A0A5K4FCR2_SCHMA Loading...

Cyclin-dependent kinase 2-associated protein

AlphaFold DB , UniProt , Accession A0A5K4FCR2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 75 aa.

						>A0A5K4FCR2_SCHMA|A0A5K4FCR2
MTQNTSIPVNYPMMPPMDDLNKYAHLLQVIEEMGRDIKPTYANNKNAAERLKKNIHTARILVRECVSELERVMKA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.8	Low	58.4	Low	241 Å²	241	148.8 Å²	148.8	100%	1.187	80%	0.8	S	S	*	*				0	100.3	0	-63.1	174.6	-179.2	0	0	106.2	Q3	M1-Q3 PolarHBondContact O-N 3.33Å
2	T	62.5	Low	58.1	Low	145 Å²	145	143.5 Å²	143.5	89%	0.89	78%	0.78	S	S	*	*			trans	-71.1	125.3	-168.7	34.9	0	0	0	0	111.1	N4	T2-N4 PolarHBondContact O-N 3.12Å
3	Q	54.4	Low	57.6	Low	184 Å²	184	145 Å²	145	86%	0.86	78%	0.781	S	S	*	*			trans	-70.5	121.3	176.7	-67.2	177.4	8.4	0	0	109.2	M1 T5	M1-Q3 PolarHBondContact O-N 3.33Å; Q3-T5 PolarHBondContact O-N 3.47Å
4	N	59.6	Low	57.3	Low	151 Å²	151	144.4 Å²	144.4	81%	0.807	77%	0.774	S	S	*	*			trans	-82.9	104.9	173.5	-172	17.2	0	0	0	108.6	T2 S6	T2-N4 PolarHBondContact O-N 3.12Å; N4-S6 PolarHBondContact O-N 3.34Å
5	T	61.1	Low	57.3	Low	112 Å²	112	138.9 Å²	138.9	69%	0.687	75%	0.749	S	S	*	*			trans	-75.1	105.7	175.6	-57.9	0	0	0	0	109.4	Q3 I7	Q3-T5 PolarHBondContact O-N 3.47Å; T5-I7 PolarHBondContact O-N 3.32Å
6	S	61.8	Low	57.2	Low	107 Å²	107	135.4 Å²	135.4	75%	0.748	74%	0.736	S	S	*	*			trans	-67.8	106.5	170.8	-27.8	0	0	0	0	109.4	N4 P8	N4-S6 PolarHBondContact O-N 3.34Å; S6-P8 WeakPolarHBondContact O-CD 3.34Å
7	I	66.7	Low	57.2	Low	147 Å²	147	133.5 Å²	133.5	75%	0.754	72%	0.722	S	S	*	*			trans	-77.9	122.4	171.9	-35.4	171.4	0	0	0	107	T5 V9	T5-I7 PolarHBondContact O-N 3.32Å; I7-V9 PolarHBondContact O-N 2.68Å
8	P	57.3	Low	57.5	Low	115 Å²	115	132.4 Å²	132.4	75%	0.747	72%	0.716	S	S	*	*			trans	-69.4	115.5	174	26.6	-30.9	0	0	0	109.2	S6 N10	S6-P8 WeakPolarHBondContact O-CD 3.34Å; P8-N10 PolarHBondContact O-N 3.46Å
9	V	58	Low	57.7	Low	103 Å²	103	128.2 Å²	128.2	62%	0.624	69%	0.693	S	S	*	*			trans	-72.1	96.7	171.9	-169.7	0	0	0	0	107.4	I7 Y11	I7-V9 PolarHBondContact O-N 2.68Å; V9-Y11 HydrophobicContact CB-CE2 4.13Å; V9-Y11 HydrophobicContact CG1-CD1 4.43Å; V9-Y11 HydrophobicContact CG1-CD2 4.44Å; V9-Y11 HydrophobicContact CG1-CE1 4Å; V9-Y11 HydrophobicContact CG1-CE2 4Å; V9-Y11 WeakPolarHBondContact O-CD2 3.43Å; V9-Y11 PolarHBondContact O-N 2.68Å; V9-Y11 VanDerWaalsContact O-N 3.13Å
10	N	53.6	Low	57.9	Low	139 Å²	139	125.7 Å²	125.7	74%	0.743	68%	0.679	S	S	*	*			trans	-70.8	97.9	170.4	-178.7	76.8	0	0	0	108.1	P8 P12	P8-N10 PolarHBondContact O-N 3.46Å; N10-P12 WeakPolarHBondContact O-CD 3.25Å
11	Y	53.9	Low	59	Low	193 Å²	193	124.3 Å²	124.3	76%	0.757	67%	0.671	S	S	*	*			trans	-72.4	109.7	169	-64.5	-79.9	0	0	0	108.1	V9 M13	V9-Y11 HydrophobicContact CB-CE2 4.13Å; V9-Y11 HydrophobicContact CG1-CD1 4.43Å; V9-Y11 HydrophobicContact CG1-CD2 4.44Å; V9-Y11 HydrophobicContact CG1-CE1 4Å; V9-Y11 HydrophobicContact CG1-CE2 4Å; V9-Y11 WeakPolarHBondContact O-CD2 3.43Å; V9-Y11 PolarHBondContact O-N 2.68Å; V9-Y11 VanDerWaalsContact O-N 3.13Å; Y11-M13 PolarHBondContact O-N 3.28Å
12	P	54.1	Low	60.5	Low	85 Å²	85	115 Å²	115	55%	0.552	62%	0.624	S	S	*	*			trans	-71	129.2	-179.6	32.6	-33.8	0	0	0	109.1	N10	N10-P12 WeakPolarHBondContact O-CD 3.25Å
13	M	52.1	Low	61.6	Low	163 Å²	163	114.6 Å²	114.6	80%	0.803	61%	0.607	S	S	*	*			trans	41.2	102.5	163	54.4	-105.5	174	0	0	117.7	Y11	Y11-M13 PolarHBondContact O-N 3.28Å
14	M	52.8	Low	63.3	Low	136 Å²	136	108.2 Å²	108.2	67%	0.67	59%	0.586	S	S	*	*	P	Polyproline II helix	trans	-51.6	121	163.9	-153.5	172.7	-155.3	0	0	109.7	M17	M14-M17 HydrophobicContact CE-CE 3.27Å; M14-M17 HydrophobicContact CE-SD 3.47Å; M14-M17 WeakPolarHBondContact CE-SD 3.36Å; M14-M17 HydrophobicContact CG-SD 4.45Å; M14-M17 HydrophobicContact SD-CE 3.59Å; M14-M17 VanDerWaalsContact SD-CE 3.59Å; M14-M17 HydrophobicContact SD-SD 3.86Å
15	P	57.7	Low	64.8	Low	63 Å²	63	105.4 Å²	105.4	41%	0.409	57%	0.568	S	S	.	*	P	Polyproline II helix	trans	-61.4	159.1	170.9	25.3	-31.6	0	0	0	109.7	M17 L20	P15-M17 PolarHBondContact O-N 2.97Å; P15-M17 VanDerWaalsContact O-N 3.09Å; P15-L20 HydrophobicContact CG-CB 4.49Å; P15-L20 HydrophobicContact CG-CD1 4.4Å
16	P	55.6	Low	66.3	Low	83 Å²	83	101.4 Å²	101.4	54%	0.539	54%	0.542	S	S	.	.	P	Polyproline II helix	trans	-47.3	124.1	175.7	-22.1	31.6	0	0	0	108.8	D18 D19 L20	P16-D18 PolarHBondContact O-N 3.49Å; P16-D19 WeakPolarHBondContact CG-OD2 3.41Å; P16-D19 PolarHBondContact O-N 2.99Å; P16-L20 PolarHBondContact O-N 2.94Å
17	M	57.4	Low	67.8	Low	102 Å²	102	99.8 Å²	99.8	50%	0.502	53%	0.525	S	S	.	.	H	α-helix	trans	-52.1	-30.5	-172.9	-72	-75.3	-143.2	0	0	112	M14 P15 D19 L20 N21	M14-M17 HydrophobicContact CE-CE 3.27Å; M14-M17 HydrophobicContact CE-SD 3.47Å; M14-M17 WeakPolarHBondContact CE-SD 3.36Å; M14-M17 HydrophobicContact CG-SD 4.45Å; M14-M17 HydrophobicContact SD-CE 3.59Å; M14-M17 VanDerWaalsContact SD-CE 3.59Å; M14-M17 HydrophobicContact SD-SD 3.86Å; P15-M17 PolarHBondContact O-N 2.97Å; P15-M17 VanDerWaalsContact O-N 3.09Å; M17-D19 PolarHBondContact O-N 3.25Å; M17-L20 PolarHBondContact O-N 2.97Å; M17-N21 VanDerWaalsContact O-CB 3.27Å; M17-N21 WeakPolarHBondContact O-CB 3.39Å; M17-N21 PolarHBondContact O-N 3.26Å; M17-N21 PolarHBondContact O-ND2 2.87Å; M17-N21 PolarHBondContact O-OD1 3.04Å
