.1	-68.3	175.4	0	0	0	112.2	L39 L45	L39-L43 HydrophobicContact CD1-CD1 3.97Å; L39-L43 HydrophobicContact CD1-CG 4.08Å; L39-L43 HydrophobicContact CG-CD1 3.95Å; L39-L43 HydrophobicContact CG-CG 4.43Å; L39-L43 WeakPolarHBondContact O-CB 3.48Å; L39-L43 WeakPolarHBondContact O-CG 3.34Å; L39-L43 PolarHBondContact O-N 3.06Å; L43-L45 HydrophobicContact CB-CD2 4Å; L43-L45 HydrophobicContact CB-CG 3.98Å; L43-L45 PolarHBondContact O-N 3.11Å; L43-L45 VanDerWaalsContact O-N 3.08Å
44	N	90.7	Very high	93	Very high	79 Å²	79	99.7 Å²	99.7	42%	0.422	50%	0.496	S	S	.	.			trans	41.6	49.5	179.7	-164.4	-8	0	0	0	112.5	M40 L46 K47 Y48	M40-N44 PolarHBondContact O-N 2.94Å; N44-L46 PolarHBondContact O-N 3.08Å; N44-L46 VanDerWaalsContact O-N 3.11Å; N44-K47 WeakPolarHBondContact O-CB 3.41Å; N44-K47 PolarHBondContact O-N 3.43Å; N44-K47 WeakPolarHBondContact OD1-CB 3.45Å; N44-Y48 PolarHBondContact O-N 3Å
45	L	90.9	Very high	92.3	Very high	112 Å²	112	98.5 Å²	98.5	59%	0.586	49%	0.494	S	S	*	.	H	α-helix	trans	-56.4	-34.8	-170	-65.4	176.8	0	0	0	112.1	L43 K47 Y48 V49	L43-L45 HydrophobicContact CB-CD2 4Å; L43-L45 HydrophobicContact CB-CG 3.98Å; L43-L45 PolarHBondContact O-N 3.11Å; L43-L45 VanDerWaalsContact O-N 3.08Å; L45-K47 VanDerWaalsContact C-N 3.34Å; L45-K47 PolarHBondContact O-N 2.85Å; L45-Y48 PolarHBondContact O-N 3.39Å; L45-Y48 VanDerWaalsContact O-N 3.16Å; L45-V49 WeakPolarHBondContact O-CG2 3.21Å; L45-V49 PolarHBondContact O-N 3.05Å
46	L	89.2	Confident	91.8	Very high	120 Å²	120	98.7 Å²	98.7	63%	0.628	50%	0.504	S	S	*	.	H	α-helix	trans	-58.9	-44.4	178.1	-177.3	61.6	0	0	0	111.9	N44 Y48 V49 I50	N44-L46 PolarHBondContact O-N 3.08Å; N44-L46 VanDerWaalsContact O-N 3.11Å; L46-Y48 VanDerWaalsContact C-N 3.29Å; L46-Y48 PolarHBondContact O-N 2.96Å; L46-V49 PolarHBondContact O-N 2.86Å; L46-I50 HydrophobicContact CD1-CD1 3.76Å; L46-I50 HydrophobicContact CD1-CG1 3.98Å; L46-I50 HydrophobicContact CD2-CD1 4.37Å; L46-I50 HydrophobicContact CG-CD1 3.7Å; L46-I50 HydrophobicContact CG-CG1 4.3Å; L46-I50 VanDerWaalsContact O-CB 3.31Å; L46-I50 WeakPolarHBondContact O-CB 3.33Å; L46-I50 VanDerWaalsContact O-CG1 3.23Å; L46-I50 WeakPolarHBondContact O-CG1 3.46Å; L46-I50 PolarHBondContact O-N 3.21Å
47	K	91	Very high	91.1	Very high	147 Å²	147	104.1 Å²	104.1	64%	0.639	51%	0.513	S	S	*	.	H	α-helix	trans	-60.7	-41.9	177	-178.5	179.9	177.9	-178.3	0	111.2	N44 L45 H51	N44-K47 WeakPolarHBondContact O-CB 3.41Å; N44-K47 PolarHBondContact O-N 3.43Å; N44-K47 WeakPolarHBondContact OD1-CB 3.45Å; L45-K47 VanDerWaalsContact C-N 3.34Å; L45-K47 PolarHBondContact O-N 2.85Å; K47-H51 WeakPolarHBondContact O-CB 3.47Å; K47-H51 PolarHBondContact O-N 3.49Å