18	D	62.5	Low	69.1	Low	114 Å²	114	98 Å²	98	61%	0.61	51%	0.513	S	S	*	.	H	α-helix	trans	-61.4	-38.8	175.9	-60.4	-65	0	0	0	113.5	P16 N21 K22	P16-D18 PolarHBondContact O-N 3.49Å; D18-N21 WeakPolarHBondContact O-CB 3.49Å; D18-N21 PolarHBondContact O-N 3.4Å; D18-K22 WeakPolarHBondContact O-CG 3.39Å; D18-K22 PolarHBondContact O-N 3.16Å
19	D	60.9	Low	70.8	Confident	53 Å²	53	92.8 Å²	92.8	28%	0.283	48%	0.479	S	S	.	.	H	α-helix	trans	-74.5	-40.5	179.6	-61.7	-33.3	0	0	0	111.2	P16 M17 N21 K22 Y23 E68	P16-D19 WeakPolarHBondContact CG-OD2 3.41Å; P16-D19 PolarHBondContact O-N 2.99Å; M17-D19 PolarHBondContact O-N 3.25Å; D19-N21 PolarHBondContact O-N 2.89Å; D19-K22 PolarHBondContact O-N 3.49Å; D19-K22 IonicContact OD1-NZ 2.68Å; D19-Y23 PolarHBondContact O-N 3.37Å; D19-E68 VanDerWaalsContact OD1-CD 3.26Å
20	L	62	Low	72.6	Confident	78 Å²	78	92 Å²	92	41%	0.408	47%	0.47	S	S	.	.	H	α-helix	trans	-62.9	-36.7	173	-164.5	67.3	0	0	0	110.5	P15 P16 M17 Y23 A24	P15-L20 HydrophobicContact CG-CB 4.49Å; P15-L20 HydrophobicContact CG-CD1 4.4Å; P16-L20 PolarHBondContact O-N 2.94Å; M17-L20 PolarHBondContact O-N 2.97Å; L20-Y23 PolarHBondContact O-N 3.41Å; L20-A24 WeakPolarHBondContact O-CB 3.44Å; L20-A24 PolarHBondContact O-N 3.09Å
21	N	81	Confident	74.6	Confident	96 Å²	96	91.3 Å²	91.3	51%	0.513	46%	0.463	S	S	.	.	H	α-helix	trans	-65.2	-41.8	174.3	-72.8	-26.1	0	0	0	111.8	M17 D18 D19 H25	M17-N21 VanDerWaalsContact O-CB 3.27Å; M17-N21 WeakPolarHBondContact O-CB 3.39Å; M17-N21 PolarHBondContact O-N 3.26Å; M17-N21 PolarHBondContact O-ND2 2.87Å; M17-N21 PolarHBondContact O-OD1 3.04Å; D18-N21 WeakPolarHBondContact O-CB 3.49Å; D18-N21 PolarHBondContact O-N 3.4Å; D19-N21 PolarHBondContact O-N 2.89Å; N21-H25 WeakPolarHBondContact O-CB 3.36Å; N21-H25 PolarHBondContact O-N 3.46Å
22	K	85.3	Confident	76.5	Confident	47 Å²	47	85.1 Å²	85.1	20%	0.204	44%	0.441	C	S	.	.	H	α-helix	trans	-63.6	-44.2	176.1	-70.6	175.1	-160.8	169.2	0	112	D18 D19 H25 L26 E68	D18-K22 WeakPolarHBondContact O-CG 3.39Å; D18-K22 PolarHBondContact O-N 3.16Å; D19-K22 PolarHBondContact O-N 3.49Å; D19-K22 IonicContact OD1-NZ 2.68Å; K22-H25 PolarHBondContact O-N 3.09Å; K22-L26 WeakPolarHBondContact O-CB 3.24Å; K22-L26 PolarHBondContact O-N 2.86Å; K22-E68 IonicContact NZ-OE1 2.68Å; K22-E68 PolarHBondContact NZ-OE1 2.97Å; K22-E68 IonicContact NZ-OE2 2.7Å; K22-E68 PolarHBondContact NZ-OE2 3.22Å
23	Y	86.4	Confident	78.5	Confident	136 Å²	136	82.6 Å²	82.6	53%	0.533	42%	0.422	S	S	.	.	H	α-helix	trans	-66.3	-45.3	177.6	-179.4	-107.7	0	0	0	112	D19 L20 H25 L26 L27	D19-Y23 PolarHBondContact O-N 3.37Å; L20-Y23 PolarHBondContact O-N 3.41Å; Y23-H25 VanDerWaalsContact C-N 3.32Å; Y23-H25 PolarHBondContact O-N 3.37Å; Y23-L26 WeakPolarHBondContact O-CB 3.41Å; Y23-L26 PolarHBondContact O-N 3.45Å; Y23-L27 HydrophobicContact CD1-CD1 3.92Å; Y23-L27 HydrophobicContact CD1-CG 4.39Å; Y23-L27 HydrophobicContact CE1-CD1 3.37Å; Y23-L27 HydrophobicContact CE1-CG 3.98Å; Y23-L27 HydrophobicContact CE2-CD2 4.45Å; Y23-L27 HydrophobicContact CE2-CG 4.34Å; Y23-L27 WeakPolarHBondContact O-CG 3.27Å; Y23-L27 PolarHBondContact O-N 2.99Å
24	A	89.6	Confident	80.6	Confident	50 Å²	50	77 Å²	77	41%	0.413	41%	0.406	S	S	.	.	H	α-helix	trans	-60.7	-41.6	175.2	0	0	0	0	0	111.8	L20 L27 Q28	L20-A24 WeakPolarHBondContact O-CB 3.44Å; L20-A24 PolarHBondContact O-N 3.09Å; A24-L27 PolarHBondContact O-N 2.96Å; A24-Q28 WeakPolarHBondContact O-CB 3.47Å; A24-Q28 PolarHBondContact O-N 2.86Å
25	H	90.9	Very high	82.6	Confident	91 Å²	91	77.8 Å²	77.8	42%	0.421	40%	0.402	S	S	.	.	H	α-helix	trans	-61.6	-45.3	174.4	-164.6	141.5	0	0	0	110.8	N21 K22 Y23 L27 Q28 V29 L61	N21-H25 WeakPolarHBondContact O-CB 3.36Å; N21-H25 PolarHBondContact O-N 3.46Å; K22-H25 PolarHBondContact O-N 3.09Å; Y23-H25 VanDerWaalsContact C-N 3.32Å; Y23-H25 PolarHBondContact O-N 3.37Å; H25-L27 PolarHBondContact O-N 3.31Å; H25-Q28 WeakPolarHBondContact O-CB 3.44Å; H25-Q28 PolarHBondContact O-N 2.97Å; H25-V29 WeakPolarHBondContact O-CG2 3.38Å; H25-V29 PolarHBondContact O-N 3.49Å; H25-L61 HydrophobicContact CB-CD1 4.4Å
26	L	92.7	Very high	84.4	Confident	29 Å²	29	75.3 Å²	75.3	15%	0.152	39%	0.385	C	S	.	.	H	α-helix	trans	-60.7	-44.2	177.4	-179.1	62	0	0	0	111.8	K22 Y23 V29 I30 A58 L61 V62	K22-L26 WeakPolarHBondContact O-CB 3.24Å; K22-L26 PolarHBondContact O-N 2.86Å; Y23-L26 WeakPolarHBondContact O-CB 3.41Å; Y23-L26 PolarHBondContact O-N 3.45Å; L26-V29 PolarHBondContact O-N 3.09Å; L26-I30 HydrophobicContact CD1-CD1 4.35Å; L26-I30 HydrophobicContact CG-CD1 4.09Å; L26-I30 VanDerWaalsContact O-CG1 3.29Å; L26-I30 WeakPolarHBondContact O-CG1 3.42Å; L26-I30 PolarHBondContact O-N 3.16Å; L26-A58 HydrophobicContact CD1-CB 4.07Å; L26-L61 HydrophobicContact CD1-CB 4.44Å; L26-V62 HydrophobicContact CD1-CG2 3.97Å; L26-V62 HydrophobicContact CD2-CG2 3.91Å
27	L	93.4	Very high	86.3	Confident	72 Å²	72	75.3 Å²	75.3	38%	0.377	38%	0.379	S	S	.	.	H	α-helix	trans	-59.6	-46.5	175	-73.9	179.3	0	0	0	111.7	Y23 A24 H25 V29 I30 E31	Y23-L27 HydrophobicContact CD1-CD1 3.92Å; Y23-L27 HydrophobicContact CD1-CG 4.39Å; Y23-L27 HydrophobicContact CE1-CD1 3.37Å; Y23-L27 HydrophobicContact CE1-CG 3.98Å; Y23-L27 HydrophobicContact CE2-CD2 4.45Å; Y23-L27 HydrophobicContact CE2-CG 4.34Å; Y23-L27 WeakPolarHBondContact O-CG 3.27Å; Y23-L27 PolarHBondContact O-N 2.99Å; A24-L27 PolarHBondContact O-N 2.96Å; H25-L27 PolarHBondContact O-N 3.31Å; L27-V29 VanDerWaalsContact C-N 3.35Å; L27-V29 PolarHBondContact O-N 3.1Å; L27-I30 WeakPolarHBondContact O-CB 3.42Å; L27-I30 PolarHBondContact O-N 3.43Å; L27-I30 VanDerWaalsContact O-N 3.16Å; L27-E31 PolarHBondContact O-N 3.49Å
28	Q	93.1	Very high	88.1	Confident	111 Å²	111	79 Å²	79	52%	0.519	39%	0.392	S	S	.	.	H	α-helix	trans	-56.5	-50	176.4	-176.6	-178	-40.7	0	0	110.8	A24 H25 I30 E31 E32	A24-Q28 WeakPolarHBondContact O-CB 3.47Å; A24-Q28 PolarHBondContact O-N 2.86Å; H25-Q28 WeakPolarHBondContact O-CB 3.44Å; H25-Q28 PolarHBondContact O-N 2.97Å; Q28-I30 VanDerWaalsContact C-N 3.26Å; Q28-I30 PolarHBondContact O-N 2.94Å; Q28-E31 WeakPolarHBondContact O-CB 3.3Å; Q28-E31 PolarHBondContact O-N 3.02Å; Q28-E31 VanDerWaalsContact O-N 3.1Å; Q28-E32 VanDerWaalsContact O-CG 3.3Å; Q28-E32 WeakPolarHBondContact O-CG 3.47Å; Q28-E32 PolarHBondContact O-N 3.41Å
29	V	94.5	Very high	89.7	Confident	4 Å²	4	75.2 Å²	75.2	2%	0.024	37%	0.374	C	S	.	.	H	α-helix	trans	-59.3	-38.3	179.5	173.7	0	0	0	0	111.4	H25 L26 L27 E32 M33 N54 T57 A58 L61	H25-V29 WeakPolarHBondContact O-CG2 3.38Å; H25-V29 PolarHBondContact O-N 3.49Å; L26-V29 PolarHBondContact O-N 3.09Å; L27-V29 VanDerWaalsContact C-N 3.35Å; L27-V29 PolarHBondContact O-N 3.1Å; V29-E32 PolarHBondContact O-N 2.94Å; V29-M33 HydrophobicContact CG1-CE 4.24Å; V29-M33 VanDerWaalsContact O-CG 3.3Å; V29-M33 WeakPolarHBondContact O-CG 3.27Å; V29-M33 PolarHBondContact O-N 2.84Å; V29-N54 HydrophobicContact CG1-CB 3.93Å; V29-N54 VanDerWaalsContact CG1-O 3.31Å; V29-N54 WeakPolarHBondContact CG1-O 3.48Å; V29-T57 HydrophobicContact CG2-CG2 4.31Å; V29-A58 HydrophobicContact CG1-CB 3.88Å; V29-L61 HydrophobicContact CG2-CD1 4.38Å
30	I	95.3	Very high	91.3	Very high	86 Å²	86	74.6 Å²	74.6	44%	0.441	37%	0.373	S	S	.	.	H	α-helix	trans	-63.6	-44.7	175.7	-68.6	165.3	0	0	0	111.6	L26 L27 Q28 E32 M33 G34	L26-I30 HydrophobicContact CD1-CD1 4.35Å; L26-I30 HydrophobicContact CG-CD1 4.09Å; L26-I30 VanDerWaalsContact O-CG1 3.29Å; L26-I30 WeakPolarHBondContact O-CG1 3.42Å; L26-I30 PolarHBondContact O-N 3.16Å; L27-I30 WeakPolarHBondContact O-CB 3.42Å; L27-I30 PolarHBondContact O-N 3.43Å; L27-I30 VanDerWaalsContact O-N 3.16Å; Q28-I30 VanDerWaalsContact C-N 3.26Å; Q28-I30 PolarHBondContact O-N 2.94Å; I30-E32 VanDerWaalsContact C-N 3.33Å; I30-E32 PolarHBondContact O-N 3.27Å; I30-M33 HydrophobicContact CB-CE 4.27Å; I30-M33 HydrophobicContact CG1-CE 3.82Å; I30-M33 PolarHBondContact O-N 3.22Å; I30-G34 PolarHBondContact O-N 2.88Å
31	E	95.6	Very high	92.9	Very high	126 Å²	126	80.6 Å²	80.6	59%	0.589	39%	0.391	S	S	*	.	H	α-helix	trans	-61.9	-40.7	175.6	-68.6	-176.1	171.7	0	0	112.1	L27 Q28 G34 R35	L27-E31 PolarHBondContact O-N 3.49Å; Q28-E31 WeakPolarHBondContact O-CB 3.3Å; Q28-E31 PolarHBondContact O-N 3.02Å; Q28-E31 VanDerWaalsContact O-N 3.1Å; E31-G34 PolarHBondContact O-N 3.23Å; E31-R35 PolarHBondContact O-N 3.49Å
32	E	93.8	Very high	93.6	Very high	63 Å²	63	79.9 Å²	79.9	29%	0.294	40%	0.398	S	S	.	.	H	α-helix	trans	-62.9	-45.1	176.1	-60.7	-154.4	95.6	0	0	111.8	Q28 V29 I30 G34 R35 D36 N54	Q28-E32 VanDerWaalsContact O-CG 3.3Å; Q28-E32 WeakPolarHBondContact O-CG 3.47Å; Q28-E32 PolarHBondContact O-N 3.41Å; V29-E32 PolarHBondContact O-N 2.94Å; I30-E32 VanDerWaalsContact C-N 3.33Å; I30-E32 PolarHBondContact O-N 3.27Å; E32-G34 VanDerWaalsContact C-N 3.28Å; E32-G34 PolarHBondContact O-N 3.48Å; E32-R35 PolarHBondContact O-N 3.45Å; E32-R35 VanDerWaalsContact O-N 3.15Å; E32-R35 IonicContact OE1-NH2 3.31Å; E32-D36 PolarHBondContact O-N 3.44Å; E32-N54 WeakPolarHBondContact CB-ND2 3.36Å
33	M	95.5	Very high	93.9	Very high	32 Å²	32	84 Å²	84	16%	0.158	42%	0.423	C	S	.	.	H	α-helix	trans	-56.7	-44.9	174.8	-71.9	-172.3	-65.9	0	0	110.9	V29 I30 R35 D36 I37 L51 N54 I55 A58	V29-M33 HydrophobicContact CG1-CE 4.24Å; V29-M33 VanDerWaalsContact O-CG 3.3Å; V29-M33 WeakPolarHBondContact O-CG 3.27Å; V29-M33 PolarHBondContact O-N 2.84Å; I30-M33 HydrophobicContact CB-CE 4.27Å; I30-M33 HydrophobicContact CG1-CE 3.82Å; I30-M33 PolarHBondContact O-N 3.22Å; M33-R35 VanDerWaalsContact C-N 3.25Å; M33-R35 PolarHBondContact O-N 3.4Å; M33-D36 PolarHBondContact O-N 3.13Å; M33-I37 WeakPolarHBondContact O-CG1 3.14Å; M33-I37 PolarHBondContact O-N 3.41Å; M33-I37 VanDerWaalsContact O-N 3.17Å; M33-L51 HydrophobicContact CB-CD1 3.85Å; M33-L51 HydrophobicContact CG-CD1 3.92Å; M33-N54 HydrophobicContact CG-CB 3.48Å; M33-N54 VanDerWaalsContact CG-CB 3.48Å; M33-N54 HydrophobicContact SD-CB 4.2Å; M33-I55 HydrophobicContact SD-CB 4.37Å; M33-I55 HydrophobicContact SD-CG1 3.58Å; M33-I55 VanDerWaalsContact SD-CG1 3.58Å; M33-A58 HydrophobicContact CE-CB 4.2Å