48	Y	89.3	Confident	90.4	Very high	158 Å²	158	104.4 Å²	104.4	62%	0.62	52%	0.515	S	S	*	.	H	α-helix	trans	-66.4	-48.4	178.8	-174.9	-96.9	0	0	0	111.8	N44 L45 L46 I50 H51 V52	N44-Y48 PolarHBondContact O-N 3Å; L45-Y48 PolarHBondContact O-N 3.39Å; L45-Y48 VanDerWaalsContact O-N 3.16Å; L46-Y48 VanDerWaalsContact C-N 3.29Å; L46-Y48 PolarHBondContact O-N 2.96Å; Y48-I50 PolarHBondContact O-N 3.16Å; Y48-H51 WeakPolarHBondContact O-CB 3.36Å; Y48-H51 PolarHBondContact O-N 3.41Å; Y48-V52 HydrophobicContact CD1-CG2 4.2Å; Y48-V52 HydrophobicContact CE1-CG2 3.77Å; Y48-V52 HydrophobicContact CE2-CG2 4.44Å; Y48-V52 WeakPolarHBondContact O-CG2 3.23Å; Y48-V52 PolarHBondContact O-N 3.4Å
49	V	89.7	Confident	89.6	Confident	76 Å²	76	105.6 Å²	105.6	46%	0.461	52%	0.521	S	S	.	.	H	α-helix	trans	-61.7	-46.4	179.1	172.2	0	0	0	0	110.8	L45 L46 H51 V52 V53	L45-V49 WeakPolarHBondContact O-CG2 3.21Å; L45-V49 PolarHBondContact O-N 3.05Å; L46-V49 PolarHBondContact O-N 2.86Å; V49-H51 VanDerWaalsContact C-N 3.3Å; V49-H51 PolarHBondContact O-N 2.82Å; V49-V52 PolarHBondContact O-N 3.38Å; V49-V53 HydrophobicContact CG1-CG2 3.93Å; V49-V53 VanDerWaalsContact O-CB 3.26Å; V49-V53 WeakPolarHBondContact O-CB 3.31Å; V49-V53 WeakPolarHBondContact O-CG2 3.25Å; V49-V53 PolarHBondContact O-N 3.02Å
50	I	89.9	Confident	89	Confident	82 Å²	82	107.9 Å²	107.9	42%	0.421	53%	0.527	S	S	.	.	H	α-helix	trans	-57.7	-45.2	176.3	-73.1	173.8	0	0	0	110.5	L46 Y48 I54	L46-I50 HydrophobicContact CD1-CD1 3.76Å; L46-I50 HydrophobicContact CD1-CG1 3.98Å; L46-I50 HydrophobicContact CD2-CD1 4.37Å; L46-I50 HydrophobicContact CG-CD1 3.7Å; L46-I50 HydrophobicContact CG-CG1 4.3Å; L46-I50 VanDerWaalsContact O-CB 3.31Å; L46-I50 WeakPolarHBondContact O-CB 3.33Å; L46-I50 VanDerWaalsContact O-CG1 3.23Å; L46-I50 WeakPolarHBondContact O-CG1 3.46Å; L46-I50 PolarHBondContact O-N 3.21Å; Y48-I50 PolarHBondContact O-N 3.16Å; I50-I54 HydrophobicContact CG2-CD1 3.46Å; I50-I54 VanDerWaalsContact CG2-CD1 3.46Å; I50-I54 HydrophobicContact CG2-CG1 4.15Å; I50-I54 VanDerWaalsContact O-CB 3.25Å; I50-I54 WeakPolarHBondContact O-CB 3.26Å; I50-I54 VanDerWaalsContact O-CG1 3.26Å; I50-I54 WeakPolarHBondContact O-CG1 3.22Å; I50-I54 PolarHBondContact O-N 3.14Å