34	G	95.8	Very high	94.3	Very high	45 Å²	45	80.6 Å²	80.6	46%	0.464	41%	0.414	S	S	.	.	H	α-helix	trans	-55.2	-37.7	177.7	0	0	0	0	0	113.7	I30 E31 E32	I30-G34 PolarHBondContact O-N 2.88Å; E31-G34 PolarHBondContact O-N 3.23Å; E32-G34 VanDerWaalsContact C-N 3.28Å; E32-G34 PolarHBondContact O-N 3.48Å
35	R	95.1	Very high	94.6	Very high	153 Å²	153	86.1 Å²	86.1	58%	0.577	43%	0.428	S	S	*	.	H	α-helix	trans	-70.4	-31.8	177	-65.7	-169.3	-69.5	-100.2	14.4	113.1	E31 E32 M33 P39	E31-R35 PolarHBondContact O-N 3.49Å; E32-R35 PolarHBondContact O-N 3.45Å; E32-R35 VanDerWaalsContact O-N 3.15Å; E32-R35 IonicContact OE1-NH2 3.31Å; M33-R35 VanDerWaalsContact C-N 3.25Å; M33-R35 PolarHBondContact O-N 3.4Å; R35-P39 WeakPolarHBondContact O-CD 3.48Å; R35-P39 WeakPolarHBondContact O-CG 3.2Å
36	D	95.2	Very high	94.8	Very high	11 Å²	11	87.3 Å²	87.3	6%	0.059	44%	0.438	C	S	.	.	H	α-helix	trans	-85.9	-14.3	-178.1	-81.6	-40.8	0	0	0	114.2	E32 M33 P39 T40 A47 R50 L51	E32-D36 PolarHBondContact O-N 3.44Å; M33-D36 PolarHBondContact O-N 3.13Å; D36-P39 WeakPolarHBondContact O-CD 3.41Å; D36-P39 WeakPolarHBondContact O-CG 3.4Å; D36-T40 VanDerWaalsContact O-CB 3.27Å; D36-T40 WeakPolarHBondContact O-CB 3.49Å; D36-T40 PolarHBondContact O-N 2.91Å; D36-T40 PolarHBondContact O-OG1 3.23Å; D36-A47 HydrophobicContact CB-CB 4.42Å; D36-R50 IonicContact OD1-CZ 3.89Å; D36-R50 VanDerWaalsContact OD1-CZ 3.31Å; D36-R50 IonicContact OD1-NE 3.7Å; D36-R50 PolarHBondContact OD1-NE 3.45Å; D36-R50 VanDerWaalsContact OD1-NE 3.09Å; D36-R50 IonicContact OD1-NH2 3.19Å; D36-R50 PolarHBondContact OD1-NH2 3.19Å; D36-R50 WeakPolarHBondContact OD2-CB 3.45Å; D36-R50 IonicContact OD2-NE 3.09Å; D36-R50 PolarHBondContact OD2-NE 2.92Å; D36-L51 HydrophobicContact CB-CB 4.13Å
37	I	96.1	Very high	94.9	Very high	83 Å²	83	85.9 Å²	85.9	43%	0.426	43%	0.431	S	S	.	.	H	α-helix	trans	-57.6	-57.5	179.3	-69	170.5	0	0	0	111.5	M33 T40 Y41	M33-I37 WeakPolarHBondContact O-CG1 3.14Å; M33-I37 PolarHBondContact O-N 3.41Å; M33-I37 VanDerWaalsContact O-N 3.17Å; I37-T40 WeakPolarHBondContact O-CB 3.46Å; I37-T40 PolarHBondContact O-N 3.09Å; I37-Y41 HydrophobicContact CG2-CD2 3.93Å; I37-Y41 HydrophobicContact CG2-CE2 3.59Å; I37-Y41 VanDerWaalsContact O-CD2 3.23Å; I37-Y41 WeakPolarHBondContact O-CD2 3.21Å; I37-Y41 PolarHBondContact O-N 3.43Å
38	K	95.5	Very high	95	Very high	178 Å²	178	84.1 Å²	84.1	77%	0.774	43%	0.426	S	S	*	.	H	α-helix	trans	-58.7	-50.8	-177.1	-171.9	179.7	-177.4	178.6	0	113.3	T40 Y41 A42	K38-T40 VanDerWaalsContact C-N 3.28Å; K38-T40 PolarHBondContact O-N 2.89Å; K38-Y41 PolarHBondContact O-N 3.11Å; K38-A42 PolarHBondContact O-N 3.1Å
39	P	95.9	Very high	95.2	Very high	36 Å²	36	83.8 Å²	83.8	23%	0.234	43%	0.425	C	S	.	.	H	α-helix	trans	-66	-27.7	177.7	24.3	-33.1	0	0	0	113.2	R35 D36 A42 N44 A47	R35-P39 WeakPolarHBondContact O-CD 3.48Å; R35-P39 WeakPolarHBondContact O-CG 3.2Å; D36-P39 WeakPolarHBondContact O-CD 3.41Å; D36-P39 WeakPolarHBondContact O-CG 3.4Å; P39-A42 CarbonylContact O-C 3.59Å; P39-A42 PolarHBondContact O-N 3.44Å; P39-A42 VanDerWaalsContact O-N 3.15Å; P39-N44 HydrophobicContact CB-CB 4.14Å; P39-N44 WeakPolarHBondContact O-CB 3.26Å; P39-N44 PolarHBondContact O-N 2.97Å; P39-N44 VanDerWaalsContact O-N 3.12Å; P39-A47 HydrophobicContact CB-CB 3.77Å; P39-A47 HydrophobicContact CG-CB 3.71Å
40	T	95.5	Very high	95.3	Very high	40 Å²	40	89.5 Å²	89.5	25%	0.245	45%	0.446	C	S	.	.	H	α-helix	trans	-62.6	-43.1	173.9	-62.9	0	0	0	0	111.6	D36 I37 K38 A42 N43 A48 L51	D36-T40 VanDerWaalsContact O-CB 3.27Å; D36-T40 WeakPolarHBondContact O-CB 3.49Å; D36-T40 PolarHBondContact O-N 2.91Å; D36-T40 PolarHBondContact O-OG1 3.23Å; I37-T40 WeakPolarHBondContact O-CB 3.46Å; I37-T40 PolarHBondContact O-N 3.09Å; K38-T40 VanDerWaalsContact C-N 3.28Å; K38-T40 PolarHBondContact O-N 2.89Å; T40-A42 PolarHBondContact O-N 3.03Å; T40-N43 PolarHBondContact O-N 3.36Å; T40-N43 VanDerWaalsContact O-N 3.09Å; T40-A48 HydrophobicContact CG2-CB 4Å; T40-A48 PolarHBondContact OG1-N 3.39Å; T40-L51 HydrophobicContact CG2-CD2 4.17Å
41	Y	95.3	Very high	95.3	Very high	204 Å²	204	86.8 Å²	86.8	80%	0.8	43%	0.432	S	S	*	.	H	α-helix	trans	-64.3	-26	174.1	-75.8	-70.5	0	0	0	113.3	I37 K38 N43	I37-Y41 HydrophobicContact CG2-CD2 3.93Å; I37-Y41 HydrophobicContact CG2-CE2 3.59Å; I37-Y41 VanDerWaalsContact O-CD2 3.23Å; I37-Y41 WeakPolarHBondContact O-CD2 3.21Å; I37-Y41 PolarHBondContact O-N 3.43Å; K38-Y41 PolarHBondContact O-N 3.11Å; Y41-N43 PolarHBondContact O-N 3.3Å