51	H	89.5	Confident	88	Confident	115 Å²	115	109.1 Å²	109.1	53%	0.532	53%	0.526	S	S	.	.	H	α-helix	trans	-60.5	-48.7	178.8	-175.7	76.4	0	0	0	112	K47 Y48 V49 N55	K47-H51 WeakPolarHBondContact O-CB 3.47Å; K47-H51 PolarHBondContact O-N 3.49Å; Y48-H51 WeakPolarHBondContact O-CB 3.36Å; Y48-H51 PolarHBondContact O-N 3.41Å; V49-H51 VanDerWaalsContact C-N 3.3Å; V49-H51 PolarHBondContact O-N 2.82Å; H51-N55 PolarHBondContact CD2-ND2 3.1Å; H51-N55 PolarHBondContact CE1-ND2 3.48Å; H51-N55 PolarHBondContact NE2-ND2 3.02Å; H51-N55 VanDerWaalsContact O-CB 3.22Å; H51-N55 WeakPolarHBondContact O-CB 3.26Å; H51-N55 PolarHBondContact O-N 3.29Å; H51-N55 PolarHBondContact O-ND2 3.36Å; H51-N55 VanDerWaalsContact O-ND2 3.1Å
52	V	90.7	Very high	87.1	Confident	60 Å²	60	111.3 Å²	111.3	36%	0.364	53%	0.534	S	S	.	.	H	α-helix	trans	-63.2	-51	178.7	172.8	0	0	0	0	110.7	Y48 V49 N55 S56	Y48-V52 HydrophobicContact CD1-CG2 4.2Å; Y48-V52 HydrophobicContact CE1-CG2 3.77Å; Y48-V52 HydrophobicContact CE2-CG2 4.44Å; Y48-V52 WeakPolarHBondContact O-CG2 3.23Å; Y48-V52 PolarHBondContact O-N 3.4Å; V49-V52 PolarHBondContact O-N 3.38Å; V52-N55 PolarHBondContact O-N 2.87Å; V52-S56 WeakPolarHBondContact O-CB 3.27Å; V52-S56 PolarHBondContact O-N 3.34Å; V52-S56 PolarHBondContact O-OG 2.96Å; V52-S56 VanDerWaalsContact O-OG 3.07Å
53	V	90.8	Very high	86.3	Confident	63 Å²	63	108.6 Å²	108.6	38%	0.382	53%	0.527	S	S	.	.	H	α-helix	trans	-60.2	-54.9	-177.3	171.1	0	0	0	0	109.8	V49 N55 S56 W57	V49-V53 HydrophobicContact CG1-CG2 3.93Å; V49-V53 VanDerWaalsContact O-CB 3.26Å; V49-V53 WeakPolarHBondContact O-CB 3.31Å; V49-V53 WeakPolarHBondContact O-CG2 3.25Å; V49-V53 PolarHBondContact O-N 3.02Å; V53-N55 VanDerWaalsContact C-N 3.32Å; V53-N55 PolarHBondContact O-N 3.07Å; V53-S56 PolarHBondContact O-N 2.87Å; V53-S56 VanDerWaalsContact O-N 3.14Å; V53-W57 VanDerWaalsContact CG1-NE1 3.31Å; V53-W57 PolarHBondContact O-N 2.89Å
54	I	89.1	Confident	84.9	Confident	86 Å²	86	112.4 Å²	112.4	44%	0.441	55%	0.546	S	S	.	.	H	α-helix	trans	-58.2	-44.2	179.9	-68.5	178.8	0	0	0	111.3	I50 S56 W57 L58	I50-I54 HydrophobicContact CG2-CD1 3.46Å; I50-I54 VanDerWaalsContact CG2-CD1 3.46Å; I50-I54 HydrophobicContact CG2-CG1 4.15Å; I50-I54 VanDerWaalsContact O-CB 3.25Å; I50-I54 WeakPolarHBondContact O-CB 3.26Å; I50-I54 VanDerWaalsContact O-CG1 3.26Å; I50-I54 WeakPolarHBondContact O-CG1 3.22Å; I50-I54 PolarHBondContact O-N 3.14Å; I54-S56 VanDerWaalsContact C-N 3.34Å; I54-S56 PolarHBondContact O-N 2.86Å; I54-W57 PolarHBondContact O-N 3.34Å; I54-L58 HydrophobicContact CG2-CD1 3.8Å; I54-L58 HydrophobicContact CG2-CG 4.17Å; I54-L58 WeakPolarHBondContact O-CB 3.41Å; I54-L58 VanDerWaalsContact O-CG 3.27Å; I54-L58 WeakPolarHBondContact O-CG 3.4Å; I54-L58 PolarHBondContact O-N 3.45Å