42	A	94.6	Very high	95.4	Very high	80 Å²	80	87.6 Å²	87.6	66%	0.661	43%	0.434	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.1	17.6	173.6	0	0	0	0	0	113.6	K38 P39 T40 N44	K38-A42 PolarHBondContact O-N 3.1Å; P39-A42 CarbonylContact O-C 3.59Å; P39-A42 PolarHBondContact O-N 3.44Å; P39-A42 VanDerWaalsContact O-N 3.15Å; T40-A42 PolarHBondContact O-N 3.03Å; A42-N44 VanDerWaalsContact C-N 3.25Å; A42-N44 PolarHBondContact O-N 2.86Å
43	N	92.6	Very high	95.5	Very high	134 Å²	134	91.3 Å²	91.3	72%	0.717	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.4	29.2	-178.8	-164.6	42	0	0	0	114	T40 Y41 K45	T40-N43 PolarHBondContact O-N 3.36Å; T40-N43 VanDerWaalsContact O-N 3.09Å; Y41-N43 PolarHBondContact O-N 3.3Å; N43-K45 PolarHBondContact O-N 3.13Å
44	N	94.5	Very high	95.5	Very high	64 Å²	64	91 Å²	91	34%	0.342	45%	0.448	S	S	.	.			trans	-78.2	102.8	172.8	-172.7	-20.5	0	0	0	110.4	P39 A42 N46 A47 A48	P39-N44 HydrophobicContact CB-CB 4.14Å; P39-N44 WeakPolarHBondContact O-CB 3.26Å; P39-N44 PolarHBondContact O-N 2.97Å; P39-N44 VanDerWaalsContact O-N 3.12Å; A42-N44 VanDerWaalsContact C-N 3.25Å; A42-N44 PolarHBondContact O-N 2.86Å; N44-N46 VanDerWaalsContact C-N 3.26Å; N44-N46 PolarHBondContact O-N 3.03Å; N44-N46 PolarHBondContact OD1-N 3.03Å; N44-N46 VanDerWaalsContact OD1-N 3.09Å; N44-A47 HydrophobicContact CB-CB 4Å; N44-A47 PolarHBondContact O-N 2.88Å; N44-A47 PolarHBondContact OD1-N 3.33Å; N44-A48 PolarHBondContact O-N 3.28Å
45	K	95	Very high	95.5	Very high	166 Å²	166	92.5 Å²	92.5	72%	0.722	45%	0.445	S	S	*	.	H	α-helix	trans	-55.5	-37.4	-179.8	-62.8	-175.7	179.9	179.9	0	113.5	N43 A48 E49	N43-K45 PolarHBondContact O-N 3.13Å; K45-A48 PolarHBondContact O-N 2.94Å; K45-E49 WeakPolarHBondContact O-CG 3.48Å; K45-E49 PolarHBondContact O-N 3.36Å
46	N	95.7	Very high	95.6	Very high	116 Å²	116	90.7 Å²	90.7	62%	0.62	44%	0.442	S	S	*	.	H	α-helix	trans	-69.2	-42.4	-179.6	-67.2	-69.2	0	0	0	111.6	N44 A48 E49 R50	N44-N46 VanDerWaalsContact C-N 3.26Å; N44-N46 PolarHBondContact O-N 3.03Å; N44-N46 PolarHBondContact OD1-N 3.03Å; N44-N46 VanDerWaalsContact OD1-N 3.09Å; N46-A48 VanDerWaalsContact C-N 3.33Å; N46-E49 PolarHBondContact O-N 3.41Å; N46-R50 WeakPolarHBondContact O-CG 3.5Å; N46-R50 PolarHBondContact O-N 3.43Å
47	A	95.5	Very high	95.5	Very high	0 Å²	0	92.6 Å²	92.6	0%	0	46%	0.455	C	S	.	.	H	α-helix	trans	-63.9	-40.7	175.7	0	0	0	0	0	111.3	D36 P39 N44 E49 R50 L51	D36-A47 HydrophobicContact CB-CB 4.42Å; P39-A47 HydrophobicContact CB-CB 3.77Å; P39-A47 HydrophobicContact CG-CB 3.71Å; N44-A47 HydrophobicContact CB-CB 4Å; N44-A47 PolarHBondContact O-N 2.88Å; N44-A47 PolarHBondContact OD1-N 3.33Å; A47-E49 PolarHBondContact O-N 3.19Å; A47-R50 PolarHBondContact O-N 3.33Å; A47-L51 VanDerWaalsContact O-CB 3.3Å; A47-L51 WeakPolarHBondContact O-CB 3.25Å; A47-L51 PolarHBondContact O-N 3.45Å
48	A	96	Very high	95.5	Very high	35 Å²	35	89.2 Å²	89.2	29%	0.289	44%	0.439	S	S	.	.	H	α-helix	trans	-60.8	-44.4	176.6	0	0	0	0	0	112.4	T40 N44 K45 N46 L51 K52	T40-A48 HydrophobicContact CG2-CB 4Å; T40-A48 PolarHBondContact OG1-N 3.39Å; N44-A48 PolarHBondContact O-N 3.28Å; K45-A48 PolarHBondContact O-N 2.94Å; N46-A48 VanDerWaalsContact C-N 3.33Å; A48-L51 PolarHBondContact O-N 2.96Å; A48-K52 WeakPolarHBondContact O-CB 3.48Å; A48-K52 PolarHBondContact O-N 2.91Å
49	E	96.4	Very high	95.5	Very high	103 Å²	103	89 Å²	89	48%	0.481	43%	0.433	S	S	.	.	H	α-helix	trans	-66.3	-40.8	177.1	-75.3	-61.8	113.7	0	0	112.5	K45 N46 A47 K52 K53	K45-E49 WeakPolarHBondContact O-CG 3.48Å; K45-E49 PolarHBondContact O-N 3.36Å; N46-E49 PolarHBondContact O-N 3.41Å; A47-E49 PolarHBondContact O-N 3.19Å; E49-K52 PolarHBondContact O-N 3.16Å; E49-K53 WeakPolarHBondContact O-CG 3.37Å; E49-K53 PolarHBondContact O-N 3.03Å
50	R	96.1	Very high	95.4	Very high	124 Å²	124	90.8 Å²	90.8	47%	0.468	44%	0.44	S	S	.	.	H	α-helix	trans	-62.3	-46.2	173.5	-73.1	-168.6	-57.1	-124.5	0.4	111.7	D36 N46 A47 K52 K53 N54	D36-R50 IonicContact OD1-CZ 3.89Å; D36-R50 VanDerWaalsContact OD1-CZ 3.31Å; D36-R50 IonicContact OD1-NE 3.7Å; D36-R50 PolarHBondContact OD1-NE 3.45Å; D36-R50 VanDerWaalsContact OD1-NE 3.09Å; D36-R50 IonicContact OD1-NH2 3.19Å; D36-R50 PolarHBondContact OD1-NH2 3.19Å; D36-R50 WeakPolarHBondContact OD2-CB 3.45Å; D36-R50 IonicContact OD2-NE 3.09Å; D36-R50 PolarHBondContact OD2-NE 2.92Å; N46-R50 WeakPolarHBondContact O-CG 3.5Å; N46-R50 PolarHBondContact O-N 3.43Å; A47-R50 PolarHBondContact O-N 3.33Å; R50-K52 VanDerWaalsContact C-N 3.31Å; R50-K52 PolarHBondContact O-N 2.95Å; R50-K53 PolarHBondContact O-N 3.25Å; R50-N54 WeakPolarHBondContact O-CB 3.49Å; R50-N54 PolarHBondContact O-N 3.06Å
51	L	96.6	Very high	95.2	Very high	30 Å²	30	89.6 Å²	89.6	16%	0.157	43%	0.432	C	S	.	.	H	α-helix	trans	-57.5	-46	177	-177.6	58.8	0	0	0	111	M33 D36 T40 A47 A48 K53 N54 I55	M33-L51 HydrophobicContact CB-CD1 3.85Å; M33-L51 HydrophobicContact CG-CD1 3.92Å; D36-L51 HydrophobicContact CB-CB 4.13Å; T40-L51 HydrophobicContact CG2-CD2 4.17Å; A47-L51 VanDerWaalsContact O-CB 3.3Å; A47-L51 WeakPolarHBondContact O-CB 3.25Å; A47-L51 PolarHBondContact O-N 3.45Å; A48-L51 PolarHBondContact O-N 2.96Å; L51-K53 PolarHBondContact O-N 3.2Å; L51-N54 PolarHBondContact O-N 3.44Å; L51-I55 HydrophobicContact CD1-CD1 4.11Å; L51-I55 HydrophobicContact CD1-CG1 4.35Å; L51-I55 HydrophobicContact CG-CD1 3.92Å; L51-I55 WeakPolarHBondContact O-CB 3.31Å; L51-I55 WeakPolarHBondContact O-CG1 3.47Å; L51-I55 PolarHBondContact O-N 2.84Å
52	K	96.3	Very high	95.1	Very high	142 Å²	142	83.1 Å²	83.1	62%	0.617	41%	0.413	S	S	*	.	H	α-helix	trans	-60.3	-43.9	177.2	-167.4	-175.6	-167.6	179.7	0	112.5	A48 E49 R50 H56	A48-K52 WeakPolarHBondContact O-CB 3.48Å; A48-K52 PolarHBondContact O-N 2.91Å; E49-K52 PolarHBondContact O-N 3.16Å; R50-K52 VanDerWaalsContact C-N 3.31Å; R50-K52 PolarHBondContact O-N 2.95Å; K52-H56 PolarHBondContact O-N 3.09Å; K52-H56 VanDerWaalsContact O-N 3.11Å
53	K	96.1	Very high	95.1	Very high	141 Å²	141	88.5 Å²	88.5	61%	0.613	42%	0.417	S	S	*	.	H	α-helix	trans	-62.9	-47.6	176.2	-74.1	174.2	176.8	179.5	0	111.3	E49 R50 L51 I55 H56 T57	E49-K53 WeakPolarHBondContact O-CG 3.37Å; E49-K53 PolarHBondContact O-N 3.03Å; R50-K53 PolarHBondContact O-N 3.25Å; L51-K53 PolarHBondContact O-N 3.2Å; K53-I55 PolarHBondContact O-N 3.17Å; K53-H56 WeakPolarHBondContact O-CB 3.5Å; K53-H56 PolarHBondContact O-N 3.09Å; K53-H56 VanDerWaalsContact O-N 3.09Å; K53-T57 PolarHBondContact O-N 3.23Å; K53-T57 PolarHBondContact O-OG1 3.47Å; K53-T57 VanDerWaalsContact O-OG1 3.13Å
54	N	95.8	Very high	94.9	Very high	25 Å²	25	86.8 Å²	86.8	13%	0.134	41%	0.405	C	S	.	.	H	α-helix	trans	-64	-39.1	179.9	-73.4	-10.9	0	0	0	112.2	V29 E32 M33 R50 L51 H56 T57 A58	V29-N54 HydrophobicContact CG1-CB 3.93Å; V29-N54 VanDerWaalsContact CG1-O 3.31Å; V29-N54 WeakPolarHBondContact CG1-O 3.48Å; E32-N54 WeakPolarHBondContact CB-ND2 3.36Å; M33-N54 HydrophobicContact CG-CB 3.48Å; M33-N54 VanDerWaalsContact CG-CB 3.48Å; M33-N54 HydrophobicContact SD-CB 4.2Å; R50-N54 WeakPolarHBondContact O-CB 3.49Å; R50-N54 PolarHBondContact O-N 3.06Å; L51-N54 PolarHBondContact O-N 3.44Å; N54-H56 VanDerWaalsContact C-N 3.31Å; N54-H56 PolarHBondContact O-N 3.19Å; N54-T57 PolarHBondContact O-N 3.02Å; N54-A58 WeakPolarHBondContact O-CB 3.46Å; N54-A58 PolarHBondContact O-N 3.41Å
55	I	96.6	Very high	94.6	Very high	78 Å²	78	85.7 Å²	85.7	40%	0.4	40%	0.401	S	S	.	.	H	α-helix	trans	-60.4	-42.4	172.4	-69.3	165.3	0	0	0	110.8	M33 L51 K53 R59	M33-I55 HydrophobicContact SD-CB 4.37Å; M33-I55 HydrophobicContact SD-CG1 3.58Å; M33-I55 VanDerWaalsContact SD-CG1 3.58Å; L51-I55 HydrophobicContact CD1-CD1 4.11Å; L51-I55 HydrophobicContact CD1-CG1 4.35Å; L51-I55 HydrophobicContact CG-CD1 3.92Å; L51-I55 WeakPolarHBondContact O-CB 3.31Å; L51-I55 WeakPolarHBondContact O-CG1 3.47Å; L51-I55 PolarHBondContact O-N 2.84Å; K53-I55 PolarHBondContact O-N 3.17Å; I55-R59 VanDerWaalsContact O-CG 3.26Å; I55-R59 WeakPolarHBondContact O-CG 3.29Å; I55-R59 PolarHBondContact O-N 3.42Å; I55-R59 VanDerWaalsContact O-N 3.1Å
56	H	96.6	Very high	94.4	Very high	115 Å²	115	81.3 Å²	81.3	53%	0.532	39%	0.388	S	S	.	.	H	α-helix	trans	-64.6	-47.2	177.6	-174.4	72.9	0	0	0	111.9	K52 K53 N54 R59 I60	K52-H56 PolarHBondContact O-N 3.09Å; K52-H56 VanDerWaalsContact O-N 3.11Å; K53-H56 WeakPolarHBondContact O-CB 3.5Å; K53-H56 PolarHBondContact O-N 3.09Å; K53-H56 VanDerWaalsContact O-N 3.09Å; N54-H56 VanDerWaalsContact C-N 3.31Å; N54-H56 PolarHBondContact O-N 3.19Å; H56-R59 WeakPolarHBondContact O-CB 3.43Å; H56-R59 PolarHBondContact O-N 3.33Å; H56-I60 WeakPolarHBondContact NE2-CD1 3.3Å; H56-I60 PolarHBondContact O-N 3.15Å; H56-I60 VanDerWaalsContact O-N 3.1Å
57	T	93.9	Very high	94.1	Very high	51 Å²	51	77.9 Å²	77.9	31%	0.313	37%	0.374	S	S	.	.	H	α-helix	trans	-59.7	-47.6	176.7	-56.3	0	0	0	0	111.6	V29 K53 N54 R59 I60 L61	V29-T57 HydrophobicContact CG2-CG2 4.31Å; K53-T57 PolarHBondContact O-N 3.23Å; K53-T57 PolarHBondContact O-OG1 3.47Å; K53-T57 VanDerWaalsContact O-OG1 3.13Å; N54-T57 PolarHBondContact O-N 3.02Å; T57-R59 VanDerWaalsContact C-N 3.26Å; T57-R59 PolarHBondContact O-N 3.41Å; T57-I60 PolarHBondContact O-N 3.38Å; T57-I60 VanDerWaalsContact O-N 3.09Å; T57-L61 HydrophobicContact CG2-CD1 4.11Å; T57-L61 HydrophobicContact CG2-CG 4.5Å; T57-L61 WeakPolarHBondContact O-CG 3.41Å; T57-L61 PolarHBondContact O-N 3.46Å
58	A	95.5	Very high	93.6	Very high	12 Å²	12	81 Å²	81	10%	0.099	39%	0.388	C	S	.	.	H	α-helix	trans	-57.2	-40.9	176.9	0	0	0	0	0	111.8	L26 V29 M33 N54 I60 L61 V62	L26-A58 HydrophobicContact CD1-CB 4.07Å; V29-A58 HydrophobicContact CG1-CB 3.88Å; M33-A58 HydrophobicContact CE-CB 4.2Å; N54-A58 WeakPolarHBondContact O-CB 3.46Å; N54-A58 PolarHBondContact O-N 3.41Å; A58-I60 PolarHBondContact O-N 2.95Å; A58-L61 PolarHBondContact O-N 3.1Å; A58-V62 WeakPolarHBondContact O-CB 3.22Å; A58-V62 VanDerWaalsContact O-CG2 3.25Å; A58-V62 WeakPolarHBondContact O-CG2 3.49Å; A58-V62 PolarHBondContact O-N 3.18Å