55	N	83.4	Confident	84.7	Confident	73 Å²	73	114.1 Å²	114.1	39%	0.39	55%	0.552	S	S	.	*	H	α-helix	trans	-64.1	-39.4	178.5	-71.6	-19.8	0	0	0	112.2	H51 V52 V53 L58 H59	H51-N55 PolarHBondContact CD2-ND2 3.1Å; H51-N55 PolarHBondContact CE1-ND2 3.48Å; H51-N55 PolarHBondContact NE2-ND2 3.02Å; H51-N55 VanDerWaalsContact O-CB 3.22Å; H51-N55 WeakPolarHBondContact O-CB 3.26Å; H51-N55 PolarHBondContact O-N 3.29Å; H51-N55 PolarHBondContact O-ND2 3.36Å; H51-N55 VanDerWaalsContact O-ND2 3.1Å; V52-N55 PolarHBondContact O-N 2.87Å; V53-N55 VanDerWaalsContact C-N 3.32Å; V53-N55 PolarHBondContact O-N 3.07Å; N55-L58 PolarHBondContact O-N 3.17Å; N55-H59 WeakPolarHBondContact O-CB 3.15Å; N55-H59 PolarHBondContact O-N 2.89Å
56	S	86.8	Confident	84.3	Confident	73 Å²	73	114.2 Å²	114.2	51%	0.51	55%	0.551	S	S	.	*	H	α-helix	trans	-64.6	-44	175.1	-66.1	0	0	0	0	111.9	V52 V53 I54 H59 F60	V52-S56 WeakPolarHBondContact O-CB 3.27Å; V52-S56 PolarHBondContact O-N 3.34Å; V52-S56 PolarHBondContact O-OG 2.96Å; V52-S56 VanDerWaalsContact O-OG 3.07Å; V53-S56 PolarHBondContact O-N 2.87Å; V53-S56 VanDerWaalsContact O-N 3.14Å; I54-S56 VanDerWaalsContact C-N 3.34Å; I54-S56 PolarHBondContact O-N 2.86Å; S56-H59 PolarHBondContact O-N 3.33Å; S56-F60 PolarHBondContact O-N 3.31Å
57	W	82.6	Confident	84.1	Confident	152 Å²	152	113.8 Å²	113.8	58%	0.576	55%	0.546	S	S	*	.	H	α-helix	trans	-61.6	-47.4	174.8	-76	103.9	0	0	0	111.4	V53 I54 H59 F60 Y61	V53-W57 VanDerWaalsContact CG1-NE1 3.31Å; V53-W57 PolarHBondContact O-N 2.89Å; I54-W57 PolarHBondContact O-N 3.34Å; W57-H59 VanDerWaalsContact C-N 3.27Å; W57-H59 PolarHBondContact O-N 3.14Å; W57-F60 WeakPolarHBondContact O-CB 3.42Å; W57-F60 PolarHBondContact O-N 3.33Å; W57-F60 VanDerWaalsContact O-N 3.14Å; W57-Y61 HydrophobicContact CE3-CE2 4.12Å; W57-Y61 WeakPolarHBondContact O-CD2 3.41Å; W57-Y61 PolarHBondContact O-N 3.3Å
58	L	81.8	Confident	83.7	Confident	94 Å²	94	111.9 Å²	111.9	49%	0.492	54%	0.541	S	S	.	.	H	α-helix	trans	-62.1	-35	177.1	-72.1	175.5	0	0	0	112.4	I54 N55 K62	I54-L58 HydrophobicContact CG2-CD1 3.8Å; I54-L58 HydrophobicContact CG2-CG 4.17Å; I54-L58 WeakPolarHBondContact O-CB 3.41Å; I54-L58 VanDerWaalsContact O-CG 3.27Å; I54-L58 WeakPolarHBondContact O-CG 3.4Å; I54-L58 PolarHBondContact O-N 3.45Å; N55-L58 PolarHBondContact O-N 3.17Å; L58-K62 WeakPolarHBondContact O-CG 3.38Å; L58-K62 PolarHBondContact O-N 3.02Å