59	R	95.8	Very high	93.2	Very high	173 Å²	173	84.1 Å²	84.1	65%	0.653	40%	0.399	S	S	*	.	H	α-helix	trans	-64.3	-38.9	176.5	-73.9	174.4	67.1	-177.9	1.8	112.8	I55 H56 T57 R63	I55-R59 VanDerWaalsContact O-CG 3.26Å; I55-R59 WeakPolarHBondContact O-CG 3.29Å; I55-R59 PolarHBondContact O-N 3.42Å; I55-R59 VanDerWaalsContact O-N 3.1Å; H56-R59 WeakPolarHBondContact O-CB 3.43Å; H56-R59 PolarHBondContact O-N 3.33Å; T57-R59 VanDerWaalsContact C-N 3.26Å; T57-R59 PolarHBondContact O-N 3.41Å; R59-R63 VanDerWaalsContact O-CG 3.3Å; R59-R63 WeakPolarHBondContact O-CG 3.33Å; R59-R63 PolarHBondContact O-N 3.28Å; R59-R63 VanDerWaalsContact O-N 3.16Å
60	I	93.2	Very high	92.9	Very high	73 Å²	73	84.2 Å²	84.2	37%	0.374	40%	0.4	S	S	.	.	H	α-helix	trans	-64.4	-52.4	176.3	-67.5	167.6	0	0	0	109.4	H56 T57 A58 V62 R63 E64	H56-I60 WeakPolarHBondContact NE2-CD1 3.3Å; H56-I60 PolarHBondContact O-N 3.15Å; H56-I60 VanDerWaalsContact O-N 3.1Å; T57-I60 PolarHBondContact O-N 3.38Å; T57-I60 VanDerWaalsContact O-N 3.09Å; A58-I60 PolarHBondContact O-N 2.95Å; I60-V62 VanDerWaalsContact C-N 3.32Å; I60-V62 PolarHBondContact O-N 3.33Å; I60-R63 WeakPolarHBondContact O-CB 3.49Å; I60-R63 PolarHBondContact O-N 3.36Å; I60-E64 HydrophobicContact CG2-CG 4.4Å; I60-E64 WeakPolarHBondContact O-CG 3.46Å; I60-E64 PolarHBondContact O-N 2.96Å
61	L	91.7	Very high	92.5	Very high	16 Å²	16	87.1 Å²	87.1	8%	0.084	41%	0.411	C	S	.	.	H	α-helix	trans	-55.2	-46.3	-180	-71.1	169.7	0	0	0	111.9	H25 L26 V29 T57 A58 R63 E64 C65	H25-L61 HydrophobicContact CB-CD1 4.4Å; L26-L61 HydrophobicContact CD1-CB 4.44Å; V29-L61 HydrophobicContact CG2-CD1 4.38Å; T57-L61 HydrophobicContact CG2-CD1 4.11Å; T57-L61 HydrophobicContact CG2-CG 4.5Å; T57-L61 WeakPolarHBondContact O-CG 3.41Å; T57-L61 PolarHBondContact O-N 3.46Å; A58-L61 PolarHBondContact O-N 3.1Å; L61-R63 VanDerWaalsContact C-N 3.33Å; L61-R63 PolarHBondContact O-N 3.03Å; L61-E64 PolarHBondContact O-N 3.03Å; L61-C65 PolarHBondContact O-N 3.03Å; L61-C65 PolarHBondContact O-SG 3Å
62	V	93	Very high	92	Very high	67 Å²	67	90.4 Å²	90.4	41%	0.406	43%	0.432	S	S	.	.	H	α-helix	trans	-62.1	-40.8	178	171	0	0	0	0	111.5	L26 A58 I60 E64 C65 V66	L26-V62 HydrophobicContact CD1-CG2 3.97Å; L26-V62 HydrophobicContact CD2-CG2 3.91Å; A58-V62 WeakPolarHBondContact O-CB 3.22Å; A58-V62 VanDerWaalsContact O-CG2 3.25Å; A58-V62 WeakPolarHBondContact O-CG2 3.49Å; A58-V62 PolarHBondContact O-N 3.18Å; I60-V62 VanDerWaalsContact C-N 3.32Å; I60-V62 PolarHBondContact O-N 3.33Å; V62-E64 VanDerWaalsContact C-N 3.34Å; V62-E64 PolarHBondContact O-N 3.3Å; V62-C65 PolarHBondContact O-N 3.28Å; V62-V66 HydrophobicContact CG1-CG2 4.35Å; V62-V66 WeakPolarHBondContact O-CB 3.2Å; V62-V66 VanDerWaalsContact O-CG2 3.27Å; V62-V66 WeakPolarHBondContact O-CG2 3.3Å; V62-V66 PolarHBondContact O-N 3.43Å
63	R	93.3	Very high	91.5	Very high	193 Å²	193	90.6 Å²	90.6	73%	0.728	44%	0.437	S	S	*	.	H	α-helix	trans	-64.6	-39	176.8	-74.1	-178.3	72.7	-141.5	-0.4	112.2	R59 I60 L61 S67	R59-R63 VanDerWaalsContact O-CG 3.3Å; R59-R63 WeakPolarHBondContact O-CG 3.33Å; R59-R63 PolarHBondContact O-N 3.28Å; R59-R63 VanDerWaalsContact O-N 3.16Å; I60-R63 WeakPolarHBondContact O-CB 3.49Å; I60-R63 PolarHBondContact O-N 3.36Å; L61-R63 VanDerWaalsContact C-N 3.33Å; L61-R63 PolarHBondContact O-N 3.03Å; R63-S67 WeakPolarHBondContact O-CB 3.39Å; R63-S67 PolarHBondContact O-N 3.17Å
64	E	89.8	Confident	90.7	Very high	99 Å²	99	92.3 Å²	92.3	46%	0.463	44%	0.444	S	S	.	.	H	α-helix	trans	-64.8	-47.2	176.4	-68.1	180	118.7	0	0	111	I60 L61 V62 V66 S67 E68	I60-E64 HydrophobicContact CG2-CG 4.4Å; I60-E64 WeakPolarHBondContact O-CG 3.46Å; I60-E64 PolarHBondContact O-N 2.96Å; L61-E64 PolarHBondContact O-N 3.03Å; V62-E64 VanDerWaalsContact C-N 3.34Å; V62-E64 PolarHBondContact O-N 3.3Å; E64-V66 PolarHBondContact O-N 3.41Å; E64-S67 PolarHBondContact O-N 3.21Å; E64-E68 WeakPolarHBondContact O-CB 3.3Å; E64-E68 PolarHBondContact O-N 2.7Å
65	C	87.4	Confident	89.1	Confident	40 Å²	40	97.7 Å²	97.7	27%	0.27	49%	0.492	S	S	.	.	H	α-helix	trans	-61.4	-42.5	176.8	-65.4	0	0	0	0	112.5	L61 V62 E68 L69	L61-C65 PolarHBondContact O-N 3.03Å; L61-C65 PolarHBondContact O-SG 3Å; V62-C65 PolarHBondContact O-N 3.28Å; C65-E68 PolarHBondContact O-N 3.3Å; C65-L69 WeakPolarHBondContact O-CB 3.48Å; C65-L69 PolarHBondContact O-N 2.67Å
66	V	90.6	Very high	88.7	Confident	74 Å²	74	98.7 Å²	98.7	45%	0.448	50%	0.497	S	S	.	.	H	α-helix	trans	-64.2	-45.7	176.4	170.8	0	0	0	0	110.7	V62 E64 E68 L69 E70	V62-V66 HydrophobicContact CG1-CG2 4.35Å; V62-V66 WeakPolarHBondContact O-CB 3.2Å; V62-V66 VanDerWaalsContact O-CG2 3.27Å; V62-V66 WeakPolarHBondContact O-CG2 3.3Å; V62-V66 PolarHBondContact O-N 3.43Å; E64-V66 PolarHBondContact O-N 3.41Å; V66-E68 VanDerWaalsContact C-N 3.31Å; V66-E68 PolarHBondContact O-N 3.31Å; V66-L69 PolarHBondContact O-N 3.3Å; V66-E70 HydrophobicContact CG1-CG 4.41Å; V66-E70 WeakPolarHBondContact O-CG 3.12Å; V66-E70 PolarHBondContact O-N 3.09Å
67	S	89.1	Confident	88.3	Confident	45 Å²	45	97.8 Å²	97.8	32%	0.315	50%	0.495	S	S	.	.	H	α-helix	trans	-64.1	-36.6	-179.8	-171.4	0	0	0	0	112.6	R63 E64 R71	R63-S67 WeakPolarHBondContact O-CB 3.39Å; R63-S67 PolarHBondContact O-N 3.17Å; E64-S67 PolarHBondContact O-N 3.21Å; S67-R71 WeakPolarHBondContact O-CG 3.19Å; S67-R71 PolarHBondContact O-N 3.24Å; S67-R71 VanDerWaalsContact O-N 3.16Å
68	E	85.6	Confident	87.9	Confident	64 Å²	64	100.4 Å²	100.4	30%	0.299	51%	0.505	S	S	.	.	H	α-helix	trans	-66.6	-45.1	174.1	-176.1	163.6	58.2	0	0	111.8	D19 K22 E64 C65 V66 E70 R71 V72	D19-E68 VanDerWaalsContact OD1-CD 3.26Å; K22-E68 IonicContact NZ-OE1 2.68Å; K22-E68 PolarHBondContact NZ-OE1 2.97Å; K22-E68 IonicContact NZ-OE2 2.7Å; K22-E68 PolarHBondContact NZ-OE2 3.22Å; E64-E68 WeakPolarHBondContact O-CB 3.3Å; E64-E68 PolarHBondContact O-N 2.7Å; C65-E68 PolarHBondContact O-N 3.3Å; V66-E68 VanDerWaalsContact C-N 3.31Å; V66-E68 PolarHBondContact O-N 3.31Å; E68-E70 VanDerWaalsContact C-N 3.32Å; E68-E70 PolarHBondContact O-N 3.12Å; E68-R71 WeakPolarHBondContact O-CB 3.38Å; E68-R71 PolarHBondContact O-N 3.3Å; E68-R71 VanDerWaalsContact O-N 3.09Å; E68-V72 WeakPolarHBondContact O-CG2 3.4Å; E68-V72 PolarHBondContact O-N 3.15Å
69	L	87	Confident	87.5	Confident	102 Å²	102	105.6 Å²	105.6	53%	0.534	53%	0.529	S	S	.	.	H	α-helix	trans	-59.5	-43.1	174.6	-176.8	62.9	0	0	0	111.5	C65 V66 R71 V72 M73	C65-L69 WeakPolarHBondContact O-CB 3.48Å; C65-L69 PolarHBondContact O-N 2.67Å; V66-L69 PolarHBondContact O-N 3.3Å; L69-R71 VanDerWaalsContact C-N 3.27Å; L69-R71 PolarHBondContact O-N 3.06Å; L69-V72 PolarHBondContact O-N 3.46Å; L69-M73 HydrophobicContact CD1-CG 4.1Å; L69-M73 HydrophobicContact CD1-SD 4.13Å; L69-M73 HydrophobicContact CD2-SD 4.36Å; L69-M73 HydrophobicContact CG-CG 4.26Å; L69-M73 HydrophobicContact CG-SD 3.86Å; L69-M73 WeakPolarHBondContact O-CB 3.46Å; L69-M73 VanDerWaalsContact O-CG 3.24Å; L69-M73 WeakPolarHBondContact O-CG 3.27Å; L69-M73 PolarHBondContact O-N 3.37Å
70	E	91	Very high	87	Confident	105 Å²	105	101.4 Å²	101.4	49%	0.491	52%	0.522	S	S	.	.	H	α-helix	trans	-61.4	-33	175.6	-73.5	-177.9	134.8	0	0	113	V66 E68 K74	V66-E70 HydrophobicContact CG1-CG 4.41Å; V66-E70 WeakPolarHBondContact O-CG 3.12Å; V66-E70 PolarHBondContact O-N 3.09Å; E68-E70 VanDerWaalsContact C-N 3.32Å; E68-E70 PolarHBondContact O-N 3.12Å; E70-K74 WeakPolarHBondContact O-CB 3.42Å; E70-K74 VanDerWaalsContact O-CG 3.25Å; E70-K74 WeakPolarHBondContact O-CG 3.23Å; E70-K74 PolarHBondContact O-N 3.5Å
71	R	88	Confident	86.6	Confident	184 Å²	184	103.3 Å²	103.3	69%	0.694	53%	0.531	S	S	*	.	H	α-helix	trans	-71.4	-44.1	175	-70.5	170.3	-171.4	-165.1	2.5	111.3	S67 E68 L69 K74 A75	S67-R71 WeakPolarHBondContact O-CG 3.19Å; S67-R71 PolarHBondContact O-N 3.24Å; S67-R71 VanDerWaalsContact O-N 3.16Å; E68-R71 WeakPolarHBondContact O-CB 3.38Å; E68-R71 PolarHBondContact O-N 3.3Å; E68-R71 VanDerWaalsContact O-N 3.09Å; L69-R71 VanDerWaalsContact C-N 3.27Å; L69-R71 PolarHBondContact O-N 3.06Å; R71-K74 PolarHBondContact O-N 3.38Å; R71-A75 PolarHBondContact O-N 3.22Å; R71-A75 VanDerWaalsContact O-N 3.12Å
72	V	86.1	Confident	86.2	Confident	99 Å²	99	109.6 Å²	109.6	60%	0.6	56%	0.563	S	S	*	*	H	α-helix	trans	-66.3	-37.6	178.7	174.9	0	0	0	0	111.4	E68 L69 K74	E68-V72 WeakPolarHBondContact O-CG2 3.4Å; E68-V72 PolarHBondContact O-N 3.15Å; L69-V72 PolarHBondContact O-N 3.46Å; V72-K74 VanDerWaalsContact C-N 3.31Å; V72-K74 PolarHBondContact O-N 3.24Å
73	M	85.1	Confident	85.7	Confident	146 Å²	146	112.8 Å²	112.8	72%	0.719	58%	0.575	S	S	*	*	H	α-helix	trans	-74.2	-19.1	178.3	-68.1	-178.8	93.9	0	0	113.8	L69	L69-M73 HydrophobicContact CD1-CG 4.1Å; L69-M73 HydrophobicContact CD1-SD 4.13Å; L69-M73 HydrophobicContact CD2-SD 4.36Å; L69-M73 HydrophobicContact CG-CG 4.26Å; L69-M73 HydrophobicContact CG-SD 3.86Å; L69-M73 WeakPolarHBondContact O-CB 3.46Å; L69-M73 VanDerWaalsContact O-CG 3.24Å; L69-M73 WeakPolarHBondContact O-CG 3.27Å; L69-M73 PolarHBondContact O-N 3.37Å
74	K	79.3	Confident	85	Confident	177 Å²	177	106.2 Å²	106.2	77%	0.77	56%	0.563	S	S	*	*	H	α-helix	trans	-97.1	-15.5	178	-73.7	-179.7	-175.8	-179	0	113.7	E70 R71 V72	E70-K74 WeakPolarHBondContact O-CB 3.42Å; E70-K74 VanDerWaalsContact O-CG 3.25Å; E70-K74 WeakPolarHBondContact O-CG 3.23Å; E70-K74 PolarHBondContact O-N 3.5Å; R71-K74 PolarHBondContact O-N 3.38Å; V72-K74 VanDerWaalsContact C-N 3.31Å; V72-K74 PolarHBondContact O-N 3.24Å
75	A	61.5	Low	84.6	Confident	139 Å²	139	106.8 Å²	106.8	100%	1.149	57%	0.572	S	S	*	*			trans	-81.3	0	173.1	0	0	0	0	0	110.6	R71	R71-A75 PolarHBondContact O-N 3.22Å; R71-A75 VanDerWaalsContact O-N 3.12Å

Retrieved 75 of 75 residues in 43.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).