59	H	80.5	Confident	83.3	Confident	125 Å²	125	109 Å²	109	58%	0.579	54%	0.536	S	S	*	.	H	α-helix	trans	-64.9	-47	173.2	-172.4	66.2	0	0	0	110.6	N55 S56 W57 Y61 K62 I63	N55-H59 WeakPolarHBondContact O-CB 3.15Å; N55-H59 PolarHBondContact O-N 2.89Å; S56-H59 PolarHBondContact O-N 3.33Å; W57-H59 VanDerWaalsContact C-N 3.27Å; W57-H59 PolarHBondContact O-N 3.14Å; H59-Y61 VanDerWaalsContact C-N 3.34Å; H59-Y61 PolarHBondContact O-N 3.36Å; H59-K62 PolarHBondContact O-N 3.38Å; H59-K62 VanDerWaalsContact O-N 3.07Å; H59-I63 WeakPolarHBondContact O-CG1 3.1Å
60	F	82.4	Confident	82.9	Confident	125 Å²	125	111.2 Å²	111.2	55%	0.548	54%	0.541	S	S	.	.	H	α-helix	trans	-56.8	-43.7	178	-166.7	-93.9	0	0	0	112.6	S56 W57 K62 I63 L64	S56-F60 PolarHBondContact O-N 3.31Å; W57-F60 WeakPolarHBondContact O-CB 3.42Å; W57-F60 PolarHBondContact O-N 3.33Å; W57-F60 VanDerWaalsContact O-N 3.14Å; F60-K62 VanDerWaalsContact C-N 3.28Å; F60-K62 PolarHBondContact O-N 3.07Å; F60-I63 PolarHBondContact O-N 3.37Å; F60-L64 HydrophobicContact CD1-CD1 4.09Å; F60-L64 HydrophobicContact CE1-CD1 3.85Å
61	Y	74.5	Confident	82.4	Confident	150 Å²	150	113.3 Å²	113.3	59%	0.588	55%	0.55	S	S	*	.	H	α-helix	trans	-68.9	-18.7	177.5	-77.3	-70.1	0	0	0	114.7	W57 H59	W57-Y61 HydrophobicContact CE3-CE2 4.12Å; W57-Y61 WeakPolarHBondContact O-CD2 3.41Å; W57-Y61 PolarHBondContact O-N 3.3Å; H59-Y61 VanDerWaalsContact C-N 3.34Å; H59-Y61 PolarHBondContact O-N 3.36Å
62	K	77.7	Confident	81.8	Confident	176 Å²	176	113.2 Å²	113.2	77%	0.765	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.4	-13.5	176.8	-76	176.7	179.5	-176.4	0	113.6	L58 H59 F60	L58-K62 WeakPolarHBondContact O-CG 3.38Å; L58-K62 PolarHBondContact O-N 3.02Å; H59-K62 PolarHBondContact O-N 3.38Å; H59-K62 VanDerWaalsContact O-N 3.07Å; F60-K62 VanDerWaalsContact C-N 3.28Å; F60-K62 PolarHBondContact O-N 3.07Å
63	I	77.5	Confident	81.1	Confident	121 Å²	121	117.6 Å²	117.6	62%	0.621	57%	0.567	S	S	*	*			trans	-100.7	-3.6	-178.6	-17.7	177.1	0	0	0	111.9	H59 F60	H59-I63 WeakPolarHBondContact O-CG1 3.1Å; F60-I63 PolarHBondContact O-N 3.37Å
64	L	66	Low	80.2	Confident	173 Å²	173	122.5 Å²	122.5	91%	0.906	58%	0.583	S	S	*	*			trans	-97.9	0	171.4	-64.3	175.2	0	0	0	109.6	F60	F60-L64 HydrophobicContact CD1-CD1 4.09Å; F60-L64 HydrophobicContact CE1-CD1 3.85Å

Retrieved 64 of 64 residues in 119 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).